F466612
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 586 | 442 | 1172 | 292 |
Family's Representative Sequence
| Representative Sequence | 3300053136|Ga0500559_0001477|Ga0500559_0001477_8057_9112 |
| Length | 344 |
| Sequence | MKNRRGLPRIDAVVGFDIIAGCRTELMQAAEARKLKVLDGVAMIRHQLPQQTAFWCREMSDDIHTIAAGGITAAIKADGAELCSLQTADGLDLLWQAGPAWPRHAPLLFPIVGRLKDDVLRHQGKTYSMTQHGFARDLRFEWRDRSTQSCTLVLTDSDAIQARYPFAFRLTVSYRVDATSLDTTIEIANPGEAMLPASFGAHPAFNWPLSPDLAKESYRLIFPQAEPAPIRRLTGGLMRAAGMVLPLSERLFADDAVILDHPVSSSVRYVGECGPSLEIAWEGFRELGIWSKPSGAPFLCIEPWRGYASPVDFGGEFADKPGLMQIAPGAVETLRYRVTVRDQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 6 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 8 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 30 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 36 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 37 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 38 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 39 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 40 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 41 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 42 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 43 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 44 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 46 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 47 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 48 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 50 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 51 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 52 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 53 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 55 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 56 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 74 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 75 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 76 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 77 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 80 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 81 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 82 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 84 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 85 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 113 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 114 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 115 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 116 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 119 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 120 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 121 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 122 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 123 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 124 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 126 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 127 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 128 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 129 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 131 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 132 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 133 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 134 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 135 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 136 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 137 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 138 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 139 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 140 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 141 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 142 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 143 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 144 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 145 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 146 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 147 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 148 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 149 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 150 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 151 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 152 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 153 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 154 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 155 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 156 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 189 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 190 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 191 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 192 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 193 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 194 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 196 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 197 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 198 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 199 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 200 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 201 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 202 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 203 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 204 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 205 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 206 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 207 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 208 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 216 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 217 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 218 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 219 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 220 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 221 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 222 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 223 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 224 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 226 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 227 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 228 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 229 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 230 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 231 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 232 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 233 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 234 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 235 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 236 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 237 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 238 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 239 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 240 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 241 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 242 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 243 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 244 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 245 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 246 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 247 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 248 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 249 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 250 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 251 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 252 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 253 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 254 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 255 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 256 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 257 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 258 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 259 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 260 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 261 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 262 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 263 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 264 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 265 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 266 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 267 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 268 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 269 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 270 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 271 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 272 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 273 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 274 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 