F466612

General Info

Members Datasets Scaffolds Average Seq Length
586 442 1172 292

Family's Representative Sequence

Representative Sequence 3300053136|Ga0500559_0001477|Ga0500559_0001477_8057_9112
Length 344
Sequence MKNRRGLPRIDAVVGFDIIAGCRTELMQAAEARKLKVLDGVAMIRHQLPQQTAFWCREMSDDIHTIAAGGITAAIKADGAELCSLQTADGLDLLWQAGPAWPRHAPLLFPIVGRLKDDVLRHQGKTYSMTQHGFARDLRFEWRDRSTQSCTLVLTDSDAIQARYPFAFRLTVSYRVDATSLDTTIEIANPGEAMLPASFGAHPAFNWPLSPDLAKESYRLIFPQAEPAPIRRLTGGLMRAAGMVLPLSERLFADDAVILDHPVSSSVRYVGECGPSLEIAWEGFRELGIWSKPSGAPFLCIEPWRGYASPVDFGGEFADKPGLMQIAPGAVETLRYRVTVRDQS

Samples

Sample ID Description Type Environment
1 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
7 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
8 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
37 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
38 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
39 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
40 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
41 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
47 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
50 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
51 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
52 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
53 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
56 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
74 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
75 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
76 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
77 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
78 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
79 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
80 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
81 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
82 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
83 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
84 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
85 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
113 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
114 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
115 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
116 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
123 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
124 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
130 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
133 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
134 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
135 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
140 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
141 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
142 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
143 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
144 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
145 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
146 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
147 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
148 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
149 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
150 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
151 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
152 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
153 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
154 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
155 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
156 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
157 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
158 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
159 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
160 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
161 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
162 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
163 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
164 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
165 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
166 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
167 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
168 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
174 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
175 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
176 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
177 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
178 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
179 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
185 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
190 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
191 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
201 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
202 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
203 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
204 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
205 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
206 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
207 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
208 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
215 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
216 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
219 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
220 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
230 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
231 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
232 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
233 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
234 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
235 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
236 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
237 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
238 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
239 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
240 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
241 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
242 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
243 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
244 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
248 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
249 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
250 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
251 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
252 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
253 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
254 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
255 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
256 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
257 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
258 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
259 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
260 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
261 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
262 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
263 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
264 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
265 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
266 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
267 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
268 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
269 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
270 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
271 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
272 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
273 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
274 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
275 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
276 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
277 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
278 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
279 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
280 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
281 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
282 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
283 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
284 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
285 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
286 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
287 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
288 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
289 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
290 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
291 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
292 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
293 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
294 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
295 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
296 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
297 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
298 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
299 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
300 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
301 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
302 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
303 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
304 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
305 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
306 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
307 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
308 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
309 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
310 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
311 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
312 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
313 2848858292 Azospirillum brasilense Az39 Isolate Unclassified
314 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
315 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
316 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
317 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
318 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
319 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
320 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
321 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
322 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
323 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
324 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
325 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
326 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
327 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
328 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
329 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
330 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
331 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
332 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
333 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
334 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
335 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
336 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
337 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
338 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
339 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
340 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
341 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
342 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
343 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
344 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
345 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
346 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
347 2922368715
348 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
349 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
350 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
351 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
352 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
353 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
354 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
355 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
356 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
357 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
358 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
359 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
360 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
361 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
362 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
363 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
364 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
365 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
366 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
367 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
368 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
369 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
370 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
371 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
372 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
373 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
374 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
375 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
376 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
377 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
378 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
379 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
380 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
381 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
382 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
383 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
384 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
385 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
386 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
387 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
388 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
389 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
390 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
391 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
392 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
393 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
394 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
395 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
396 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
397 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
398 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
399 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
400 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
401 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
402 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
403 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
404 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
405 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
406 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
407 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
408 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
409 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
410 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
411 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
412 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
413 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
414 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
415 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
416 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
417 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
418 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
419 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
420 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
421 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
422 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
423 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
424 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
425 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
426 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
427 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
428 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
429 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
430 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
431 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
432 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
433 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
434 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
435 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
436 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
437 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
438 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
439 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
440 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
441 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
442 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 68.89
Metatranscriptomes 0
Isolates 31.11