275 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 276 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 277 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 278 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 279 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 280 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 281 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 282 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 283 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 284 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 285 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 286 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 287 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 288 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 289 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 290 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 291 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 292 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 293 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 294 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 295 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 296 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 297 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 298 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 299 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 300 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 301 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 302 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 303 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 304 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 305 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 306 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 307 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 308 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 309 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 310 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 311 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 312 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 313 | 2848858292 | Azospirillum brasilense Az39 | Isolate | Unclassified |
| 314 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 315 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 316 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 317 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 318 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 319 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 320 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 321 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 322 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 323 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 324 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 325 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 326 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 327 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 328 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 329 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 330 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 331 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 332 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 333 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 334 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 335 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 336 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 337 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 338 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 339 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 340 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 341 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 342 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 343 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 344 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 345 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 346 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 347 | 2922368715 | |||
| 348 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 349 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 350 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 351 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 352 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 353 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 354 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 355 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 356 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 357 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 358 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 359 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 360 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 361 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 362 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 363 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 364 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 365 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 366 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 367 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 368 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 369 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 370 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 371 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 372 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 373 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 374 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 375 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 376 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 377 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 378 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 379 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 380 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 381 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 382 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 383 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 384 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 385 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 386 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 387 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 388 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 389 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 390 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 391 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 392 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 393 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 394 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 395 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 396 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 397 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 398 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 399 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 400 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 401 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 402 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 403 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 404 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 405 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 406 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 407 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 408 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 409 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 410 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 411 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 412 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 413 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 414 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 415 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 416 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 417 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 418 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 419 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 420 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 421 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 422 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 423 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 424 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 425 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 426 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 427 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 428 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 429 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 430 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 431 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 432 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 433 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 434 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 435 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 436 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 437 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 438 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 439 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 440 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 441 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 442 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 68.89 |