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 18.43
Nodule 23.89
Rhizoplane 4.27
Rhizosphere 38.91
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500559_0001477 3300053136 Bacteria 13272
2 JGI25153J46596_10000127 3300003215 Bacteria 83368
3 JGI25153J46596_10000201 3300003215 Bacteria 55451
4 JGI25153J46596_10011440 3300003215 Bacteria 3921
5 JGI25153J46596_10014157 3300003215 Bacteria 3332
6 JGI25153J46596_10033280 3300003215 Bacteria 1704
7 JGI25153J46596_10040758 3300003215 Bacteria 1436
8 rootH1_10069813 3300003316 Bacteria 1427
9 rootH1_10079915 3300003316 Bacteria 2268
10 rootH2_10064424 3300003320 Bacteria 2260
11 JGI25160J50197_1000386 3300003354 Bacteria 28574
12 JGI25160J50197_1000785 3300003354 Bacteria 17040
13 Ga0055531_10009083 3300003794 Bacteria 5127
14 Ga0055543_1001354 3300004625 Bacteria 9919
15 Ga0065165_1001118 3300005262 Bacteria 31690
16 Ga0065165_1025955 3300005262 Bacteria 1935
17 Ga0070658_10035558 3300005327 Bacteria 4013
18 Ga0070658_10035588 3300005327 Bacteria 4011
19 Ga0070683_100188812 3300005329 Bacteria 1956
20 Ga0070670_100128187 3300005331 Bacteria 2190
21 Ga0070666_10320974 3300005335 Bacteria 1105
22 Ga0070682_100348122 3300005337 Bacteria 1104
23 Ga0070660_100089457 3300005339 Bacteria 2426
24 Ga0070661_100067102 3300005344 Bacteria 2636
25 Ga0070668_100030431 3300005347 Bacteria 4104
26 Ga0070671_100080559 3300005355 Bacteria 2723
27 Ga0070667_100273288 3300005367 Bacteria 1516
28 Ga0070709_10035201 3300005434 Bacteria 3042
29 Ga0070709_10344262 3300005434 Bacteria 1100
30 Ga0070713_100074804 3300005436 Bacteria 2871
31 Ga0070711_100005751 3300005439 Bacteria 7439
32 Ga0070711_100005777 3300005439 Bacteria 7426
33 Ga0070700_100127945 3300005441 Bacteria 1710
34 Ga0070663_100015395 3300005455 Bacteria 4936
35 Ga0070663_100020741 3300005455 Bacteria 4355
36 Ga0070663_100162606 3300005455 Bacteria 1719
37 Ga0070663_100201269 3300005455 Bacteria 1554
38 Ga0070663_100250806 3300005455 Bacteria 1401
39 Ga0070678_100152994 3300005456 Bacteria 1860
40 Ga0070678_100443643 3300005456 Bacteria 1135
41 Ga0070681_10002390 3300005458 Bacteria 17156
42 Ga0070698_100052848 3300005471 Bacteria 4131
43 Ga0070679_100003890 3300005530 Bacteria 13727
44 Ga0070679_100338955 3300005530 Bacteria 1452
45 Ga0070684_100021854 3300005535 Bacteria 5330
46 Ga0068853_100385349 3300005539 Bacteria 1310
47 Ga0068853_100459514 3300005539 Bacteria 1198
48 Ga0070693_100041088 3300005547 Bacteria 2600
49 Ga0070693_100147883 3300005547 Bacteria 1485
50 Ga0070665_100011705 3300005548 Bacteria 8865
51 Ga0070665_100070688 3300005548 Bacteria 3497
52 Ga0070665_100087540 3300005548 Bacteria 3120
53 Ga0070665_100108577 3300005548 Bacteria 2777
54 Ga0068855_100386068 3300005563 Bacteria 1537
55 Ga0068856_100074029 3300005614 Bacteria 3372
56 Ga0068856_100286277 3300005614 Bacteria 1665
57 Ga0070702_100280444 3300005615 Bacteria 1144
58 Ga0068852_100031021 3300005616 Bacteria 4405
59 Ga0068852_100774512 3300005616 Bacteria 972
60 Ga0068859_100066991 3300005617 Bacteria 3626
61 Ga0068859_100245105 3300005617 Bacteria 1881
62 Ga0068861_100325047 3300005719 Bacteria 1341
63 Ga0068870_10026046 3300005840 Bacteria 2911
64 Ga0068863_100658390 3300005841 Bacteria 1039
65 Ga0068858_100166458 3300005842 Bacteria 2077
66 Ga0068858_100277698 3300005842 Bacteria 1595
67 Ga0068858_100456550 3300005842 Bacteria 1232
68 Ga0068860_100000213 3300005843 Bacteria 91105
69 Ga0068860_100497428 3300005843 Bacteria 1217
70 Ga0081540_1006747 3300005983 Bacteria 8301
71 Ga0081540_1045469 3300005983 Bacteria 2229
72 Ga0081540_1064067 3300005983 Bacteria 1736
73 Ga0081539_10070313 3300005985 Bacteria 1879
74 Ga0070717_10090227 3300006028 Bacteria 2586
75 Ga0075365_10098373 3300006038 Bacteria 2001
76 Ga0075365_10193524 3300006038 Bacteria 1424
77 Ga0075363_100003660 3300006048 Bacteria 6601
78 Ga0075363_100018202 3300006048 Bacteria 3495
79 Ga0075364_10103022 3300006051 Bacteria 1901
80 Ga0070712_100026707 3300006175 Bacteria 3850
81 Ga0075362_10069207 3300006177 Bacteria 1609
82 Ga0075367_10026945 3300006178 Bacteria 3265
83 Ga0075367_10187462 3300006178 Bacteria 1290
84 Ga0075369_10010834 3300006186 Bacteria 3573
85 Ga0075369_10048713 3300006186 Bacteria 1829
86 Ga0075369_10088288 3300006186 Bacteria 1381
87 Ga0075366_10028318 3300006195 Bacteria 3288
88 Ga0075366_10202663 3300006195 Bacteria 1207
89 Ga0097621_100198095 3300006237 Bacteria 1742
90 Ga0075370_10045496 3300006353 Bacteria 2482
91 Ga0068865_100145103 3300006881 Bacteria 1794
92 Ga0097620_100066990 3300006931 Bacteria 3626
93 Ga0097620_100245103 3300006931 Bacteria 1881
94 Ga0099822_1042973 3300006943 Bacteria 2324
95 Ga0105240_10000556 3300009093 Bacteria 69165
96 Ga0105240_10015762 3300009093 Bacteria 10256
97 Ga0105247_10020281 3300009101 Bacteria 3997
98 Ga0105247_10086184 3300009101 Bacteria 1987
99 Ga0105241_10062260 3300009174 Bacteria 2876
100 Ga0105241_10098738 3300009174 Bacteria 2317
101 Ga0105242_10340383 3300009176 Bacteria 1382
102 Ga0105237_10001571 3300009545 Bacteria 29788
103 Ga0105237_10009910 3300009545 Bacteria 10171
104 Ga0105237_10218422 3300009545 Bacteria 1906
105 Ga0105237_10322824 3300009545 Bacteria 1548
106 Ga0105237_10335048 3300009545 Bacteria 1517
107 Ga0105237_10628923 3300009545 Bacteria 1080
108 Ga0105238_10061555 3300009551 Bacteria 3756
109 Ga0105238_10098262 3300009551 Bacteria 2911
110 Ga0105238_10211164 3300009551 Bacteria 1917
111 Ga0105238_10352862 3300009551 Bacteria 1460
112 Ga0105238_10640505 3300009551 Bacteria 1072
113 Ga0105239_10005373 3300010375 Bacteria 15042
114 Ga0105239_10042884 3300010375 Bacteria 4958
115 Ga0105239_10047592 3300010375 Bacteria 4700
116 Ga0105239_10372414 3300010375 Bacteria 1614
117 Ga0105239_10545061 3300010375 Bacteria 1321
118 Ga0157370_10162022 3300013104 Bacteria 2081
119 Ga0157369_10005445 3300013105 Bacteria 14806
120 Ga0157369_10055761 3300013105 Bacteria 4266
121 Ga0157369_10195156 3300013105 Bacteria 2126
122 Ga0157374_10054391 3300013296 Bacteria 3734
123 Ga0157378_10009302 3300013297 Bacteria 8559
124 Ga0163162_10800354 3300013306 Bacteria 1060
125 Ga0157372_10291393 3300013307 Bacteria 1898
126 Ga0157372_10477173 3300013307 Bacteria 1454
127 Ga0157375_10271222 3300013308 Bacteria 1859
128 Ga0163163_10123302 3300014325 Bacteria 2627
129 Ga0163163_10785961 3300014325 Bacteria 1015
130 Ga0214544_1000053 3300021320 Bacteria 133908
131 Ga0214542_1000058 3300021321 Bacteria 133923
132 Ga0214545_1000026 3300021324 Bacteria 133811
133 Ga0214543_1000160 3300021327 Bacteria 96627
134 Ga0209677_100241 3300025253 Bacteria 37674