| Metatranscriptomes | 0 |
| Isolates | 31.11 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 18.43 |
| Nodule | 23.89 |
| Rhizoplane | 4.27 |
| Rhizosphere | 38.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500559_0001477 | 3300053136 | Bacteria | 13272 |
| 2 | JGI25153J46596_10000127 | 3300003215 | Bacteria | 83368 |
| 3 | JGI25153J46596_10000201 | 3300003215 | Bacteria | 55451 |
| 4 | JGI25153J46596_10011440 | 3300003215 | Bacteria | 3921 |
| 5 | JGI25153J46596_10014157 | 3300003215 | Bacteria | 3332 |
| 6 | JGI25153J46596_10033280 | 3300003215 | Bacteria | 1704 |
| 7 | JGI25153J46596_10040758 | 3300003215 | Bacteria | 1436 |
| 8 | rootH1_10069813 | 3300003316 | Bacteria | 1427 |
| 9 | rootH1_10079915 | 3300003316 | Bacteria | 2268 |
| 10 | rootH2_10064424 | 3300003320 | Bacteria | 2260 |
| 11 | JGI25160J50197_1000386 | 3300003354 | Bacteria | 28574 |
| 12 | JGI25160J50197_1000785 | 3300003354 | Bacteria | 17040 |
| 13 | Ga0055531_10009083 | 3300003794 | Bacteria | 5127 |
| 14 | Ga0055543_1001354 | 3300004625 | Bacteria | 9919 |
| 15 | Ga0065165_1001118 | 3300005262 | Bacteria | 31690 |
| 16 | Ga0065165_1025955 | 3300005262 | Bacteria | 1935 |
| 17 | Ga0070658_10035558 | 3300005327 | Bacteria | 4013 |
| 18 | Ga0070658_10035588 | 3300005327 | Bacteria | 4011 |
| 19 | Ga0070683_100188812 | 3300005329 | Bacteria | 1956 |
| 20 | Ga0070670_100128187 | 3300005331 | Bacteria | 2190 |
| 21 | Ga0070666_10320974 | 3300005335 | Bacteria | 1105 |
| 22 | Ga0070682_100348122 | 3300005337 | Bacteria | 1104 |
| 23 | Ga0070660_100089457 | 3300005339 | Bacteria | 2426 |
| 24 | Ga0070661_100067102 | 3300005344 | Bacteria | 2636 |
| 25 | Ga0070668_100030431 | 3300005347 | Bacteria | 4104 |
| 26 | Ga0070671_100080559 | 3300005355 | Bacteria | 2723 |
| 27 | Ga0070667_100273288 | 3300005367 | Bacteria | 1516 |
| 28 | Ga0070709_10035201 | 3300005434 | Bacteria | 3042 |
| 29 | Ga0070709_10344262 | 3300005434 | Bacteria | 1100 |
| 30 | Ga0070713_100074804 | 3300005436 | Bacteria | 2871 |
| 31 | Ga0070711_100005751 | 3300005439 | Bacteria | 7439 |
| 32 | Ga0070711_100005777 | 3300005439 | Bacteria | 7426 |
| 33 | Ga0070700_100127945 | 3300005441 | Bacteria | 1710 |
| 34 | Ga0070663_100015395 | 3300005455 | Bacteria | 4936 |
| 35 | Ga0070663_100020741 | 3300005455 | Bacteria | 4355 |
| 36 | Ga0070663_100162606 | 3300005455 | Bacteria | 1719 |
| 37 | Ga0070663_100201269 | 3300005455 | Bacteria | 1554 |
| 38 | Ga0070663_100250806 | 3300005455 | Bacteria | 1401 |
| 39 | Ga0070678_100152994 | 3300005456 | Bacteria | 1860 |
| 40 | Ga0070678_100443643 | 3300005456 | Bacteria | 1135 |
| 41 | Ga0070681_10002390 | 3300005458 | Bacteria | 17156 |
| 42 | Ga0070698_100052848 | 3300005471 | Bacteria | 4131 |
| 43 | Ga0070679_100003890 | 3300005530 | Bacteria | 13727 |
| 44 | Ga0070679_100338955 | 3300005530 | Bacteria | 1452 |
| 45 | Ga0070684_100021854 | 3300005535 | Bacteria | 5330 |
| 46 | Ga0068853_100385349 | 3300005539 | Bacteria | 1310 |
| 47 | Ga0068853_100459514 | 3300005539 | Bacteria | 1198 |
| 48 | Ga0070693_100041088 | 3300005547 | Bacteria | 2600 |
| 49 | Ga0070693_100147883 | 3300005547 | Bacteria | 1485 |
| 50 | Ga0070665_100011705 | 3300005548 | Bacteria | 8865 |
| 51 | Ga0070665_100070688 | 3300005548 | Bacteria | 3497 |
| 52 | Ga0070665_100087540 | 3300005548 | Bacteria | 3120 |
| 53 | Ga0070665_100108577 | 3300005548 | Bacteria | 2777 |
| 54 | Ga0068855_100386068 | 3300005563 | Bacteria | 1537 |
| 55 | Ga0068856_100074029 | 3300005614 | Bacteria | 3372 |
| 56 | Ga0068856_100286277 | 3300005614 | Bacteria | 1665 |
| 57 | Ga0070702_100280444 | 3300005615 | Bacteria | 1144 |
| 58 | Ga0068852_100031021 | 3300005616 | Bacteria | 4405 |
| 59 | Ga0068852_100774512 | 3300005616 | Bacteria | 972 |
| 60 | Ga0068859_100066991 | 3300005617 | Bacteria | 3626 |
| 61 | Ga0068859_100245105 | 3300005617 | Bacteria | 1881 |
| 62 | Ga0068861_100325047 | 3300005719 | Bacteria | 1341 |
| 63 | Ga0068870_10026046 | 3300005840 | Bacteria | 2911 |
| 64 | Ga0068863_100658390 | 3300005841 | Bacteria | 1039 |
| 65 | Ga0068858_100166458 | 3300005842 | Bacteria | 2077 |
| 66 | Ga0068858_100277698 | 3300005842 | Bacteria | 1595 |
| 67 | Ga0068858_100456550 | 3300005842 | Bacteria | 1232 |
| 68 | Ga0068860_100000213 | 3300005843 | Bacteria | 91105 |
| 69 | Ga0068860_100497428 | 3300005843 | Bacteria | 1217 |
| 70 | Ga0081540_1006747 | 3300005983 | Bacteria | 8301 |
| 71 | Ga0081540_1045469 | 3300005983 | Bacteria | 2229 |
| 72 | Ga0081540_1064067 | 3300005983 | Bacteria | 1736 |
| 73 | Ga0081539_10070313 | 3300005985 | Bacteria | 1879 |
| 74 | Ga0070717_10090227 | 3300006028 | Bacteria | 2586 |
| 75 | Ga0075365_10098373 | 3300006038 | Bacteria | 2001 |
| 76 | Ga0075365_10193524 | 3300006038 | Bacteria | 1424 |
| 77 | Ga0075363_100003660 | 3300006048 | Bacteria | 6601 |
| 78 | Ga0075363_100018202 | 3300006048 | Bacteria | 3495 |
| 79 | Ga0075364_10103022 | 3300006051 | Bacteria | 1901 |
| 80 | Ga0070712_100026707 | 3300006175 | Bacteria | 3850 |
| 81 | Ga0075362_10069207 | 3300006177 | Bacteria | 1609 |
| 82 | Ga0075367_10026945 | 3300006178 | Bacteria | 3265 |
| 83 | Ga0075367_10187462 | 3300006178 | Bacteria | 1290 |
| 84 | Ga0075369_10010834 | 3300006186 | Bacteria | 3573 |
| 85 | Ga0075369_10048713 | 3300006186 | Bacteria | 1829 |
| 86 | Ga0075369_10088288 | 3300006186 | Bacteria | 1381 |
| 87 | Ga0075366_10028318 | 3300006195 | Bacteria | 3288 |
| 88 | Ga0075366_10202663 | 3300006195 | Bacteria | 1207 |
| 89 | Ga0097621_100198095 | 3300006237 | Bacteria | 1742 |
| 90 | Ga0075370_10045496 | 3300006353 | Bacteria | 2482 |
| 91 | Ga0068865_100145103 | 3300006881 | Bacteria | 1794 |
| 92 | Ga0097620_100066990 | 3300006931 | Bacteria | 3626 |
| 93 | Ga0097620_100245103 | 3300006931 | Bacteria | 1881 |
| 94 | Ga0099822_1042973 | 3300006943 | Bacteria | 2324 |
| 95 | Ga0105240_10000556 | 3300009093 | Bacteria | 69165 |
| 96 | Ga0105240_10015762 | 3300009093 | Bacteria | 10256 |
| 97 | Ga0105247_10020281 | 3300009101 | Bacteria | 3997 |
| 98 | Ga0105247_10086184 | 3300009101 | Bacteria | 1987 |
| 99 | Ga0105241_10062260 | 3300009174 | Bacteria | 2876 |
| 100 | Ga0105241_10098738 | 3300009174 | Bacteria | 2317 |
| 101 | Ga0105242_10340383 | 3300009176 | Bacteria | 1382 |
| 102 | Ga0105237_10001571 | 3300009545 | Bacteria | 29788 |
| 103 | Ga0105237_10009910 | 3300009545 | Bacteria | 10171 |
| 104 | Ga0105237_10218422 | 3300009545 | Bacteria | 1906 |
| 105 | Ga0105237_10322824 | 3300009545 | Bacteria | 1548 |
| 106 | Ga0105237_10335048 | 3300009545 | Bacteria | 1517 |
| 107 | Ga0105237_10628923 | 3300009545 | Bacteria | 1080 |
| 108 | Ga0105238_10061555 | 3300009551 | Bacteria | 3756 |
| 109 | Ga0105238_10098262 | 3300009551 | Bacteria | 2911 |
| 110 | Ga0105238_10211164 | 3300009551 | Bacteria | 1917 |
| 111 | Ga0105238_10352862 | 3300009551 | Bacteria | 1460 |
| 112 | Ga0105238_10640505 | 3300009551 | Bacteria | 1072 |
| 113 | Ga0105239_10005373 | 3300010375 | Bacteria | 15042 |
| 114 | Ga0105239_10042884 | 3300010375 | Bacteria | 4958 |
| 115 | Ga0105239_10047592 | 3300010375 | Bacteria | 4700 |
| 116 | Ga0105239_10372414 | 3300010375 | Bacteria | 1614 |
| 117 | Ga0105239_10545061 | 3300010375 | Bacteria | 1321 |
| 118 | Ga0157370_10162022 | 3300013104 | Bacteria | 2081 |
| 119 | Ga0157369_10005445 | 3300013105 | Bacteria | 14806 |
| 120 | Ga0157369_10055761 | 3300013105 | Bacteria | 4266 |
| 121 | Ga0157369_10195156 | 3300013105 | Bacteria | 2126 |
| 122 | Ga0157374_10054391 | 3300013296 | Bacteria | 3734 |
| 123 | Ga0157378_10009302 | 3300013297 | Bacteria | 8559 |
| 124 | Ga0163162_10800354 | 3300013306 | Bacteria | 1060 |
| 125 | Ga0157372_10291393 | 3300013307 | Bacteria | 1898 |
| 126 | Ga0157372_10477173 | 3300013307 | Bacteria | 1454 |
| 127 | Ga0157375_10271222 | 3300013308 | Bacteria | 1859 |
| 128 | Ga0163163_10123302 | 3300014325 | Bacteria | 2627 |
| 129 | Ga0163163_10785961 | 3300014325 | Bacteria | 1015 |
| 130 | Ga0214544_1000053 | 3300021320 | Bacteria | 133908 |
| 131 | Ga0214542_1000058 | 3300021321 | Bacteria | 133923 |
| 132 | Ga0214545_1000026 | 3300021324 | Bacteria | 133811 |
| 133 | Ga0214543_1000160 | 3300021327 | Bacteria | 96627 |
| 134 | Ga0209677_100241 | 3300025253 | Bacteria | 37674 |
| 135 | Ga0209677_104068 | 3300025253 | Bacteria | 4395 |
| 136 | Ga0209148_1015343 | 3300025254 | Bacteria | 1339 |
| 137 | Ga0209233_1001843 | 3300025261 | Bacteria | 8137 |
| 138 | Ga0209233_1004236 | 3300025261 | Bacteria | 4913 |
| 139 | Ga0209455_1001205 | 3300025272 | Bacteria | 12353 |
| 140 | Ga0209455_1002355 | 3300025272 | Bacteria | 7368 |
| 141 | Ga0209564_1015668 | 3300025295 | Bacteria | 3068 |
| 142 | Ga0209758_1000011 | 3300025297 | Bacteria | 1049685 |
| 143 | Ga0209758_1000607 | 3300025297 | Bacteria | 55510 |
| 144 | Ga0209758_1000940 | 3300025297 | Bacteria | 39289 |
| 145 | Ga0209758_1006006 | 3300025297 | Bacteria | 8975 |
| 146 | Ga0209758_1008510 | 3300025297 | Bacteria | 6620 |
| 147 | Ga0209256_1009509 | 3300025299 | Bacteria | 4250 |
| 148 | Ga0207426_1000505 | 3300025302 | Bacteria | 57583 |
| 149 | Ga0207426_1039334 | 3300025302 | Bacteria | 1482 |
| 150 | Ga0209257_1000158 | 3300025304 | Bacteria | 180079 |
| 151 | Ga0207680_10093283 | 3300025903 | Bacteria | 1920 |
| 152 | Ga0207680_10278491 | 3300025903 | Bacteria | 1162 |
| 153 | Ga0207680_10298733 | 3300025903 | Bacteria | 1122 |
| 154 | Ga0207699_10001555 | 3300025906 | Bacteria | 10866 |
| 155 | Ga0207699_10319276 | 3300025906 | Bacteria | 1089 |
| 156 | Ga0207654_10073023 | 3300025911 | Bacteria | 2044 |
| 157 | Ga0207654_10094196 | 3300025911 | Bacteria | 1832 |
| 158 | Ga0207707_10000776 | 3300025912 | Bacteria | 31443 |
| 159 | Ga0207707_10289319 | 3300025912 | Bacteria | 1418 |
| 160 | Ga0207695_10000157 | 3300025913 | Bacteria | 204140 |
| 161 | Ga0207671_10015678 | 3300025914 | Bacteria | 5924 |
| 162 | Ga0207671_10134286 | 3300025914 | Bacteria | 1902 |
| 163 | Ga0207671_10192066 | 3300025914 | Bacteria | 1592 |
| 164 | Ga0207693_10007365 | 3300025915 | Bacteria | 9049 |
| 165 | Ga0207693_10019200 | 3300025915 | Bacteria | 5440 |
| 166 | Ga0207663_10010754 | 3300025916 | Bacteria | 4886 |
| 167 | Ga0207657_10156033 | 3300025919 | Bacteria | 1856 |
| 168 | Ga0207649_10152879 | 3300025920 | Bacteria | 1591 |
| 169 | Ga0207652_10016460 | 3300025921 | Bacteria | 6038 |
| 170 | Ga0207652_10030215 | 3300025921 | Bacteria | 4535 |
| 171 | Ga0207681_10293204 | 3300025923 | Bacteria | 1285 |
| 172 | Ga0207664_10011234 | 3300025929 | Bacteria | 6351 |
| 173 | Ga0207664_10178534 | 3300025929 | Bacteria | 1822 |
| 174 | Ga0207644_10056453 | 3300025931 | Bacteria | 2834 |
| 175 | Ga0207706_10112320 | 3300025933 | Bacteria | 2397 |
| 176 | Ga0207704_10125883 | 3300025938 | Bacteria | 1764 |
| 177 | Ga0207665_10338905 | 3300025939 | Bacteria | 1132 |
| 178 | Ga0207661_10000407 | 3300025944 | Bacteria | 27744 |
| 179 | Ga0207667_10051838 | 3300025949 | Bacteria | 4324 |
| 180 | Ga0207668_10045989 | 3300025972 | Bacteria | 2979 |
| 181 | Ga0207658_10315793 | 3300025986 | Bacteria | 1351 |
| 182 | Ga0207703_10162769 | 3300026035 | Bacteria | 1955 |
| 183 | Ga0207639_10184501 | 3300026041 | Bacteria | 1777 |
| 184 | Ga0207639_10308964 | 3300026041 | Bacteria | 1400 |
| 185 | Ga0207678_10014040 | 3300026067 | Bacteria | 7044 |
| 186 | Ga0207678_10035191 | 3300026067 | Bacteria | 4361 |
| 187 | Ga0207678_10075652 | 3300026067 | Bacteria | 2884 |
| 188 | Ga0207676_10310738 | 3300026095 | Bacteria | 1443 |
| 189 | Ga0207683_10205835 | 3300026121 | Bacteria | 1790 |
| 190 | Ga0209389_1000073 | 3300027296 | Bacteria | 94298 |
| 191 | Ga0209389_1000160 | 3300027296 | Bacteria | 56126 |
| 192 | Ga0209589_1000484 | 3300027357 | Bacteria | 56126 |
| 193 | Ga0209489_100917 | 3300027361 | Bacteria | 58978 |
| 194 | Ga0209489_100982 | 3300027361 | Bacteria | 57399 |
| 195 | Ga0209700_100067 | 3300027363 | Bacteria | 144074 |
| 196 | Ga0209813_10015301 | 3300027866 | Bacteria | 2076 |
| 197 | Ga0268266_10001288 | 3300028379 | Bacteria | 30547 |
| 198 | Ga0307517_10000392 | 3300028786 | Bacteria | 74887 |
| 199 | Ga0307515_10016635 | 3300028794 | Bacteria | 13449 |
| 200 | Ga0307515_10085987 | 3300028794 | Bacteria | 4016 |
| 201 | Ga0307515_10142289 | 3300028794 | Bacteria | 2565 |
| 202 | Ga0265330_10004698 | 3300031235 | Bacteria | 6900 |
| 203 | Ga0265330_10028627 | 3300031235 | Bacteria | 2510 |
| 204 | Ga0265328_10000545 | 3300031239 | Bacteria | 17506 |
| 205 | Ga0265325_10019839 | 3300031241 | Bacteria | 3712 |
| 206 | Ga0265340_10052280 | 3300031247 | Bacteria | 1976 |
| 207 | Ga0265339_10122461 | 3300031249 | Bacteria | 1335 |
| 208 | Ga0265331_10027630 | 3300031250 | Bacteria | 2843 |
| 209 | Ga0265331_10038936 | 3300031250 | Bacteria | 2321 |
| 210 | Ga0265316_10092067 | 3300031344 | Bacteria | 2312 |
| 211 | Ga0307509_10006372 | 3300031507 | Bacteria | 15921 |
| 212 | Ga0307408_100519327 | 3300031548 | Bacteria | 1046 |
| 213 | Ga0265314_10031509 | 3300031711 | Bacteria | 3912 |
| 214 | Ga0307516_10040004 | 3300031730 | Bacteria | 4669 |
| 215 | Ga0307412_10168330 | 3300031911 | Bacteria | 1636 |
| 216 | Ga0307510_10005570 | 3300033180 | Bacteria | 15003 |
| 217 | Ga0373951_0000914 | 3300035091 | Bacteria | 7959 |
| 218 | Ga0373937_0243111 | 3300036401 | Bacteria | 1696 |
| 219 | Ga0373925_0385148 | 3300037068 | Bacteria | 1142 |
| 220 | Ga0395905_0075935 | 3300037471 | Bacteria | 3149 |
| 221 | Ga0395905_0472178 | 3300037471 | Bacteria | 1153 |
| 222 | Ga0395901_0058487 | 3300038443 | Bacteria | 4009 |
| 223 | Ga0436365_0998043 | 3300039437 | Bacteria | 1166 |
| 224 | Ga0436365_1021776 | 3300039437 | Bacteria | 2257 |
| 225 | Ga0436361_0113453 | 3300039447 | Bacteria | 1397 |
| 226 | Ga0436363_1630017 | 3300039450 | Bacteria | 3031 |
| 227 | Ga0451795_1558593 | 3300041456 | Bacteria | 1065 |
| 228 | Ga0451849_0449595 | 3300041505 | Bacteria | 1229 |
| 229 | Ga0451577_0007043 | 3300042876 | Bacteria | 11089 |
| 230 | Ga0466972_0038783 | 3300044658 | Bacteria | 2326 |
| 231 | Ga0453683_0133632 | 3300044673 | Bacteria | 1564 |
| 232 | Ga0466965_0025714 | 3300044683 | Bacteria | 2851 |
| 233 | Ga0466965_0102899 | 3300044683 | Bacteria | 1462 |
| 234 | Ga0466966_0000763 | 3300044684 | Bacteria | 20420 |
| 235 | Ga0466961_0000505 | 3300044693 | Bacteria | 24872 |
| 236 | Ga0466964_0073701 | 3300044706 | Bacteria | 1450 |
| 237 | Ga0453684_0067870 | 3300044712 | Bacteria | 4532 |
| 238 | Ga0453684_0328094 | 3300044712 | Bacteria | 1731 |
| 239 | Ga0466968_0010380 | 3300044735 | Bacteria | 3608 |
| 240 | Ga0466968_0046133 | 3300044735 | Bacteria | 1851 |
| 241 | Ga0466970_0107156 | 3300044765 | Bacteria | 1525 |
| 242 | Ga0466960_0007628 | 3300044901 | Bacteria | 4405 |
| 243 | Ga0466959_0033585 | 3300045049 | Bacteria | 3794 |
| 244 | Ga0451576_0005035 | 3300045051 | Bacteria | 16777 |
| 245 | Ga0451576_0079063 | 3300045051 | Bacteria | 3422 |
| 246 | Ga0451576_0101485 | 3300045051 | Bacteria | 2992 |
| 247 | Ga0495590_0014141 | 3300046457 | Bacteria | 2919 |
| 248 | Ga0495590_0070649 | 3300046457 | Bacteria | 1225 |
| 249 | Ga0495629_0005760 | 3300046459 | Bacteria | 9249 |
| 250 | Ga0495638_0002608 | 3300046460 | Bacteria | 14546 |
| 251 | Ga0495638_0045766 | 3300046460 | Bacteria | 2751 |
| 252 | Ga0495638_0065610 | 3300046460 | Bacteria | 2233 |
| 253 | Ga0495651_0028772 | 3300046462 | Bacteria | 4331 |
| 254 | Ga0495651_0195488 | 3300046462 | Bacteria | 1420 |
| 255 | Ga0495650_0045815 | 3300046471 | Bacteria | 1839 |
| 256 | Ga0495580_0112493 | 3300046472 | Bacteria | 1891 |
| 257 | Ga0495605_0033462 | 3300046474 | Bacteria | 2608 |
| 258 | Ga0495605_0139751 | 3300046474 | Bacteria | 1087 |
| 259 | Ga0495585_0099430 | 3300046492 | Bacteria | 1557 |
| 260 | Ga0495583_0040266 | 3300046506 | Bacteria | 2196 |
| 261 | Ga0495606_0069954 | 3300046507 | Bacteria | 2215 |
| 262 | Ga0495606_0143600 | 3300046507 | Bacteria | 1407 |
| 263 | Ga0495606_0145043 | 3300046507 | Bacteria | 1399 |
| 264 | Ga0495610_0118979 | 3300046512 | Bacteria | 1160 |
| 265 | Ga0495618_0109740 | 3300046514 | Bacteria | 1767 |
| 266 | Ga0495637_0069245 | 3300046520 | Bacteria | 1428 |
| 267 | Ga0495643_0024774 | 3300046522 | Bacteria | 3401 |
| 268 | Ga0495643_0032817 | 3300046522 | Bacteria | 2879 |
| 269 | Ga0495643_0063138 | 3300046522 | Bacteria | 1959 |
| 270 | Ga0495648_0077530 | 3300046524 | Bacteria | 1904 |
| 271 | Ga0495652_0137878 | 3300046529 | Bacteria | 1922 |
| 272 | Ga0495597_0016185 | 3300046542 | Bacteria | 3525 |
| 273 | Ga0495656_0018309 | 3300046615 | Bacteria | 2687 |
| 274 | Ga0495656_0129729 | 3300046615 | Bacteria | 1199 |
| 275 | Ga0495668_0086988 | 3300046616 | Bacteria | 1714 |
| 276 | Ga0495611_0033322 | 3300046648 | Bacteria | 2272 |
| 277 | Ga0495625_0265772 | 3300046660 | Bacteria | 1109 |
| 278 | Ga0495661_0041611 | 3300046665 | Bacteria | 2841 |
| 279 | Ga0495588_0012046 | 3300046674 | Bacteria | 4077 |
| 280 | Ga0495588_0138403 | 3300046674 | Bacteria | 1285 |
| 281 | Ga0495589_0041848 | 3300046794 | Bacteria | 2284 |
| 282 | Ga0495589_0122487 | 3300046794 | Bacteria | 1252 |
| 283 | Ga0495600_0131625 | 3300046809 | Bacteria | 1626 |
| 284 | Ga0495604_0088554 | 3300047317 | Bacteria | 2302 |
| 285 | Ga0495604_0093028 | 3300047317 | Bacteria | 2232 |
| 286 | Ga0495674_0101687 | 3300047319 | Bacteria | 2445 |
| 287 | Ga0495683_0050579 | 3300047323 | Bacteria | 2079 |
| 288 | Ga0495687_080059 | 3300047443 | Bacteria | 1282 |
| 289 | Ga0495673_0092130 | 3300047469 | Bacteria | 1237 |
| 290 | Ga0495686_0075748 | 3300047472 | Bacteria | 2062 |
| 291 | Ga0496100_0106446 | 3300048903 | Bacteria | 1941 |