135 Ga0209677_104068 3300025253 Bacteria 4395
136 Ga0209148_1015343 3300025254 Bacteria 1339
137 Ga0209233_1001843 3300025261 Bacteria 8137
138 Ga0209233_1004236 3300025261 Bacteria 4913
139 Ga0209455_1001205 3300025272 Bacteria 12353
140 Ga0209455_1002355 3300025272 Bacteria 7368
141 Ga0209564_1015668 3300025295 Bacteria 3068
142 Ga0209758_1000011 3300025297 Bacteria 1049685
143 Ga0209758_1000607 3300025297 Bacteria 55510
144 Ga0209758_1000940 3300025297 Bacteria 39289
145 Ga0209758_1006006 3300025297 Bacteria 8975
146 Ga0209758_1008510 3300025297 Bacteria 6620
147 Ga0209256_1009509 3300025299 Bacteria 4250
148 Ga0207426_1000505 3300025302 Bacteria 57583
149 Ga0207426_1039334 3300025302 Bacteria 1482
150 Ga0209257_1000158 3300025304 Bacteria 180079
151 Ga0207680_10093283 3300025903 Bacteria 1920
152 Ga0207680_10278491 3300025903 Bacteria 1162
153 Ga0207680_10298733 3300025903 Bacteria 1122
154 Ga0207699_10001555 3300025906 Bacteria 10866
155 Ga0207699_10319276 3300025906 Bacteria 1089
156 Ga0207654_10073023 3300025911 Bacteria 2044
157 Ga0207654_10094196 3300025911 Bacteria 1832
158 Ga0207707_10000776 3300025912 Bacteria 31443
159 Ga0207707_10289319 3300025912 Bacteria 1418
160 Ga0207695_10000157 3300025913 Bacteria 204140
161 Ga0207671_10015678 3300025914 Bacteria 5924
162 Ga0207671_10134286 3300025914 Bacteria 1902
163 Ga0207671_10192066 3300025914 Bacteria 1592
164 Ga0207693_10007365 3300025915 Bacteria 9049
165 Ga0207693_10019200 3300025915 Bacteria 5440
166 Ga0207663_10010754 3300025916 Bacteria 4886
167 Ga0207657_10156033 3300025919 Bacteria 1856
168 Ga0207649_10152879 3300025920 Bacteria 1591
169 Ga0207652_10016460 3300025921 Bacteria 6038
170 Ga0207652_10030215 3300025921 Bacteria 4535
171 Ga0207681_10293204 3300025923 Bacteria 1285
172 Ga0207664_10011234 3300025929 Bacteria 6351
173 Ga0207664_10178534 3300025929 Bacteria 1822
174 Ga0207644_10056453 3300025931 Bacteria 2834
175 Ga0207706_10112320 3300025933 Bacteria 2397
176 Ga0207704_10125883 3300025938 Bacteria 1764
177 Ga0207665_10338905 3300025939 Bacteria 1132
178 Ga0207661_10000407 3300025944 Bacteria 27744
179 Ga0207667_10051838 3300025949 Bacteria 4324
180 Ga0207668_10045989 3300025972 Bacteria 2979
181 Ga0207658_10315793 3300025986 Bacteria 1351
182 Ga0207703_10162769 3300026035 Bacteria 1955
183 Ga0207639_10184501 3300026041 Bacteria 1777
184 Ga0207639_10308964 3300026041 Bacteria 1400
185 Ga0207678_10014040 3300026067 Bacteria 7044
186 Ga0207678_10035191 3300026067 Bacteria 4361
187 Ga0207678_10075652 3300026067 Bacteria 2884
188 Ga0207676_10310738 3300026095 Bacteria 1443
189 Ga0207683_10205835 3300026121 Bacteria 1790
190 Ga0209389_1000073 3300027296 Bacteria 94298
191 Ga0209389_1000160 3300027296 Bacteria 56126
192 Ga0209589_1000484 3300027357 Bacteria 56126
193 Ga0209489_100917 3300027361 Bacteria 58978
194 Ga0209489_100982 3300027361 Bacteria 57399
195 Ga0209700_100067 3300027363 Bacteria 144074
196 Ga0209813_10015301 3300027866 Bacteria 2076
197 Ga0268266_10001288 3300028379 Bacteria 30547
198 Ga0307517_10000392 3300028786 Bacteria 74887
199 Ga0307515_10016635 3300028794 Bacteria 13449
200 Ga0307515_10085987 3300028794 Bacteria 4016
201 Ga0307515_10142289 3300028794 Bacteria 2565
202 Ga0265330_10004698 3300031235 Bacteria 6900
203 Ga0265330_10028627 3300031235 Bacteria 2510
204 Ga0265328_10000545 3300031239 Bacteria 17506
205 Ga0265325_10019839 3300031241 Bacteria 3712
206 Ga0265340_10052280 3300031247 Bacteria 1976
207 Ga0265339_10122461 3300031249 Bacteria 1335
208 Ga0265331_10027630 3300031250 Bacteria 2843
209 Ga0265331_10038936 3300031250 Bacteria 2321
210 Ga0265316_10092067 3300031344 Bacteria 2312
211 Ga0307509_10006372 3300031507 Bacteria 15921
212 Ga0307408_100519327 3300031548 Bacteria 1046
213 Ga0265314_10031509 3300031711 Bacteria 3912
214 Ga0307516_10040004 3300031730 Bacteria 4669
215 Ga0307412_10168330 3300031911 Bacteria 1636
216 Ga0307510_10005570 3300033180 Bacteria 15003
217 Ga0373951_0000914 3300035091 Bacteria 7959
218 Ga0373937_0243111 3300036401 Bacteria 1696
219 Ga0373925_0385148 3300037068 Bacteria 1142
220 Ga0395905_0075935 3300037471 Bacteria 3149
221 Ga0395905_0472178 3300037471 Bacteria 1153
222 Ga0395901_0058487 3300038443 Bacteria 4009
223 Ga0436365_0998043 3300039437 Bacteria 1166
224 Ga0436365_1021776 3300039437 Bacteria 2257
225 Ga0436361_0113453 3300039447 Bacteria 1397
226 Ga0436363_1630017 3300039450 Bacteria 3031
227 Ga0451795_1558593 3300041456 Bacteria 1065
228 Ga0451849_0449595 3300041505 Bacteria 1229
229 Ga0451577_0007043 3300042876 Bacteria 11089
230 Ga0466972_0038783 3300044658 Bacteria 2326
231 Ga0453683_0133632 3300044673 Bacteria 1564
232 Ga0466965_0025714 3300044683 Bacteria 2851
233 Ga0466965_0102899 3300044683 Bacteria 1462
234 Ga0466966_0000763 3300044684 Bacteria 20420
235 Ga0466961_0000505 3300044693 Bacteria 24872
236 Ga0466964_0073701 3300044706 Bacteria 1450
237 Ga0453684_0067870 3300044712 Bacteria 4532
238 Ga0453684_0328094 3300044712 Bacteria 1731
239 Ga0466968_0010380 3300044735 Bacteria 3608
240 Ga0466968_0046133 3300044735 Bacteria 1851
241 Ga0466970_0107156 3300044765 Bacteria 1525
242 Ga0466960_0007628 3300044901 Bacteria 4405
243 Ga0466959_0033585 3300045049 Bacteria 3794
244 Ga0451576_0005035 3300045051 Bacteria 16777
245 Ga0451576_0079063 3300045051 Bacteria 3422
246 Ga0451576_0101485 3300045051 Bacteria 2992
247 Ga0495590_0014141 3300046457 Bacteria 2919
248 Ga0495590_0070649 3300046457 Bacteria 1225
249 Ga0495629_0005760 3300046459 Bacteria 9249
250 Ga0495638_0002608 3300046460 Bacteria 14546
251 Ga0495638_0045766 3300046460 Bacteria 2751
252 Ga0495638_0065610 3300046460 Bacteria 2233
253 Ga0495651_0028772 3300046462 Bacteria 4331
254 Ga0495651_0195488 3300046462 Bacteria 1420
255 Ga0495650_0045815 3300046471 Bacteria 1839
256 Ga0495580_0112493 3300046472 Bacteria 1891
257 Ga0495605_0033462 3300046474 Bacteria 2608
258 Ga0495605_0139751 3300046474 Bacteria 1087
259 Ga0495585_0099430 3300046492 Bacteria 1557
260 Ga0495583_0040266 3300046506 Bacteria 2196
261 Ga0495606_0069954 3300046507 Bacteria 2215
262 Ga0495606_0143600 3300046507 Bacteria 1407
263 Ga0495606_0145043 3300046507 Bacteria 1399
264 Ga0495610_0118979 3300046512 Bacteria 1160
265 Ga0495618_0109740 3300046514 Bacteria 1767
266 Ga0495637_0069245 3300046520 Bacteria 1428
267 Ga0495643_0024774 3300046522 Bacteria 3401
268 Ga0495643_0032817 3300046522 Bacteria 2879
269 Ga0495643_0063138 3300046522 Bacteria 1959
270 Ga0495648_0077530 3300046524 Bacteria 1904
271 Ga0495652_0137878 3300046529 Bacteria 1922
272 Ga0495597_0016185 3300046542 Bacteria 3525
273 Ga0495656_0018309 3300046615 Bacteria 2687
274 Ga0495656_0129729 3300046615 Bacteria 1199
275 Ga0495668_0086988 3300046616 Bacteria 1714
276 Ga0495611_0033322 3300046648 Bacteria 2272
277 Ga0495625_0265772 3300046660 Bacteria 1109
278 Ga0495661_0041611 3300046665 Bacteria 2841
279 Ga0495588_0012046 3300046674 Bacteria 4077
280 Ga0495588_0138403 3300046674 Bacteria 1285
281 Ga0495589_0041848 3300046794 Bacteria 2284
282 Ga0495589_0122487 3300046794 Bacteria 1252
283 Ga0495600_0131625 3300046809 Bacteria 1626
284 Ga0495604_0088554 3300047317 Bacteria 2302
285 Ga0495604_0093028 3300047317 Bacteria 2232
286 Ga0495674_0101687 3300047319 Bacteria 2445
287 Ga0495683_0050579 3300047323 Bacteria 2079
288 Ga0495687_080059 3300047443 Bacteria 1282
289 Ga0495673_0092130 3300047469 Bacteria 1237
290 Ga0495686_0075748 3300047472 Bacteria 2062
291 Ga0496100_0106446 3300048903 Bacteria 1941
292 Ga0496102_0061998 3300048905 Bacteria 3424
293 Ga0496102_0126772 3300048905 Bacteria 2387
294 Ga0496102_0127103 3300048905 Bacteria 2383
295 Ga0496103_0017407 3300048906 Bacteria 4302
296 Ga0496104_0047658 3300048907 Bacteria 4039
297 Ga0496104_0101988 3300048907 Bacteria 2748
298 Ga0496104_0283318 3300048907 Bacteria 1570
299 Ga0496105_0166925 3300048908 Bacteria 1806
300 Ga0496105_0261234 3300048908 Bacteria 1400
301 Ga0496107_0156539 3300048910 Bacteria 1687
302 Ga0496107_0236345 3300048910 Bacteria 1360
303 Ga0496107_0253894 3300048910 Bacteria 1308
304 Ga0496108_0269043 3300048911 Bacteria 1483
305 Ga0496109_0082292 3300048912 Bacteria 2967
306 Ga0496110_0226661 3300048913 Bacteria 1699
307 Ga0496110_0478112 3300048913 Bacteria 1135
308 Ga0496111_0029968 3300048914 Bacteria 3868
309 Ga0496112_0116037 3300048915 Bacteria 2648
310 Ga0496112_0204552 3300048915 Bacteria 1933
311 Ga0496112_0313510 3300048915 Bacteria 1514
312 Ga0496113_0115319 3300048916 Bacteria 2096
313 Ga0496113_0208976 3300048916 Bacteria 1553
314 Ga0496115_0242129 3300048918 Bacteria 1486
315 Ga0496116_0025695 3300048919 Bacteria 4324
316 Ga0496117_0168329 3300048920 Bacteria 1275
317 Ga0496118_0041863 3300048921 Bacteria 3621
318 Ga0496119_0067899 3300048922 Bacteria 2101
319 Ga0496121_0014474 3300048924 Bacteria 8365
320 Ga0496121_0016063 3300048924 Bacteria 7759
321 Ga0496122_0108719 3300048925 Bacteria 1828
322 Ga0496122_0194615 3300048925 Bacteria 1192
323 Ga0496122_0219830 3300048925 Bacteria 1091
324 Ga0496125_0000063 3300048928 Bacteria 250260
325 Ga0496125_0000829 3300048928 Bacteria 49885
326 Ga0496125_0036272 3300048928 Bacteria 4309
327 Ga0496125_0045218 3300048928 Bacteria 3710
328 Ga0496126_0001653 3300048929 Bacteria 33549
329 Ga0496126_0033602 3300048929 Bacteria 4823
330 Ga0496126_0120335 3300048929 Bacteria 2278
331 Ga0496126_0155587 3300048929 Bacteria 1957
332 Ga0496126_0287307 3300048929 Bacteria 1361
333 Ga0495682_0014295 3300049460 Bacteria 3012
334 Ga0501034_0588468 3300049571 Bacteria 1019
335 Ga0501047_0031654 3300049581 Bacteria 5104
336 Ga0501067_0287831 3300049583 Bacteria 915
337 Ga0501070_0129897 3300049586 Bacteria 2081
338 Ga0501080_0008865 3300049742 Bacteria 9144
339 Ga0501044_0053414 3300049823 Bacteria 4157
340 nmdc:mga03683_89617_c1 3300050489 Bacteria 1339
341 nmdc:mga03n38_35921_c1 3300050490 Bacteria 2127
342 nmdc:mga03n38_835_c1 3300050490 Bacteria 8246
343 nmdc:mga0yw44_216649_c1 3300050492 Bacteria 1268
344 nmdc:mga0yw44_26574_c1 3300050492 Bacteria 3308
345 nmdc:mga0k408_67463_c1 3300050493 Bacteria 2085
346 nmdc:mga06z11_5120_c1 3300050494 Bacteria 5227
347 nmdc:mga06z11_85384_c1 3300050494 Bacteria 1703
348 nmdc:mga04h51_19397_c1 3300050495 Bacteria 2016
349 nmdc:mga07m45_2049_c3 3300050496 Bacteria 6903
350 nmdc:mga07m45_69319_c1 3300050496 Bacteria 2005
351 nmdc:mga0sz30_204612_c1 3300050516 Bacteria 877
352 nmdc:mga0sz30_45534_c1 3300050516 Bacteria 1850
353 Ga0500635_0055225 3300053080 Bacteria 1371
354 Ga0495655_0056559 3300053083 Bacteria 1056
355 Ga0500643_001353 3300053087 Bacteria 14266
356 Ga0500644_0137022 3300053088 Bacteria 969
357 Ga0500651_0030706 3300053093 Bacteria 3382
358 Ga0500566_0000040 3300053094 Bacteria 66046
359 Ga0500566_0000057 3300053094 Bacteria 53723
360 Ga0500566_0061419 3300053094 Bacteria 2127
361 Ga0500640_000194 3300053095 Bacteria 12934
362 Ga0500641_0007880 3300053096 Bacteria 3797
363 Ga0500650_0001791 3300053098 Bacteria 6706
364 Ga0500650_0041809 3300053098 Bacteria 2117
365 Ga0500557_000106 3300053105 Bacteria 25501
366 Ga0500562_007305 3300053108 Bacteria 2788
367 Ga0500572_000127 3300053111 Bacteria 25536
368 Ga0500572_000443 3300053111 Bacteria 14511
369 Ga0500572_001713 3300053111 Bacteria 5698
370 Ga0500607_070991 3300053121 Bacteria 1798
371 Ga0500608_090318 3300053122 Bacteria 1433
372 Ga0500614_008970 3300053123 Bacteria 2127
373 Ga0500642_0000068 3300053130 Bacteria 56277
374 Ga0500652_000639 3300053131 Bacteria 11973
375 Ga0500658_0017555 3300053134 Bacteria 2674
376 Ga0500658_0110513 3300053134 Bacteria 1209
377 Ga0500559_0002888 3300053136 Bacteria 8657
378 Ga0500568_0005042 3300053139 Bacteria 6915
379 Ga0500568_0058158 3300053139 Bacteria 1503
380 Ga0500589_026976 3300053147 Bacteria 2665
381 Ga0500590_034245 3300053148 Bacteria 2630
382 Ga0500603_000111 3300053150 Bacteria 19037
383 Ga0500604_0000656 3300053151 Bacteria 9492
384 Ga0500616_0103653 3300053153 Bacteria 1386
385 Ga0500620_002695 3300053155 Bacteria 3641
386 Ga0500622_0038696 3300053156 Bacteria 2488
387 Ga0500627_0011475 3300053158 Bacteria 3276
388 Ga0500627_0024146 3300053158 Bacteria 2484
389 Ga0500627_0163022 3300053158 Unclassified 1005
390 Ga0500630_000675 3300053159 Bacteria 15519
391 Ga0500634_0035492 3300053161 Bacteria 2716
392 Ga0500638_063049 3300053162 Bacteria 1779
393 Ga0500639_000003 3300053163 Bacteria 230428
394 Ga0500636_0000059 3300053177 Bacteria 52601
395 Ga0500636_0048782 3300053177 Bacteria 2491
396 Ga0500636_0056820 3300053177 Bacteria 2290
397 Ga0500637_0128813 3300053178 Bacteria 1468
398 Ga0500625_005504 3300053729 Bacteria 5301
399 Ga0500609_003497 3300053731 Bacteria 2199
400 Ga0500596_002114 3300053735 Bacteria 3959
401 Ga0500596_007576 3300053735 Bacteria 1772
402 Ga0500601_000439 3300053737 Bacteria 6834
403 Ga0500601_006549 3300053737 Bacteria 1283
404 2507507102 2507262055 Bacteria 8048963
405 2508541151 2508501009 Bacteria 7784016
406 2508693513 2508501042 Bacteria 8719808
407 2511398519 2511231028 Bacteria 8046582
408 2513626339 2513237092 Bacteria 8341956
409 2513637282 2513237094 Bacteria 8789602
410 2513651673 2513237095 Bacteria 8976980