| 292 | Ga0496102_0061998 | 3300048905 | Bacteria | 3424 |
| 293 | Ga0496102_0126772 | 3300048905 | Bacteria | 2387 |
| 294 | Ga0496102_0127103 | 3300048905 | Bacteria | 2383 |
| 295 | Ga0496103_0017407 | 3300048906 | Bacteria | 4302 |
| 296 | Ga0496104_0047658 | 3300048907 | Bacteria | 4039 |
| 297 | Ga0496104_0101988 | 3300048907 | Bacteria | 2748 |
| 298 | Ga0496104_0283318 | 3300048907 | Bacteria | 1570 |
| 299 | Ga0496105_0166925 | 3300048908 | Bacteria | 1806 |
| 300 | Ga0496105_0261234 | 3300048908 | Bacteria | 1400 |
| 301 | Ga0496107_0156539 | 3300048910 | Bacteria | 1687 |
| 302 | Ga0496107_0236345 | 3300048910 | Bacteria | 1360 |
| 303 | Ga0496107_0253894 | 3300048910 | Bacteria | 1308 |
| 304 | Ga0496108_0269043 | 3300048911 | Bacteria | 1483 |
| 305 | Ga0496109_0082292 | 3300048912 | Bacteria | 2967 |
| 306 | Ga0496110_0226661 | 3300048913 | Bacteria | 1699 |
| 307 | Ga0496110_0478112 | 3300048913 | Bacteria | 1135 |
| 308 | Ga0496111_0029968 | 3300048914 | Bacteria | 3868 |
| 309 | Ga0496112_0116037 | 3300048915 | Bacteria | 2648 |
| 310 | Ga0496112_0204552 | 3300048915 | Bacteria | 1933 |
| 311 | Ga0496112_0313510 | 3300048915 | Bacteria | 1514 |
| 312 | Ga0496113_0115319 | 3300048916 | Bacteria | 2096 |
| 313 | Ga0496113_0208976 | 3300048916 | Bacteria | 1553 |
| 314 | Ga0496115_0242129 | 3300048918 | Bacteria | 1486 |
| 315 | Ga0496116_0025695 | 3300048919 | Bacteria | 4324 |
| 316 | Ga0496117_0168329 | 3300048920 | Bacteria | 1275 |
| 317 | Ga0496118_0041863 | 3300048921 | Bacteria | 3621 |
| 318 | Ga0496119_0067899 | 3300048922 | Bacteria | 2101 |
| 319 | Ga0496121_0014474 | 3300048924 | Bacteria | 8365 |
| 320 | Ga0496121_0016063 | 3300048924 | Bacteria | 7759 |
| 321 | Ga0496122_0108719 | 3300048925 | Bacteria | 1828 |
| 322 | Ga0496122_0194615 | 3300048925 | Bacteria | 1192 |
| 323 | Ga0496122_0219830 | 3300048925 | Bacteria | 1091 |
| 324 | Ga0496125_0000063 | 3300048928 | Bacteria | 250260 |
| 325 | Ga0496125_0000829 | 3300048928 | Bacteria | 49885 |
| 326 | Ga0496125_0036272 | 3300048928 | Bacteria | 4309 |
| 327 | Ga0496125_0045218 | 3300048928 | Bacteria | 3710 |
| 328 | Ga0496126_0001653 | 3300048929 | Bacteria | 33549 |
| 329 | Ga0496126_0033602 | 3300048929 | Bacteria | 4823 |
| 330 | Ga0496126_0120335 | 3300048929 | Bacteria | 2278 |
| 331 | Ga0496126_0155587 | 3300048929 | Bacteria | 1957 |
| 332 | Ga0496126_0287307 | 3300048929 | Bacteria | 1361 |
| 333 | Ga0495682_0014295 | 3300049460 | Bacteria | 3012 |
| 334 | Ga0501034_0588468 | 3300049571 | Bacteria | 1019 |
| 335 | Ga0501047_0031654 | 3300049581 | Bacteria | 5104 |
| 336 | Ga0501067_0287831 | 3300049583 | Bacteria | 915 |
| 337 | Ga0501070_0129897 | 3300049586 | Bacteria | 2081 |
| 338 | Ga0501080_0008865 | 3300049742 | Bacteria | 9144 |
| 339 | Ga0501044_0053414 | 3300049823 | Bacteria | 4157 |
| 340 | nmdc:mga03683_89617_c1 | 3300050489 | Bacteria | 1339 |
| 341 | nmdc:mga03n38_35921_c1 | 3300050490 | Bacteria | 2127 |
| 342 | nmdc:mga03n38_835_c1 | 3300050490 | Bacteria | 8246 |
| 343 | nmdc:mga0yw44_216649_c1 | 3300050492 | Bacteria | 1268 |
| 344 | nmdc:mga0yw44_26574_c1 | 3300050492 | Bacteria | 3308 |
| 345 | nmdc:mga0k408_67463_c1 | 3300050493 | Bacteria | 2085 |
| 346 | nmdc:mga06z11_5120_c1 | 3300050494 | Bacteria | 5227 |
| 347 | nmdc:mga06z11_85384_c1 | 3300050494 | Bacteria | 1703 |
| 348 | nmdc:mga04h51_19397_c1 | 3300050495 | Bacteria | 2016 |
| 349 | nmdc:mga07m45_2049_c3 | 3300050496 | Bacteria | 6903 |
| 350 | nmdc:mga07m45_69319_c1 | 3300050496 | Bacteria | 2005 |
| 351 | nmdc:mga0sz30_204612_c1 | 3300050516 | Bacteria | 877 |
| 352 | nmdc:mga0sz30_45534_c1 | 3300050516 | Bacteria | 1850 |
| 353 | Ga0500635_0055225 | 3300053080 | Bacteria | 1371 |
| 354 | Ga0495655_0056559 | 3300053083 | Bacteria | 1056 |
| 355 | Ga0500643_001353 | 3300053087 | Bacteria | 14266 |
| 356 | Ga0500644_0137022 | 3300053088 | Bacteria | 969 |
| 357 | Ga0500651_0030706 | 3300053093 | Bacteria | 3382 |
| 358 | Ga0500566_0000040 | 3300053094 | Bacteria | 66046 |
| 359 | Ga0500566_0000057 | 3300053094 | Bacteria | 53723 |
| 360 | Ga0500566_0061419 | 3300053094 | Bacteria | 2127 |
| 361 | Ga0500640_000194 | 3300053095 | Bacteria | 12934 |
| 362 | Ga0500641_0007880 | 3300053096 | Bacteria | 3797 |
| 363 | Ga0500650_0001791 | 3300053098 | Bacteria | 6706 |
| 364 | Ga0500650_0041809 | 3300053098 | Bacteria | 2117 |
| 365 | Ga0500557_000106 | 3300053105 | Bacteria | 25501 |
| 366 | Ga0500562_007305 | 3300053108 | Bacteria | 2788 |
| 367 | Ga0500572_000127 | 3300053111 | Bacteria | 25536 |
| 368 | Ga0500572_000443 | 3300053111 | Bacteria | 14511 |
| 369 | Ga0500572_001713 | 3300053111 | Bacteria | 5698 |
| 370 | Ga0500607_070991 | 3300053121 | Bacteria | 1798 |
| 371 | Ga0500608_090318 | 3300053122 | Bacteria | 1433 |
| 372 | Ga0500614_008970 | 3300053123 | Bacteria | 2127 |
| 373 | Ga0500642_0000068 | 3300053130 | Bacteria | 56277 |
| 374 | Ga0500652_000639 | 3300053131 | Bacteria | 11973 |
| 375 | Ga0500658_0017555 | 3300053134 | Bacteria | 2674 |
| 376 | Ga0500658_0110513 | 3300053134 | Bacteria | 1209 |
| 377 | Ga0500559_0002888 | 3300053136 | Bacteria | 8657 |
| 378 | Ga0500568_0005042 | 3300053139 | Bacteria | 6915 |
| 379 | Ga0500568_0058158 | 3300053139 | Bacteria | 1503 |
| 380 | Ga0500589_026976 | 3300053147 | Bacteria | 2665 |
| 381 | Ga0500590_034245 | 3300053148 | Bacteria | 2630 |
| 382 | Ga0500603_000111 | 3300053150 | Bacteria | 19037 |
| 383 | Ga0500604_0000656 | 3300053151 | Bacteria | 9492 |
| 384 | Ga0500616_0103653 | 3300053153 | Bacteria | 1386 |
| 385 | Ga0500620_002695 | 3300053155 | Bacteria | 3641 |
| 386 | Ga0500622_0038696 | 3300053156 | Bacteria | 2488 |
| 387 | Ga0500627_0011475 | 3300053158 | Bacteria | 3276 |
| 388 | Ga0500627_0024146 | 3300053158 | Bacteria | 2484 |
| 389 | Ga0500627_0163022 | 3300053158 | Unclassified | 1005 |
| 390 | Ga0500630_000675 | 3300053159 | Bacteria | 15519 |
| 391 | Ga0500634_0035492 | 3300053161 | Bacteria | 2716 |
| 392 | Ga0500638_063049 | 3300053162 | Bacteria | 1779 |
| 393 | Ga0500639_000003 | 3300053163 | Bacteria | 230428 |
| 394 | Ga0500636_0000059 | 3300053177 | Bacteria | 52601 |
| 395 | Ga0500636_0048782 | 3300053177 | Bacteria | 2491 |
| 396 | Ga0500636_0056820 | 3300053177 | Bacteria | 2290 |
| 397 | Ga0500637_0128813 | 3300053178 | Bacteria | 1468 |
| 398 | Ga0500625_005504 | 3300053729 | Bacteria | 5301 |
| 399 | Ga0500609_003497 | 3300053731 | Bacteria | 2199 |
| 400 | Ga0500596_002114 | 3300053735 | Bacteria | 3959 |
| 401 | Ga0500596_007576 | 3300053735 | Bacteria | 1772 |
| 402 | Ga0500601_000439 | 3300053737 | Bacteria | 6834 |
| 403 | Ga0500601_006549 | 3300053737 | Bacteria | 1283 |
| 404 | 2507507102 | 2507262055 | Bacteria | 8048963 |
| 405 | 2508541151 | 2508501009 | Bacteria | 7784016 |
| 406 | 2508693513 | 2508501042 | Bacteria | 8719808 |
| 407 | 2511398519 | 2511231028 | Bacteria | 8046582 |
| 408 | 2513626339 | 2513237092 | Bacteria | 8341956 |
| 409 | 2513637282 | 2513237094 | Bacteria | 8789602 |
| 410 | 2513651673 | 2513237095 | Bacteria | 8976980 |
| 411 | 2513674122 | 2513237098 | Bacteria | 9902361 |
| 412 | 2513876837 | 2513237139 | Bacteria | 8737671 |
| 413 | 2514012126 | 2513237161 | Bacteria | 8871253 |
| 414 | 2515628869 | 2515154112 | Bacteria | 8294334 |
| 415 | 2517107432 | 2517093001 | Bacteria | 9002274 |
| 416 | 2524439496 | 2524023205 | Bacteria | 8918781 |
| 417 | 2524465097 | 2524023210 | Bacteria | 9029266 |
| 418 | 2528858676 | 2528768022 | Bacteria | 10457665 |
| 419 | 2599103775 | 2597490356 | Bacteria | 7030811 |
| 420 | 2617348081 | 2617270735 | Bacteria | 9163226 |
| 421 | 2617377687 | 2617270741 | Bacteria | 8201522 |
| 422 | 2745078207 | 2744054633 | Bacteria | 8678936 |
| 423 | 2793064377 | 2791355196 | Bacteria | 7323613 |
| 424 | 2805922137 | 2802429603 | Bacteria | 8777136 |
| 425 | 2818243183 | 2816332527 | Bacteria | 8933356 |
| 426 | 2824603231 | 2824600985 | Bacteria | 8488197 |
| 427 | 2824614769 | 2824609381 | Bacteria | 8672835 |
| 428 | 2824630241 | 2824626560 | Bacteria | 8813858 |
| 429 | 2824636441 | 2824635225 | Bacteria | 8785348 |
| 430 | 2824644802 | 2824644064 | Bacteria | 8743947 |
| 431 | 2824656030 | 2824653114 | Bacteria | 8493680 |
| 432 | 2824664418 | 2824661429 | Bacteria | 9877870 |
| 433 | 2824673768 | 2824671348 | Bacteria | 8369588 |
| 434 | 2824686751 | 2824679649 | Bacteria | 8248951 |
| 435 | 2824690349 | 2824687955 | Bacteria | 8360029 |
| 436 | 2824696740 | 2824696289 | Bacteria | 8335049 |
| 437 | 2824706770 | 2824704595 | Bacteria | 9667483 |
| 438 | 2824715334 | 2824714736 | Bacteria | 8717648 |
| 439 | 2824724589 | 2824723954 | Bacteria | 8758240 |
| 440 | 2824746370 | 2824746037 | Bacteria | 7911610 |
| 441 | 2824760463 | 2824753945 | Bacteria | 9787441 |
| 442 | 2824768145 | 2824763712 | Bacteria | 9792355 |
| 443 | 2824776195 | 2824773399 | Bacteria | 8360218 |
| 444 | 2838126949 | 2838122688 | Bacteria | 8803140 |
| 445 | 2841945571 | 2841941048 | Bacteria | 8688029 |
| 446 | 2841954787 | 2841949485 | Bacteria | 8680857 |
| 447 | 2841966139 | 2841957949 | Bacteria | 8652217 |