411 2513674122 2513237098 Bacteria 9902361
412 2513876837 2513237139 Bacteria 8737671
413 2514012126 2513237161 Bacteria 8871253
414 2515628869 2515154112 Bacteria 8294334
415 2517107432 2517093001 Bacteria 9002274
416 2524439496 2524023205 Bacteria 8918781
417 2524465097 2524023210 Bacteria 9029266
418 2528858676 2528768022 Bacteria 10457665
419 2599103775 2597490356 Bacteria 7030811
420 2617348081 2617270735 Bacteria 9163226
421 2617377687 2617270741 Bacteria 8201522
422 2745078207 2744054633 Bacteria 8678936
423 2793064377 2791355196 Bacteria 7323613
424 2805922137 2802429603 Bacteria 8777136
425 2818243183 2816332527 Bacteria 8933356
426 2824603231 2824600985 Bacteria 8488197
427 2824614769 2824609381 Bacteria 8672835
428 2824630241 2824626560 Bacteria 8813858
429 2824636441 2824635225 Bacteria 8785348
430 2824644802 2824644064 Bacteria 8743947
431 2824656030 2824653114 Bacteria 8493680
432 2824664418 2824661429 Bacteria 9877870
433 2824673768 2824671348 Bacteria 8369588
434 2824686751 2824679649 Bacteria 8248951
435 2824690349 2824687955 Bacteria 8360029
436 2824696740 2824696289 Bacteria 8335049
437 2824706770 2824704595 Bacteria 9667483
438 2824715334 2824714736 Bacteria 8717648
439 2824724589 2824723954 Bacteria 8758240
440 2824746370 2824746037 Bacteria 7911610
441 2824760463 2824753945 Bacteria 9787441
442 2824768145 2824763712 Bacteria 9792355
443 2824776195 2824773399 Bacteria 8360218
444 2838126949 2838122688 Bacteria 8803140
445 2841945571 2841941048 Bacteria 8688029
446 2841954787 2841949485 Bacteria 8680857
447 2841966139 2841957949 Bacteria 8652217
448 2841972429 2841966195 Bacteria 8673214
449 2841980513 2841974524 Bacteria 8931498
450 2841988684 2841983080 Bacteria 8395090
451 2842044972 2842038055 Bacteria 8002051
452 2842052842 2842045827 Bacteria 8006841
453 2844320592 2844315083 Bacteria 8138177
454 2846957462 2846952575 Bacteria 6587527
455 2847938127 2847930680 Bacteria 9342022
456 2847940046 2847939898 Bacteria 8606328
457 2848863257 2848858292 Bacteria 7391279
458 2849077759 2849076700 Bacteria 7039503
459 2857510935 2857509624 Bacteria 7472071
460 2874591495 2874590934 Bacteria 8299676
461 2874618981 2874612657 Bacteria 8252029
462 2874625916 2874620515 Bacteria 8290088
463 2874634256 2874628541 Bacteria 8630250
464 2874645858 2874645413 Bacteria 8214782
465 2876762133 2876761206 Bacteria 10111113
466 2876771635 2876771140 Bacteria 8287509
467 2876818969 2876818435 Bacteria 8274608
468 2879075477 2879074833 Bacteria 8279565
469 2879084327 2879083081 Bacteria 8587928
470 2879101134 2879099564 Bacteria 10442239
471 2879129661 2879127579 Bacteria 8294491
472 2879145608 2879142872 Bacteria 8267021
473 2881364434 2881364244 Bacteria 7710352
474 2881669651 2881665667 Bacteria 8175609
475 2885368523 2885366525 Bacteria 8326213
476 2885388664 2885383462 Bacteria 9473874
477 2885413276 2885409591 Bacteria 9235467
478 2888386078 2888378607 Bacteria 9652610
479 2888392209 2888388044 Bacteria 7304136
480 2888426195 2888419890 Bacteria 7857137
481 2903733410 2903727486 Bacteria 8281579
482 2903777783 2903768456 Bacteria 9749579
483 2904673724 2904666416 Bacteria 8226587
484 2904717542 2904711408 Bacteria 9771557
485 2906605683 2906602504 Bacteria 8295279
486 2906629372 2906626472 Bacteria 8826946
487 2906640341 2906635258 Bacteria 8601019
488 2906644027 2906643746 Bacteria 8722424
489 2906667261 2906660503 Bacteria 8595048
490 2908782270 2908775508 Bacteria 8092255
491 2922376411
492 2922399872 2922393267 Bacteria 8285685
493 2929624062 2929615660 Bacteria 9193770
494 2929633203 2929624759 Bacteria 9339455
495 2932792629 2932784394 Bacteria 9704911
496 2932797919 2932794094 Bacteria 7915132
497 2932806455 2932801729 Bacteria 7987968
498 2932815280 2932809354 Bacteria 9135765
499 2932824440 2932818245 Bacteria 9955613
500 2932832161 2932828146 Bacteria 9745859
501 2933585962 2933577622 Bacteria 9116884
502 2935610517 2935608549 Bacteria 8203142
503 2935622099 2935616580 Bacteria 9032984
504 2935643890 2935638405 Bacteria 10015038
505 2935654278 2935648319 Bacteria 8801166
506 2935663158 2935656913 Bacteria 8965014
507 2935669194 2935665750 Bacteria 9571747
508 2935683248 2935675223 Bacteria 9928132
509 2935692189 2935684952 Bacteria 9590419
510 2935700640 2935694250 Bacteria 9291695
511 2935708730 2935703347 Bacteria 10242284
512 2935720573 2935713505 Bacteria 9608509
513 2935729854 2935722832 Bacteria 9608746
514 2935739164 2935732158 Bacteria 9706831
515 2935748295 2935741537 Bacteria 9707219
516 2935758498 2935750917 Bacteria 9590372
517 2935766076 2935760218 Bacteria 9817913
518 2935770952 2935769743 Bacteria 7878163
519 2935781119 2935777560 Bacteria 8077691
520 2935786347 2935785616 Bacteria 7962367
521 2935793856 2935793552 Bacteria 8012592
522 2935805910 2935801545 Bacteria 9301974
523 2935815531 2935810662 Bacteria 9401221
524 2935823678 2935819856 Bacteria 8261050
525 2935833142 2935827899 Bacteria 10038562
526 2935843287 2935837841 Bacteria 9454360
527 2935849204 2935847175 Bacteria 8228321
528 2935860346 2935855204 Bacteria 9035059
529 2935867744 2935864058 Bacteria 9784707
530 2935878447 2935873716 Bacteria 9632195
531 2935888706 2935883170 Bacteria 7964738
532 2935916659 2935908558 Bacteria 8568796
533 2935922981 2935916978 Bacteria 9113783
534 2935934148 2935926038 Bacteria 8601059
535 2935942620 2935934488 Bacteria 8602579
536 2935951060 2935942939 Bacteria 8599779
537 2935959521 2935951376 Bacteria 8602333
538 2935966899 2935959822 Bacteria 7869783
539 2935975611 2935967501 Bacteria 8603075
540 2935975978 2935975950 Bacteria 8347125
541 2935986533 2935984226 Bacteria 8302647
542 2935998670 2935992306 Bacteria 9802711
543 2936006976 2936002035 Bacteria 9362176
544 2936017314 2936011229 Bacteria 8801034
545 2936025816 2936019824 Bacteria 8804134
546 2936034776 2936028420 Bacteria 8965941
547 2936040769 2936037263 Bacteria 9446081
548 2936052833 2936046547 Bacteria 8903709
549 2936060028 2936055302 Bacteria 8785755
550 2940564402 2940556831 Bacteria 9590747
551 2941531787 2941531003 Bacteria 7653939
552 2941544833 2941538514 Bacteria 9402094
553 3005488865 3005483717 Bacteria 7877331
554 3005508000 3005506211 Bacteria 6943378
555 3005593317 3005587118 Bacteria 7794411
556 3005600988 3005594810 Bacteria 8716512
557 3005716377 3005710791 Bacteria 7622528
558 3005723757 3005718088 Bacteria 8283608
559 8006930423 8006926726 Bacteria 6749210
560 8016519996 8016511872 Bacteria 9921665
561 8016527920 8016522445 Bacteria 8156687
562 8016533038 8016530956 Bacteria 8155261
563 8016546273 8016539877 Bacteria 8155419
564 8016555857 8016548790 Bacteria 8155074
565 8016571353 8016566248 Bacteria 8158151
566 8016583825 8016575299 Bacteria 8154085
567 8016595114 8016583857 Bacteria 10421953
568 8016601901 8016595262 Bacteria 8149947
569 8016608343 8016603502 Bacteria 8731218
570 8016616523 8016613128 Bacteria 8794220
571 8016624618 8016622563 Bacteria 7999408
572 8016638108 8016630954 Bacteria 9217207
573 8017065551 8017057580 Bacteria 10023680
574 8019551655 8019547302 Bacteria 7996444
575 8019584954 8019576017 Bacteria 10049540
576 8019592911 8019586578 Bacteria 10212056
577 8019598547 8019597564 Bacteria 10041141
578 8019609831 8019608314 Bacteria 10042931
579 8019620411 8019619141 Bacteria 9218857
580 8019632691 8019629233 Bacteria 8687553
581 8019660556 8019659431 Bacteria 8577854
582 8019669981 8019668869 Bacteria 8791617
583 8019686122 8019678201 Bacteria 8863603
584 8019692300 8019687851 Bacteria 8712826
585 8055744467 8055742211 Bacteria 9226248
586 8056972097 8056967851 Bacteria 9038162
587 Ga0500559_0001477
588 JGI25153J46596_10000127
589 JGI25153J46596_10000201
590 JGI25153J46596_10011440
591 JGI25153J46596_10014157
592 JGI25153J46596_10033280
593 JGI25153J46596_10040758
594 rootH1_10069813
595 rootH1_10079915
596 rootH2_10064424
597 JGI25160J50197_1000386
598 JGI25160J50197_1000785
599 Ga0055531_10009083
600 Ga0055543_1001354
601 Ga0065165_1001118
602 Ga0065165_1025955
603 Ga0070658_10035558
604 Ga0070658_10035588
605 Ga0070683_100188812
606 Ga0070670_100128187
607 Ga0070666_10320974
608 Ga0070682_100348122
609 Ga0070660_100089457
610 Ga0070661_100067102
611 Ga0070668_100030431
612 Ga0070671_100080559
613 Ga0070667_100273288
614 Ga0070709_10035201
615 Ga0070709_10344262
616 Ga0070713_100074804
617 Ga0070711_100005751
618 Ga0070711_100005777
619 Ga0070700_100127945
620 Ga0070663_100015395
621 Ga0070663_100020741
622 Ga0070663_100162606
623 Ga0070663_100201269
624 Ga0070663_100250806
625 Ga0070678_100152994
626 Ga0070678_100443643
627 Ga0070681_10002390
628 Ga0070698_100052848
629 Ga0070679_100003890
630 Ga0070679_100338955
631 Ga0070684_100021854
632 Ga0068853_100385349
633 Ga0068853_100459514
634 Ga0070693_100041088
635 Ga0070693_100147883
636 Ga0070665_100011705
637 Ga0070665_100070688
638 Ga0070665_100087540
639 Ga0070665_100108577
640 Ga0068855_100386068
641 Ga0068856_100074029
642 Ga0068856_100286277
643 Ga0070702_100280444
644 Ga0068852_100031021
645 Ga0068852_100774512
646 Ga0068859_100066991
647 Ga0068859_100245105
648 Ga0068861_100325047
649 Ga0068870_10026046
650 Ga0068863_100658390
651 Ga0068858_100166458
652 Ga0068858_100277698
653 Ga0068858_100456550
654 Ga0068860_100000213
655 Ga0068860_100497428
656 Ga0081540_1006747
657 Ga0081540_1045469
658 Ga0081540_1064067
659 Ga0081539_10070313
660 Ga0070717_10090227
661 Ga0075365_10098373
662 Ga0075365_10193524
663 Ga0075363_100003660
664 Ga0075363_100018202
665 Ga0075364_10103022
666 Ga0070712_100026707
667 Ga0075362_10069207
668 Ga0075367_10026945
669 Ga0075367_10187462
670 Ga0075369_10010834
671 Ga0075369_10048713
672 Ga0075369_10088288
673 Ga0075366_10028318
674 Ga0075366_10202663
675 Ga0097621_100198095
676 Ga0075370_10045496
677 Ga0068865_100145103
678 Ga0097620_100066990
679 Ga0097620_100245103
680 Ga0099822_1042973
681 Ga0105240_10000556
682 Ga0105240_10015762
683 Ga0105247_10020281
684 Ga0105247_10086184
685 Ga0105241_10062260
686 Ga0105241_10098738
687 Ga0105242_10340383
688 Ga0105237_10001571
689 Ga0105237_10009910
690 Ga0105237_10218422
691 Ga0105237_10322824
692 Ga0105237_10335048
693 Ga0105237_10628923
694 Ga0105238_10061555
695 Ga0105238_10098262
696 Ga0105238_10211164
697 Ga0105238_10352862
698 Ga0105238_10640505
699 Ga0105239_10005373
700 Ga0105239_10042884
701 Ga0105239_10047592
702 Ga0105239_10372414
703 Ga0105239_10545061
704 Ga0157370_10162022
705 Ga0157369_10005445
706 Ga0157369_10055761
707 Ga0157369_10195156
708 Ga0157374_10054391
709 Ga0157378_10009302
710 Ga0163162_10800354
711 Ga0157372_10291393
712 Ga0157372_10477173
713 Ga0157375_10271222
714 Ga0163163_10123302
715 Ga0163163_10785961
716 Ga0214544_1000053
717 Ga0214542_1000058
718 Ga0214545_1000026
719 Ga0214543_1000160
720 Ga0209677_100241
721 Ga0209677_104068
722 Ga0209148_1015343
723 Ga0209233_1001843
724 Ga0209233_1004236
725 Ga0209455_1001205
726 Ga0209455_1002355
727 Ga0209564_1015668
728 Ga0209758_1000011
729 Ga0209758_1000607
730 Ga0209758_1000940
731 Ga0209758_1006006
732 Ga0209758_1008510
733 Ga0209256_1009509
734 Ga0207426_1000505
735 Ga0207426_1039334
736 Ga0209257_1000158
737 Ga0207680_10093283
738 Ga0207680_10278491
739 Ga0207680_10298733
740 Ga0207699_10001555
741 Ga0207699_10319276
742 Ga0207654_10073023
743 Ga0207654_10094196
744 Ga0207707_10000776
745 Ga0207707_10289319
746 Ga0207695_10000157
747 Ga0207671_10015678
748 Ga0207671_10134286
749 Ga0207671_10192066
750 Ga0207693_10007365
751 Ga0207693_10019200
752 Ga0207663_10010754
753 Ga0207657_10156033
754 Ga0207649_10152879
755 Ga0207652_10016460
756 Ga0207652_10030215
757 Ga0207681_10293204
758 Ga0207664_10011234
759 Ga0207664_10178534
760 Ga0207644_10056453
761 Ga0207706_10112320
762 Ga0207704_10125883
763 Ga0207665_10338905
764 Ga0207661_10000407
765 Ga0207667_10051838
766 Ga0207668_10045989
767 Ga0207658_10315793
768 Ga0207703_10162769
769 Ga0207639_10184501
770 Ga0207639_10308964
771 Ga0207678_10014040
772 Ga0207678_10035191
773 Ga0207678_10075652
774 Ga0207676_10310738
775 Ga0207683_10205835
776 Ga0209389_1000073
777 Ga0209389_1000160
778 Ga0209589_1000484
779 Ga0209489_100917
780 Ga0209489_100982
781 Ga0209700_100067
782 Ga0209813_10015301
783 Ga0268266_10001288
784 Ga0307517_10000392
785 Ga0307515_10016635
786 Ga0307515_10085987
787 Ga0307515_10142289
788 Ga0265330_10004698
789 Ga0265330_10028627
790 Ga0265328_10000545
791 Ga0265325_10019839
792 Ga0265340_10052280
793 Ga0265339_10122461
794 Ga0265331_10027630
795 Ga0265331_10038936
796 Ga0265316_10092067
797 Ga0307509_10006372
798 Ga0307408_100519327
799 Ga0265314_10031509
800 Ga0307516_10040004
801 Ga0307412_10168330
802 Ga0307510_10005570
803 Ga0373951_0000914
804 Ga0373937_0243111
805 Ga0373925_0385148
806 Ga0395905_0075935
807 Ga0395905_0472178
808 Ga0395901_0058487
809 Ga0436365_0998043
810 Ga0436365_1021776
811 Ga0436361_0113453
812 Ga0436363_1630017
813 Ga0451795_1558593
814 Ga0451849_0449595
815 Ga0451577_0007043
816 Ga0466972_0038783
817 Ga0453683_0133632
818 Ga0466965_0025714
819 Ga0466965_0102899
820 Ga0466966_0000763
821 Ga0466961_0000505
822 Ga0466964_0073701
823 Ga0453684_0067870
824 Ga0453684_0328094
825 Ga0466968_0010380
826 Ga0466968_0046133