| 448 | 2841972429 | 2841966195 | Bacteria | 8673214 |
| 449 | 2841980513 | 2841974524 | Bacteria | 8931498 |
| 450 | 2841988684 | 2841983080 | Bacteria | 8395090 |
| 451 | 2842044972 | 2842038055 | Bacteria | 8002051 |
| 452 | 2842052842 | 2842045827 | Bacteria | 8006841 |
| 453 | 2844320592 | 2844315083 | Bacteria | 8138177 |
| 454 | 2846957462 | 2846952575 | Bacteria | 6587527 |
| 455 | 2847938127 | 2847930680 | Bacteria | 9342022 |
| 456 | 2847940046 | 2847939898 | Bacteria | 8606328 |
| 457 | 2848863257 | 2848858292 | Bacteria | 7391279 |
| 458 | 2849077759 | 2849076700 | Bacteria | 7039503 |
| 459 | 2857510935 | 2857509624 | Bacteria | 7472071 |
| 460 | 2874591495 | 2874590934 | Bacteria | 8299676 |
| 461 | 2874618981 | 2874612657 | Bacteria | 8252029 |
| 462 | 2874625916 | 2874620515 | Bacteria | 8290088 |
| 463 | 2874634256 | 2874628541 | Bacteria | 8630250 |
| 464 | 2874645858 | 2874645413 | Bacteria | 8214782 |
| 465 | 2876762133 | 2876761206 | Bacteria | 10111113 |
| 466 | 2876771635 | 2876771140 | Bacteria | 8287509 |
| 467 | 2876818969 | 2876818435 | Bacteria | 8274608 |
| 468 | 2879075477 | 2879074833 | Bacteria | 8279565 |
| 469 | 2879084327 | 2879083081 | Bacteria | 8587928 |
| 470 | 2879101134 | 2879099564 | Bacteria | 10442239 |
| 471 | 2879129661 | 2879127579 | Bacteria | 8294491 |
| 472 | 2879145608 | 2879142872 | Bacteria | 8267021 |
| 473 | 2881364434 | 2881364244 | Bacteria | 7710352 |
| 474 | 2881669651 | 2881665667 | Bacteria | 8175609 |
| 475 | 2885368523 | 2885366525 | Bacteria | 8326213 |
| 476 | 2885388664 | 2885383462 | Bacteria | 9473874 |
| 477 | 2885413276 | 2885409591 | Bacteria | 9235467 |
| 478 | 2888386078 | 2888378607 | Bacteria | 9652610 |
| 479 | 2888392209 | 2888388044 | Bacteria | 7304136 |
| 480 | 2888426195 | 2888419890 | Bacteria | 7857137 |
| 481 | 2903733410 | 2903727486 | Bacteria | 8281579 |
| 482 | 2903777783 | 2903768456 | Bacteria | 9749579 |
| 483 | 2904673724 | 2904666416 | Bacteria | 8226587 |
| 484 | 2904717542 | 2904711408 | Bacteria | 9771557 |
| 485 | 2906605683 | 2906602504 | Bacteria | 8295279 |
| 486 | 2906629372 | 2906626472 | Bacteria | 8826946 |
| 487 | 2906640341 | 2906635258 | Bacteria | 8601019 |
| 488 | 2906644027 | 2906643746 | Bacteria | 8722424 |
| 489 | 2906667261 | 2906660503 | Bacteria | 8595048 |
| 490 | 2908782270 | 2908775508 | Bacteria | 8092255 |
| 491 | 2922376411 | |||
| 492 | 2922399872 | 2922393267 | Bacteria | 8285685 |
| 493 | 2929624062 | 2929615660 | Bacteria | 9193770 |
| 494 | 2929633203 | 2929624759 | Bacteria | 9339455 |
| 495 | 2932792629 | 2932784394 | Bacteria | 9704911 |
| 496 | 2932797919 | 2932794094 | Bacteria | 7915132 |
| 497 | 2932806455 | 2932801729 | Bacteria | 7987968 |
| 498 | 2932815280 | 2932809354 | Bacteria | 9135765 |
| 499 | 2932824440 | 2932818245 | Bacteria | 9955613 |
| 500 | 2932832161 | 2932828146 | Bacteria | 9745859 |
| 501 | 2933585962 | 2933577622 | Bacteria | 9116884 |
| 502 | 2935610517 | 2935608549 | Bacteria | 8203142 |
| 503 | 2935622099 | 2935616580 | Bacteria | 9032984 |
| 504 | 2935643890 | 2935638405 | Bacteria | 10015038 |
| 505 | 2935654278 | 2935648319 | Bacteria | 8801166 |
| 506 | 2935663158 | 2935656913 | Bacteria | 8965014 |
| 507 | 2935669194 | 2935665750 | Bacteria | 9571747 |
| 508 | 2935683248 | 2935675223 | Bacteria | 9928132 |
| 509 | 2935692189 | 2935684952 | Bacteria | 9590419 |
| 510 | 2935700640 | 2935694250 | Bacteria | 9291695 |
| 511 | 2935708730 | 2935703347 | Bacteria | 10242284 |
| 512 | 2935720573 | 2935713505 | Bacteria | 9608509 |
| 513 | 2935729854 | 2935722832 | Bacteria | 9608746 |
| 514 | 2935739164 | 2935732158 | Bacteria | 9706831 |
| 515 | 2935748295 | 2935741537 | Bacteria | 9707219 |
| 516 | 2935758498 | 2935750917 | Bacteria | 9590372 |
| 517 | 2935766076 | 2935760218 | Bacteria | 9817913 |
| 518 | 2935770952 | 2935769743 | Bacteria | 7878163 |
| 519 | 2935781119 | 2935777560 | Bacteria | 8077691 |
| 520 | 2935786347 | 2935785616 | Bacteria | 7962367 |
| 521 | 2935793856 | 2935793552 | Bacteria | 8012592 |
| 522 | 2935805910 | 2935801545 | Bacteria | 9301974 |
| 523 | 2935815531 | 2935810662 | Bacteria | 9401221 |
| 524 | 2935823678 | 2935819856 | Bacteria | 8261050 |
| 525 | 2935833142 | 2935827899 | Bacteria | 10038562 |
| 526 | 2935843287 | 2935837841 | Bacteria | 9454360 |
| 527 | 2935849204 | 2935847175 | Bacteria | 8228321 |
| 528 | 2935860346 | 2935855204 | Bacteria | 9035059 |
| 529 | 2935867744 | 2935864058 | Bacteria | 9784707 |
| 530 | 2935878447 | 2935873716 | Bacteria | 9632195 |
| 531 | 2935888706 | 2935883170 | Bacteria | 7964738 |
| 532 | 2935916659 | 2935908558 | Bacteria | 8568796 |
| 533 | 2935922981 | 2935916978 | Bacteria | 9113783 |
| 534 | 2935934148 | 2935926038 | Bacteria | 8601059 |
| 535 | 2935942620 | 2935934488 | Bacteria | 8602579 |
| 536 | 2935951060 | 2935942939 | Bacteria | 8599779 |
| 537 | 2935959521 | 2935951376 | Bacteria | 8602333 |
| 538 | 2935966899 | 2935959822 | Bacteria | 7869783 |
| 539 | 2935975611 | 2935967501 | Bacteria | 8603075 |
| 540 | 2935975978 | 2935975950 | Bacteria | 8347125 |
| 541 | 2935986533 | 2935984226 | Bacteria | 8302647 |
| 542 | 2935998670 | 2935992306 | Bacteria | 9802711 |
| 543 | 2936006976 | 2936002035 | Bacteria | 9362176 |
| 544 | 2936017314 | 2936011229 | Bacteria | 8801034 |
| 545 | 2936025816 | 2936019824 | Bacteria | 8804134 |
| 546 | 2936034776 | 2936028420 | Bacteria | 8965941 |
| 547 | 2936040769 | 2936037263 | Bacteria | 9446081 |
| 548 | 2936052833 | 2936046547 | Bacteria | 8903709 |
| 549 | 2936060028 | 2936055302 | Bacteria | 8785755 |
| 550 | 2940564402 | 2940556831 | Bacteria | 9590747 |
| 551 | 2941531787 | 2941531003 | Bacteria | 7653939 |
| 552 | 2941544833 | 2941538514 | Bacteria | 9402094 |
| 553 | 3005488865 | 3005483717 | Bacteria | 7877331 |
| 554 | 3005508000 | 3005506211 | Bacteria | 6943378 |
| 555 | 3005593317 | 3005587118 | Bacteria | 7794411 |
| 556 | 3005600988 | 3005594810 | Bacteria | 8716512 |
| 557 | 3005716377 | 3005710791 | Bacteria | 7622528 |
| 558 | 3005723757 | 3005718088 | Bacteria | 8283608 |
| 559 | 8006930423 | 8006926726 | Bacteria | 6749210 |
| 560 | 8016519996 | 8016511872 | Bacteria | 9921665 |
| 561 | 8016527920 | 8016522445 | Bacteria | 8156687 |
| 562 | 8016533038 | 8016530956 | Bacteria | 8155261 |
| 563 | 8016546273 | 8016539877 | Bacteria | 8155419 |
| 564 | 8016555857 | 8016548790 | Bacteria | 8155074 |
| 565 | 8016571353 | 8016566248 | Bacteria | 8158151 |
| 566 | 8016583825 | 8016575299 | Bacteria | 8154085 |
| 567 | 8016595114 | 8016583857 | Bacteria | 10421953 |
| 568 | 8016601901 | 8016595262 | Bacteria | 8149947 |
| 569 | 8016608343 | 8016603502 | Bacteria | 8731218 |
| 570 | 8016616523 | 8016613128 | Bacteria | 8794220 |
| 571 | 8016624618 | 8016622563 | Bacteria | 7999408 |
| 572 | 8016638108 | 8016630954 | Bacteria | 9217207 |
| 573 | 8017065551 | 8017057580 | Bacteria | 10023680 |
| 574 | 8019551655 | 8019547302 | Bacteria | 7996444 |
| 575 | 8019584954 | 8019576017 | Bacteria | 10049540 |
| 576 | 8019592911 | 8019586578 | Bacteria | 10212056 |
| 577 | 8019598547 | 8019597564 | Bacteria | 10041141 |
| 578 | 8019609831 | 8019608314 | Bacteria | 10042931 |
| 579 | 8019620411 | 8019619141 | Bacteria | 9218857 |
| 580 | 8019632691 | 8019629233 | Bacteria | 8687553 |
| 581 | 8019660556 | 8019659431 | Bacteria | 8577854 |
| 582 | 8019669981 | 8019668869 | Bacteria | 8791617 |
| 583 | 8019686122 | 8019678201 | Bacteria | 8863603 |
| 584 | 8019692300 | 8019687851 | Bacteria | 8712826 |
| 585 | 8055744467 | 8055742211 | Bacteria | 9226248 |
| 586 | 8056972097 | 8056967851 | Bacteria | 9038162 |
| 587 | Ga0500559_0001477 | |||
| 588 | JGI25153J46596_10000127 | |||
| 589 | JGI25153J46596_10000201 | |||
| 590 | JGI25153J46596_10011440 | |||
| 591 | JGI25153J46596_10014157 | |||
| 592 | JGI25153J46596_10033280 | |||
| 593 | JGI25153J46596_10040758 | |||
| 594 | rootH1_10069813 | |||
| 595 | rootH1_10079915 | |||
| 596 | rootH2_10064424 | |||
| 597 | JGI25160J50197_1000386 | |||
| 598 | JGI25160J50197_1000785 | |||
| 599 | Ga0055531_10009083 | |||
| 600 | Ga0055543_1001354 | |||
| 601 | Ga0065165_1001118 | |||
| 602 | Ga0065165_1025955 | |||
| 603 | Ga0070658_10035558 | |||
| 604 | Ga0070658_10035588 | |||
| 605 | Ga0070683_100188812 | |||
| 606 | Ga0070670_100128187 | |||
| 607 | Ga0070666_10320974 | |||
| 608 | Ga0070682_100348122 | |||
| 609 | Ga0070660_100089457 | |||
| 610 | Ga0070661_100067102 | |||
| 611 | Ga0070668_100030431 | |||
| 612 | Ga0070671_100080559 | |||
| 613 | Ga0070667_100273288 | |||
| 614 | Ga0070709_10035201 | |||
| 615 | Ga0070709_10344262 | |||
| 616 | Ga0070713_100074804 | |||
| 617 | Ga0070711_100005751 | |||
| 618 | Ga0070711_100005777 | |||
| 619 | Ga0070700_100127945 | |||
| 620 | Ga0070663_100015395 | |||
| 621 | Ga0070663_100020741 | |||
| 622 | Ga0070663_100162606 | |||
| 623 | Ga0070663_100201269 | |||
| 624 | Ga0070663_100250806 | |||
| 625 | Ga0070678_100152994 | |||
| 626 | Ga0070678_100443643 | |||
| 627 | Ga0070681_10002390 | |||
| 628 | Ga0070698_100052848 | |||
| 629 | Ga0070679_100003890 | |||
| 630 | Ga0070679_100338955 | |||
| 631 | Ga0070684_100021854 | |||
| 632 | Ga0068853_100385349 | |||
| 633 | Ga0068853_100459514 | |||
| 634 | Ga0070693_100041088 | |||
| 635 | Ga0070693_100147883 | |||
| 636 | Ga0070665_100011705 | |||
| 637 | Ga0070665_100070688 | |||
| 638 | Ga0070665_100087540 | |||
| 639 | Ga0070665_100108577 | |||
| 640 | Ga0068855_100386068 | |||
| 641 | Ga0068856_100074029 | |||
| 642 | Ga0068856_100286277 | |||
| 643 | Ga0070702_100280444 | |||
| 644 | Ga0068852_100031021 | |||
| 645 | Ga0068852_100774512 | |||
| 646 | Ga0068859_100066991 | |||
| 647 | Ga0068859_100245105 | |||
| 648 | Ga0068861_100325047 | |||
| 649 | Ga0068870_10026046 | |||
| 650 | Ga0068863_100658390 | |||
| 651 | Ga0068858_100166458 | |||
| 652 | Ga0068858_100277698 | |||
| 653 | Ga0068858_100456550 | |||
| 654 | Ga0068860_100000213 | |||
| 655 | Ga0068860_100497428 | |||
| 656 | Ga0081540_1006747 | |||
| 657 | Ga0081540_1045469 | |||
| 658 | Ga0081540_1064067 | |||
| 659 | Ga0081539_10070313 | |||
| 660 | Ga0070717_10090227 | |||
| 661 | Ga0075365_10098373 | |||
| 662 | Ga0075365_10193524 | |||
| 663 | Ga0075363_100003660 | |||
| 664 | Ga0075363_100018202 | |||
| 665 | Ga0075364_10103022 | |||
| 666 | Ga0070712_100026707 | |||
| 667 | Ga0075362_10069207 | |||
| 668 | Ga0075367_10026945 | |||
| 669 | Ga0075367_10187462 | |||
| 670 | Ga0075369_10010834 | |||
| 671 | Ga0075369_10048713 | |||
| 672 | Ga0075369_10088288 | |||
| 673 | Ga0075366_10028318 | |||
| 674 | Ga0075366_10202663 | |||
| 675 | Ga0097621_100198095 | |||
| 676 | Ga0075370_10045496 | |||
| 677 | Ga0068865_100145103 | |||
| 678 | Ga0097620_100066990 | |||
| 679 | Ga0097620_100245103 | |||
| 680 | Ga0099822_1042973 | |||
| 681 | Ga0105240_10000556 | |||
| 682 | Ga0105240_10015762 | |||
| 683 | Ga0105247_10020281 | |||
| 684 | Ga0105247_10086184 | |||
| 685 | Ga0105241_10062260 | |||
| 686 | Ga0105241_10098738 | |||
| 687 | Ga0105242_10340383 | |||
| 688 | Ga0105237_10001571 | |||
| 689 | Ga0105237_10009910 | |||
| 690 | Ga0105237_10218422 | |||
| 691 | Ga0105237_10322824 | |||
| 692 | Ga0105237_10335048 | |||
| 693 | Ga0105237_10628923 | |||
| 694 | Ga0105238_10061555 | |||
| 695 | Ga0105238_10098262 | |||
| 696 | Ga0105238_10211164 | |||
| 697 | Ga0105238_10352862 | |||
| 698 | Ga0105238_10640505 | |||
| 699 | Ga0105239_10005373 | |||
| 700 | Ga0105239_10042884 | |||
| 701 | Ga0105239_10047592 | |||
| 702 | Ga0105239_10372414 | |||
| 703 | Ga0105239_10545061 | |||
| 704 | Ga0157370_10162022 | |||
| 705 | Ga0157369_10005445 | |||
| 706 | Ga0157369_10055761 | |||
| 707 | Ga0157369_10195156 | |||
| 708 | Ga0157374_10054391 | |||
| 709 | Ga0157378_10009302 | |||
| 710 | Ga0163162_10800354 | |||
| 711 | Ga0157372_10291393 | |||
| 712 | Ga0157372_10477173 | |||
| 713 | Ga0157375_10271222 | |||
| 714 | Ga0163163_10123302 | |||
| 715 | Ga0163163_10785961 | |||
| 716 | Ga0214544_1000053 | |||
| 717 | Ga0214542_1000058 | |||
| 718 | Ga0214545_1000026 | |||
| 719 | Ga0214543_1000160 | |||
| 720 | Ga0209677_100241 | |||
| 721 | Ga0209677_104068 | |||
| 722 | Ga0209148_1015343 | |||
| 723 | Ga0209233_1001843 | |||
| 724 | Ga0209233_1004236 | |||
| 725 | Ga0209455_1001205 | |||
| 726 | Ga0209455_1002355 | |||
| 727 | Ga0209564_1015668 | |||
| 728 | Ga0209758_1000011 | |||
| 729 | Ga0209758_1000607 | |||
| 730 | Ga0209758_1000940 | |||
| 731 | Ga0209758_1006006 | |||
| 732 | Ga0209758_1008510 | |||
| 733 | Ga0209256_1009509 | |||
| 734 | Ga0207426_1000505 | |||
| 735 | Ga0207426_1039334 | |||
| 736 | Ga0209257_1000158 | |||
| 737 | Ga0207680_10093283 | |||
| 738 | Ga0207680_10278491 | |||
| 739 | Ga0207680_10298733 | |||
| 740 | Ga0207699_10001555 | |||
| 741 | Ga0207699_10319276 | |||
| 742 | Ga0207654_10073023 | |||
| 743 | Ga0207654_10094196 | |||
| 744 | Ga0207707_10000776 | |||
| 745 | Ga0207707_10289319 | |||
| 746 | Ga0207695_10000157 | |||
| 747 | Ga0207671_10015678 | |||
| 748 | Ga0207671_10134286 | |||
| 749 | Ga0207671_10192066 | |||
| 750 | Ga0207693_10007365 | |||
| 751 | Ga0207693_10019200 | |||
| 752 | Ga0207663_10010754 | |||
| 753 | Ga0207657_10156033 | |||
| 754 | Ga0207649_10152879 | |||
| 755 | Ga0207652_10016460 | |||
| 756 | Ga0207652_10030215 | |||
| 757 | Ga0207681_10293204 | |||
| 758 | Ga0207664_10011234 | |||
| 759 | Ga0207664_10178534 | |||
| 760 | Ga0207644_10056453 | |||
| 761 | Ga0207706_10112320 | |||
| 762 | Ga0207704_10125883 | |||
| 763 | Ga0207665_10338905 | |||
| 764 | Ga0207661_10000407 | |||
| 765 | Ga0207667_10051838 | |||
| 766 | Ga0207668_10045989 | |||
| 767 | Ga0207658_10315793 | |||
| 768 | Ga0207703_10162769 | |||
| 769 | Ga0207639_10184501 | |||
| 770 | Ga0207639_10308964 | |||
| 771 | Ga0207678_10014040 | |||
| 772 | Ga0207678_10035191 | |||
| 773 | Ga0207678_10075652 | |||
| 774 | Ga0207676_10310738 | |||
| 775 | Ga0207683_10205835 | |||
| 776 | Ga0209389_1000073 | |||
| 777 | Ga0209389_1000160 | |||
| 778 | Ga0209589_1000484 | |||
| 779 | Ga0209489_100917 | |||
| 780 | Ga0209489_100982 | |||
| 781 | Ga0209700_100067 | |||
| 782 | Ga0209813_10015301 | |||
| 783 | Ga0268266_10001288 | |||
| 784 | Ga0307517_10000392 | |||
| 785 | Ga0307515_10016635 | |||
| 786 | Ga0307515_10085987 | |||
| 787 | Ga0307515_10142289 | |||
| 788 | Ga0265330_10004698 | |||
| 789 | Ga0265330_10028627 | |||
| 790 | Ga0265328_10000545 | |||
| 791 | Ga0265325_10019839 | |||
| 792 | Ga0265340_10052280 | |||
| 793 | Ga0265339_10122461 | |||
| 794 | Ga0265331_10027630 | |||
| 795 | Ga0265331_10038936 | |||
| 796 | Ga0265316_10092067 | |||
| 797 | Ga0307509_10006372 | |||
| 798 | Ga0307408_100519327 | |||
| 799 | Ga0265314_10031509 | |||
| 800 | Ga0307516_10040004 | |||
| 801 | Ga0307412_10168330 | |||
| 802 | Ga0307510_10005570 | |||
| 803 | Ga0373951_0000914 | |||
| 804 | Ga0373937_0243111 | |||
| 805 | Ga0373925_0385148 | |||
| 806 | Ga0395905_0075935 | |||
| 807 | Ga0395905_0472178 | |||
| 808 | Ga0395901_0058487 | |||
| 809 | Ga0436365_0998043 | |||
| 810 | Ga0436365_1021776 | |||
| 811 | Ga0436361_0113453 | |||
| 812 | Ga0436363_1630017 | |||
| 813 | Ga0451795_1558593 | |||
| 814 | Ga0451849_0449595 | |||
| 815 | Ga0451577_0007043 | |||
| 816 | Ga0466972_0038783 | |||
| 817 | Ga0453683_0133632 | |||
| 818 | Ga0466965_0025714 | |||
| 819 | Ga0466965_0102899 | |||
| 820 | Ga0466966_0000763 | |||
| 821 | Ga0466961_0000505 | |||
| 822 | Ga0466964_0073701 | |||
| 823 | Ga0453684_0067870 | |||
| 824 | Ga0453684_0328094 | |||
| 825 | Ga0466968_0010380 | |||
| 826 | Ga0466968_0046133 | |||
| 827 | Ga0466970_0107156 | |||
| 828 | Ga0466960_0007628 | |||
| 829 | Ga0466959_0033585 | |||
| 830 | Ga0451576_0005035 | |||
| 831 | Ga0451576_0079063 | |||
| 832 | Ga0451576_0101485 | |||
| 833 | Ga0495590_0014141 | |||
| 834 | Ga0495590_0070649 | |||
| 835 | Ga0495629_0005760 | |||
| 836 | Ga0495638_0002608 | |||
| 837 | Ga0495638_0045766 | |||
| 838 | Ga0495638_0065610 | |||
| 839 | Ga0495651_0028772 | |||
| 840 | Ga0495651_0195488 | |||
| 841 | Ga0495650_0045815 | |||
| 842 | Ga0495580_0112493 | |||
| 843 | Ga0495605_0033462 | |||
| 844 | Ga0495605_0139751 | |||
| 845 | Ga0495585_0099430 | |||
| 846 | Ga0495583_0040266 | |||
| 847 | Ga0495606_0069954 | |||
| 848 | Ga0495606_0143600 | |||
| 849 | Ga0495606_0145043 | |||
| 850 | Ga0495610_0118979 | |||
| 851 | Ga0495618_0109740 | |||
| 852 | Ga0495637_0069245 | |||
| 853 | Ga0495643_0024774 | |||
| 854 | Ga0495643_0032817 | |||
| 855 | Ga0495643_0063138 | |||
| 856 | Ga0495648_0077530 | |||
| 857 | Ga0495652_0137878 | |||
| 858 | Ga0495597_0016185 | |||
| 859 | Ga0495656_0018309 | |||
| 860 | Ga0495656_0129729 | |||
| 861 | Ga0495668_0086988 | |||
| 862 | Ga0495611_0033322 | |||
| 863 | Ga0495625_0265772 | |||
| 864 | Ga0495661_0041611 | |||
| 865 | Ga0495588_0012046 | |||
| 866 | Ga0495588_0138403 | |||
| 867 | Ga0495589_0041848 | |||
| 868 | Ga0495589_0122487 | |||
| 869 | Ga0495600_0131625 | |||
| 870 | Ga0495604_0088554 | |||
| 871 | Ga0495604_0093028 | |||
| 872 | Ga0495674_0101687 | |||
| 873 | Ga0495683_0050579 | |||
| 874 | Ga0495687_080059 | |||
| 875 | Ga0495673_0092130 | |||
| 876 | Ga0495686_0075748 | |||
| 877 | Ga0496100_0106446 | |||
| 878 | Ga0496102_0061998 | |||
| 879 | Ga0496102_0126772 | |||
| 880 | Ga0496102_0127103 | |||
| 881 | Ga0496103_0017407 | |||
| 882 | Ga0496104_0047658 | |||
| 883 | Ga0496104_0101988 | |||
| 884 | Ga0496104_0283318 | |||
| 885 | Ga0496105_0166925 | |||
| 886 | Ga0496105_0261234 | |||
| 887 | Ga0496107_0156539 | |||
| 888 | Ga0496107_0236345 | |||
| 889 | Ga0496107_0253894 | |||
| 890 | Ga0496108_0269043 | |||
| 891 | Ga0496109_0082292 | |||
| 892 | Ga0496110_0226661 | |||
| 893 | Ga0496110_0478112 | |||
| 894 | Ga0496111_0029968 | |||
| 895 | Ga0496112_0116037 | |||
| 896 | Ga0496112_0204552 | |||
| 897 | Ga0496112_0313510 | |||
| 898 | Ga0496113_0115319 | |||
| 899 | Ga0496113_0208976 | |||
| 900 | Ga0496115_0242129 | |||
| 901 | Ga0496116_0025695 | |||
| 902 | Ga0496117_0168329 | |||
| 903 | Ga0496118_0041863 | |||
| 904 | Ga0496119_0067899 | |||
| 905 | Ga0496121_0014474 | |||
| 906 | Ga0496121_0016063 | |||
| 907 | Ga0496122_0108719 | |||
| 908 | Ga0496122_0194615 | |||
| 909 | Ga0496122_0219830 | |||