827 Ga0466970_0107156
828 Ga0466960_0007628
829 Ga0466959_0033585
830 Ga0451576_0005035
831 Ga0451576_0079063
832 Ga0451576_0101485
833 Ga0495590_0014141
834 Ga0495590_0070649
835 Ga0495629_0005760
836 Ga0495638_0002608
837 Ga0495638_0045766
838 Ga0495638_0065610
839 Ga0495651_0028772
840 Ga0495651_0195488
841 Ga0495650_0045815
842 Ga0495580_0112493
843 Ga0495605_0033462
844 Ga0495605_0139751
845 Ga0495585_0099430
846 Ga0495583_0040266
847 Ga0495606_0069954
848 Ga0495606_0143600
849 Ga0495606_0145043
850 Ga0495610_0118979
851 Ga0495618_0109740
852 Ga0495637_0069245
853 Ga0495643_0024774
854 Ga0495643_0032817
855 Ga0495643_0063138
856 Ga0495648_0077530
857 Ga0495652_0137878
858 Ga0495597_0016185
859 Ga0495656_0018309
860 Ga0495656_0129729
861 Ga0495668_0086988
862 Ga0495611_0033322
863 Ga0495625_0265772
864 Ga0495661_0041611
865 Ga0495588_0012046
866 Ga0495588_0138403
867 Ga0495589_0041848
868 Ga0495589_0122487
869 Ga0495600_0131625
870 Ga0495604_0088554
871 Ga0495604_0093028
872 Ga0495674_0101687
873 Ga0495683_0050579
874 Ga0495687_080059
875 Ga0495673_0092130
876 Ga0495686_0075748
877 Ga0496100_0106446
878 Ga0496102_0061998
879 Ga0496102_0126772
880 Ga0496102_0127103
881 Ga0496103_0017407
882 Ga0496104_0047658
883 Ga0496104_0101988
884 Ga0496104_0283318
885 Ga0496105_0166925
886 Ga0496105_0261234
887 Ga0496107_0156539
888 Ga0496107_0236345
889 Ga0496107_0253894
890 Ga0496108_0269043
891 Ga0496109_0082292
892 Ga0496110_0226661
893 Ga0496110_0478112
894 Ga0496111_0029968
895 Ga0496112_0116037
896 Ga0496112_0204552
897 Ga0496112_0313510
898 Ga0496113_0115319
899 Ga0496113_0208976
900 Ga0496115_0242129
901 Ga0496116_0025695
902 Ga0496117_0168329
903 Ga0496118_0041863
904 Ga0496119_0067899
905 Ga0496121_0014474
906 Ga0496121_0016063
907 Ga0496122_0108719
908 Ga0496122_0194615
909 Ga0496122_0219830
910 Ga0496125_0000063
911 Ga0496125_0000829
912 Ga0496125_0036272
913 Ga0496125_0045218
914 Ga0496126_0001653
915 Ga0496126_0033602
916 Ga0496126_0120335
917 Ga0496126_0155587
918 Ga0496126_0287307
919 Ga0495682_0014295
920 Ga0501034_0588468
921 Ga0501047_0031654
922 Ga0501067_0287831
923 Ga0501070_0129897
924 Ga0501080_0008865
925 Ga0501044_0053414
926 nmdc:mga03683_89617_c1
927 nmdc:mga03n38_35921_c1
928 nmdc:mga03n38_835_c1
929 nmdc:mga0yw44_216649_c1
930 nmdc:mga0yw44_26574_c1
931 nmdc:mga0k408_67463_c1
932 nmdc:mga06z11_5120_c1
933 nmdc:mga06z11_85384_c1
934 nmdc:mga04h51_19397_c1
935 nmdc:mga07m45_2049_c3
936 nmdc:mga07m45_69319_c1
937 nmdc:mga0sz30_204612_c1
938 nmdc:mga0sz30_45534_c1
939 Ga0500635_0055225
940 Ga0495655_0056559
941 Ga0500643_001353
942 Ga0500644_0137022
943 Ga0500651_0030706
944 Ga0500566_0000040
945 Ga0500566_0000057
946 Ga0500566_0061419
947 Ga0500640_000194
948 Ga0500641_0007880
949 Ga0500650_0001791
950 Ga0500650_0041809
951 Ga0500557_000106
952 Ga0500562_007305
953 Ga0500572_000127
954 Ga0500572_000443
955 Ga0500572_001713
956 Ga0500607_070991
957 Ga0500608_090318
958 Ga0500614_008970
959 Ga0500642_0000068
960 Ga0500652_000639
961 Ga0500658_0017555
962 Ga0500658_0110513
963 Ga0500559_0002888
964 Ga0500568_0005042
965 Ga0500568_0058158
966 Ga0500589_026976
967 Ga0500590_034245
968 Ga0500603_000111
969 Ga0500604_0000656
970 Ga0500616_0103653
971 Ga0500620_002695
972 Ga0500622_0038696
973 Ga0500627_0011475
974 Ga0500627_0024146
975 Ga0500627_0163022
976 Ga0500630_000675
977 Ga0500634_0035492
978 Ga0500638_063049
979 Ga0500639_000003
980 Ga0500636_0000059
981 Ga0500636_0048782
982 Ga0500636_0056820
983 Ga0500637_0128813
984 Ga0500625_005504
985 Ga0500609_003497
986 Ga0500596_002114
987 Ga0500596_007576
988 Ga0500601_000439
989 Ga0500601_006549
990 2507507102
991 2508541151
992 2508693513
993 2511398519
994 2513626339
995 2513637282
996 2513651673
997 2513674122
998 2513876837
999 2514012126
1000 2515628869
1001 2517107432
1002 2524439496
1003 2524465097
1004 2528858676
1005 2599103775
1006 2617348081
1007 2617377687
1008 2745078207
1009 2793064377
1010 2805922137
1011 2818243183
1012 2824603231
1013 2824614769
1014 2824630241
1015 2824636441
1016 2824644802
1017 2824656030
1018 2824664418
1019 2824673768
1020 2824686751
1021 2824690349
1022 2824696740
1023 2824706770
1024 2824715334
1025 2824724589
1026 2824746370
1027 2824760463
1028 2824768145
1029 2824776195
1030 2838126949
1031 2841945571
1032 2841954787
1033 2841966139
1034 2841972429
1035 2841980513
1036 2841988684
1037 2842044972
1038 2842052842
1039 2844320592
1040 2846957462
1041 2847938127
1042 2847940046
1043 2848863257
1044 2849077759
1045 2857510935
1046 2874591495
1047 2874618981
1048 2874625916
1049 2874634256
1050 2874645858
1051 2876762133
1052 2876771635
1053 2876818969
1054 2879075477
1055 2879084327
1056 2879101134
1057 2879129661
1058 2879145608
1059 2881364434
1060 2881669651
1061 2885368523
1062 2885388664
1063 2885413276
1064 2888386078
1065 2888392209
1066 2888426195
1067 2903733410
1068 2903777783
1069 2904673724
1070 2904717542
1071 2906605683
1072 2906629372
1073 2906640341
1074 2906644027
1075 2906667261
1076 2908782270
1077 2922376411
1078 2922399872
1079 2929624062
1080 2929633203
1081 2932792629
1082 2932797919
1083 2932806455
1084 2932815280
1085 2932824440
1086 2932832161
1087 2933585962
1088 2935610517
1089 2935622099
1090 2935643890
1091 2935654278
1092 2935663158
1093 2935669194
1094 2935683248
1095 2935692189
1096 2935700640
1097 2935708730
1098 2935720573
1099 2935729854
1100 2935739164
1101 2935748295
1102 2935758498
1103 2935766076
1104 2935770952
1105 2935781119
1106 2935786347
1107 2935793856
1108 2935805910
1109 2935815531
1110 2935823678
1111 2935833142
1112 2935843287
1113 2935849204
1114 2935860346
1115 2935867744
1116 2935878447
1117 2935888706
1118 2935916659
1119 2935922981
1120 2935934148
1121 2935942620
1122 2935951060
1123 2935959521
1124 2935966899
1125 2935975611
1126 2935975978
1127 2935986533
1128 2935998670
1129 2936006976
1130 2936017314
1131 2936025816
1132 2936034776
1133 2936040769
1134 2936052833
1135 2936060028
1136 2940564402
1137 2941531787
1138 2941544833
1139 3005488865
1140 3005508000
1141 3005593317
1142 3005600988
1143 3005716377
1144 3005723757
1145 8006930423
1146 8016519996
1147 8016527920
1148 8016533038
1149 8016546273
1150 8016555857
1151 8016571353
1152 8016583825
1153 8016595114
1154 8016601901
1155 8016608343
1156 8016616523
1157 8016624618
1158 8016638108
1159 8017065551
1160 8019551655
1161 8019584954
1162 8019592911
1163 8019598547
1164 8019609831
1165 8019620411
1166 8019632691
1167 8019660556
1168 8019669981
1169 8019686122
1170 8019692300
1171 8055744467
1172 8056972097

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01263

Aldose_epim

Aldose 1-epimerase

62

322

0.74

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dcd-assembly2.cif.gz_B x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. 0.9535 8 293
3dcd-assembly2.cif.gz_B x-ray structure of the galactose mutarotase related enzyme q5fkd7 from lactobacillus acidophilus at the resolution 1.9a. northeast structural genomics consortium target lar33. 0.9251 8 293
3q1n-assembly1.cif.gz_A crystal structure of a galactose mutarotase-like protein (lsei_2598) from lactobacillus casei atcc 334 at 1.61 a resolution 0.9229 8 292
3k25-assembly2.cif.gz_B crystal structure of slr1438 protein from synechocystis sp. pcc 6803, northeast structural genomics consortium target sgr112 0.8277 8 294
3mwx-assembly2.cif.gz_B crystal structure of a putative galactose mutarotase (bsu18360) from bacillus subtilis at 1.45 a resolution 0.8197 8 294
ID Description Score Start End Superfamily
3dcdA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.9266 9 293 2.70.98.10
3q1nA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.912 9 292 2.70.98.10
3dcdA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.899 9 293 2.70.98.10
3q1nA00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8908 9 292 2.70.98.10
3k25A00 Mainly Beta;Distorted Sandwich;Beta-galactosidase; Chain A, domain 5; 0.8268 8 294 2.70.98.10
ID Description Score Start End GO Terms
AF-A0A4S1F0Q1-F1-model_v4 Aldose 1-epimerase family protein 0.9937 98 236 GO:0005975
GO:0016853
GO:0030246
AF-A0A5E9AUR3-F1-model_v4 Aldose 1-epimerase family protein 0.9928 130 293 GO:0005975
GO:0016853
GO:0030246
AF-A0A5R2N1Q1-F1-model_v4 Aldose 1-epimerase family protein 0.9928 132 275 GO:0005975
GO:0016853
GO:0030246
AF-A0A1M7E8H2-F1-model_v4 Galactose mutarotase 0.9921 4 292 GO:0005975
GO:0016853
GO:0030246
AF-A0A4Q5PWN9-F1-model_v4 Aldose 1-epimerase family protein 0.9921 108 292 GO:0005975
GO:0016853
GO:0030246

Map