| 910 | Ga0496125_0000063 | |||
| 911 | Ga0496125_0000829 | |||
| 912 | Ga0496125_0036272 | |||
| 913 | Ga0496125_0045218 | |||
| 914 | Ga0496126_0001653 | |||
| 915 | Ga0496126_0033602 | |||
| 916 | Ga0496126_0120335 | |||
| 917 | Ga0496126_0155587 | |||
| 918 | Ga0496126_0287307 | |||
| 919 | Ga0495682_0014295 | |||
| 920 | Ga0501034_0588468 | |||
| 921 | Ga0501047_0031654 | |||
| 922 | Ga0501067_0287831 | |||
| 923 | Ga0501070_0129897 | |||
| 924 | Ga0501080_0008865 | |||
| 925 | Ga0501044_0053414 | |||
| 926 | nmdc:mga03683_89617_c1 | |||
| 927 | nmdc:mga03n38_35921_c1 | |||
| 928 | nmdc:mga03n38_835_c1 | |||
| 929 | nmdc:mga0yw44_216649_c1 | |||
| 930 | nmdc:mga0yw44_26574_c1 | |||
| 931 | nmdc:mga0k408_67463_c1 | |||
| 932 | nmdc:mga06z11_5120_c1 | |||
| 933 | nmdc:mga06z11_85384_c1 | |||
| 934 | nmdc:mga04h51_19397_c1 | |||
| 935 | nmdc:mga07m45_2049_c3 | |||
| 936 | nmdc:mga07m45_69319_c1 | |||
| 937 | nmdc:mga0sz30_204612_c1 | |||
| 938 | nmdc:mga0sz30_45534_c1 | |||
| 939 | Ga0500635_0055225 | |||
| 940 | Ga0495655_0056559 | |||
| 941 | Ga0500643_001353 | |||
| 942 | Ga0500644_0137022 | |||
| 943 | Ga0500651_0030706 | |||
| 944 | Ga0500566_0000040 | |||
| 945 | Ga0500566_0000057 | |||
| 946 | Ga0500566_0061419 | |||
| 947 | Ga0500640_000194 | |||
| 948 | Ga0500641_0007880 | |||
| 949 | Ga0500650_0001791 | |||
| 950 | Ga0500650_0041809 | |||
| 951 | Ga0500557_000106 | |||
| 952 | Ga0500562_007305 | |||
| 953 | Ga0500572_000127 | |||
| 954 | Ga0500572_000443 | |||
| 955 | Ga0500572_001713 | |||
| 956 | Ga0500607_070991 | |||
| 957 | Ga0500608_090318 | |||
| 958 | Ga0500614_008970 | |||
| 959 | Ga0500642_0000068 | |||
| 960 | Ga0500652_000639 | |||
| 961 | Ga0500658_0017555 | |||
| 962 | Ga0500658_0110513 | |||
| 963 | Ga0500559_0002888 | |||
| 964 | Ga0500568_0005042 | |||
| 965 | Ga0500568_0058158 | |||
| 966 | Ga0500589_026976 | |||
| 967 | Ga0500590_034245 | |||
| 968 | Ga0500603_000111 | |||
| 969 | Ga0500604_0000656 | |||
| 970 | Ga0500616_0103653 | |||
| 971 | Ga0500620_002695 | |||
| 972 | Ga0500622_0038696 | |||
| 973 | Ga0500627_0011475 | |||
| 974 | Ga0500627_0024146 | |||
| 975 | Ga0500627_0163022 | |||
| 976 | Ga0500630_000675 | |||
| 977 | Ga0500634_0035492 | |||
| 978 | Ga0500638_063049 | |||
| 979 | Ga0500639_000003 | |||
| 980 | Ga0500636_0000059 | |||
| 981 | Ga0500636_0048782 | |||
| 982 | Ga0500636_0056820 | |||
| 983 | Ga0500637_0128813 | |||
| 984 | Ga0500625_005504 | |||
| 985 | Ga0500609_003497 | |||
| 986 | Ga0500596_002114 | |||
| 987 | Ga0500596_007576 | |||
| 988 | Ga0500601_000439 | |||
| 989 | Ga0500601_006549 | |||
| 990 | 2507507102 | |||
| 991 | 2508541151 | |||
| 992 | 2508693513 | |||
| 993 | 2511398519 | |||
| 994 | 2513626339 | |||
| 995 | 2513637282 | |||
| 996 | 2513651673 | |||
| 997 | 2513674122 | |||
| 998 | 2513876837 | |||
| 999 | 2514012126 | |||
| 1000 | 2515628869 | |||
| 1001 | 2517107432 | |||
| 1002 | 2524439496 | |||
| 1003 | 2524465097 | |||
| 1004 | 2528858676 | |||
| 1005 | 2599103775 | |||
| 1006 | 2617348081 | |||
| 1007 | 2617377687 | |||
| 1008 | 2745078207 | |||
| 1009 | 2793064377 | |||
| 1010 | 2805922137 | |||
| 1011 | 2818243183 | |||
| 1012 | 2824603231 | |||
| 1013 | 2824614769 | |||
| 1014 | 2824630241 | |||
| 1015 | 2824636441 | |||
| 1016 | 2824644802 | |||
| 1017 | 2824656030 | |||
| 1018 | 2824664418 | |||
| 1019 | 2824673768 | |||
| 1020 | 2824686751 | |||
| 1021 | 2824690349 | |||
| 1022 | 2824696740 | |||
| 1023 | 2824706770 | |||
| 1024 | 2824715334 | |||
| 1025 | 2824724589 | |||
| 1026 | 2824746370 | |||
| 1027 | 2824760463 | |||
| 1028 | 2824768145 | |||
| 1029 | 2824776195 | |||
| 1030 | 2838126949 | |||
| 1031 | 2841945571 | |||
| 1032 | 2841954787 | |||
| 1033 | 2841966139 | |||
| 1034 | 2841972429 | |||
| 1035 | 2841980513 | |||
| 1036 | 2841988684 | |||
| 1037 | 2842044972 | |||
| 1038 | 2842052842 | |||
| 1039 | 2844320592 | |||
| 1040 | 2846957462 | |||
| 1041 | 2847938127 | |||
| 1042 | 2847940046 | |||
| 1043 | 2848863257 | |||
| 1044 | 2849077759 | |||
| 1045 | 2857510935 | |||
| 1046 | 2874591495 | |||
| 1047 | 2874618981 | |||
| 1048 | 2874625916 | |||
| 1049 | 2874634256 | |||
| 1050 | 2874645858 | |||
| 1051 | 2876762133 | |||
| 1052 | 2876771635 | |||
| 1053 | 2876818969 | |||
| 1054 | 2879075477 | |||
| 1055 | 2879084327 | |||
| 1056 | 2879101134 | |||
| 1057 | 2879129661 | |||
| 1058 | 2879145608 | |||
| 1059 | 2881364434 | |||
| 1060 | 2881669651 | |||
| 1061 | 2885368523 | |||
| 1062 | 2885388664 | |||
| 1063 | 2885413276 | |||
| 1064 | 2888386078 | |||
| 1065 | 2888392209 | |||
| 1066 | 2888426195 | |||
| 1067 | 2903733410 | |||
| 1068 | 2903777783 | |||
| 1069 | 2904673724 | |||
| 1070 | 2904717542 | |||
| 1071 | 2906605683 | |||
| 1072 | 2906629372 | |||
| 1073 | 2906640341 | |||
| 1074 | 2906644027 | |||
| 1075 | 2906667261 | |||
| 1076 | 2908782270 | |||
| 1077 | 2922376411 | |||
| 1078 | 2922399872 | |||
| 1079 | 2929624062 | |||
| 1080 | 2929633203 | |||
| 1081 | 2932792629 | |||
| 1082 | 2932797919 | |||
| 1083 | 2932806455 | |||
| 1084 | 2932815280 | |||
| 1085 | 2932824440 | |||
| 1086 | 2932832161 | |||
| 1087 | 2933585962 | |||
| 1088 | 2935610517 | |||
| 1089 | 2935622099 | |||
| 1090 | 2935643890 | |||
| 1091 | 2935654278 | |||
| 1092 | 2935663158 | |||
| 1093 | 2935669194 | |||
| 1094 | 2935683248 | |||
| 1095 | 2935692189 | |||
| 1096 | 2935700640 | |||
| 1097 | 2935708730 | |||
| 1098 | 2935720573 | |||
| 1099 | 2935729854 | |||
| 1100 | 2935739164 | |||
| 1101 | 2935748295 | |||
| 1102 | 2935758498 | |||
| 1103 | 2935766076 | |||
| 1104 | 2935770952 | |||
| 1105 | 2935781119 | |||
| 1106 | 2935786347 | |||
| 1107 | 2935793856 | |||
| 1108 | 2935805910 | |||
| 1109 | 2935815531 | |||
| 1110 | 2935823678 | |||
| 1111 | 2935833142 | |||
| 1112 | 2935843287 | |||
| 1113 | 2935849204 | |||
| 1114 | 2935860346 | |||
| 1115 | 2935867744 | |||
| 1116 | 2935878447 | |||
| 1117 | 2935888706 | |||
| 1118 | 2935916659 | |||
| 1119 | 2935922981 | |||
| 1120 | 2935934148 | |||
| 1121 | 2935942620 | |||
| 1122 | 2935951060 | |||
| 1123 | 2935959521 | |||
| 1124 | 2935966899 | |||
| 1125 | 2935975611 | |||
| 1126 | 2935975978 | |||
| 1127 | 2935986533 | |||
| 1128 | 2935998670 | |||
| 1129 | 2936006976 | |||
| 1130 | 2936017314 | |||
| 1131 | 2936025816 | |||
| 1132 | 2936034776 | |||
| 1133 | 2936040769 | |||
| 1134 | 2936052833 | |||
| 1135 | 2936060028 | |||
| 1136 | 2940564402 | |||
| 1137 | 2941531787 | |||
| 1138 | 2941544833 | |||
| 1139 | 3005488865 | |||
| 1140 | 3005508000 | |||
| 1141 | 3005593317 | |||
| 1142 | 3005600988 | |||
| 1143 | 3005716377 | |||
| 1144 | 3005723757 | |||
| 1145 | 8006930423 | |||
| 1146 | 8016519996 | |||
| 1147 | 8016527920 | |||
| 1148 | 8016533038 | |||
| 1149 | 8016546273 | |||
| 1150 | 8016555857 | |||
| 1151 | 8016571353 | |||
| 1152 | 8016583825 | |||
| 1153 | 8016595114 | |||
| 1154 | 8016601901 | |||
| 1155 | 8016608343 | |||
| 1156 | 8016616523 | |||
| 1157 | 8016624618 | |||
| 1158 | 8016638108 | |||
| 1159 | 8017065551 | |||
| 1160 | 8019551655 | |||
| 1161 | 8019584954 | |||
| 1162 | 8019592911 | |||
| 1163 | 8019598547 | |||
| 1164 | 8019609831 | |||
| 1165 | 8019620411 | |||
| 1166 | 8019632691 | |||
| 1167 | 8019660556 | |||
| 1168 | 8019669981 | |||
| 1169 | 8019686122 | |||
| 1170 | 8019692300 | |||
| 1171 | 8055744467 | |||
| 1172 | 8056972097 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3dcd-assembly2.cif.gz_B | x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. | 0.9535 | 8 | 293 |
| 3dcd-assembly2.cif.gz_B | x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. | 0.9251 | 8 | 293 |
| 3q1n-assembly1.cif.gz_A | crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution | 0.9229 | 8 | 292 |
| 3k25-assembly2.cif.gz_B | crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 | 0.8277 | 8 | 294 |
| 3mwx-assembly2.cif.gz_B | crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution | 0.8197 | 8 | 294 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3dcdA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.9266 | 9 | 293 | 2.70.98.10 |
| 3q1nA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.912 | 9 | 292 | 2.70.98.10 |
| 3dcdA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.899 | 9 | 293 | 2.70.98.10 |
| 3q1nA00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8908 | 9 | 292 | 2.70.98.10 |
| 3k25A00 | Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; | 0.8268 | 8 | 294 | 2.70.98.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4S1F0Q1-F1-model_v4 | Aldose 1-epimerase family protein | 0.9937 | 98 | 236 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A5E9AUR3-F1-model_v4 | Aldose 1-epimerase family protein | 0.9928 | 130 | 293 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A5R2N1Q1-F1-model_v4 | Aldose 1-epimerase family protein | 0.9928 | 132 | 275 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A1M7E8H2-F1-model_v4 | Galactose mutarotase | 0.9921 | 4 | 292 |
GO:0005975
GO:0016853 GO:0030246 |
| AF-A0A4Q5PWN9-F1-model_v4 | Aldose 1-epimerase family protein | 0.9921 | 108 | 292 |
GO:0005975
GO:0016853 GO:0030246 |