F466572

General Info

Members Datasets Scaffolds Average Seq Length
586 268 1172 258

Family's Representative Sequence

Representative Sequence 3300031852|Ga0307410_10001590|Ga0307410_100015902
Length 309
Sequence VSSSDPQPPSDPMTTDARPAAPQTLAVVRAAIAPLHAESRVSSPQTSQALAGELLLVHEERGDWLLAAGTDRYRGWVHRGYVERCAVSEASPAGGRVEATVALATAPWEPASTWALTRAVNRDADRLSLGCRVRFGRGPALTLPLGAGVANGAQLVDGRAVARDELPALFPAEPERVASTAVEYFAGTSYQWGGVTPWGADCSGMVQRVFALHGVSLPRDAWQQALIGDDAGRDIAALRAGDLLFFTDRDDGRTTHVGISVGASRMVHLALGRGGYAVDRFDAEADDYAARLAGRLVASRRVIAGSGAG

Samples

Sample ID Description Type Environment
1 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
2 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
62 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
63 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
64 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
65 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
66 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
67 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
68 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
74 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
98 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
157 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
158 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
159 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
160 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
163 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
164 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
165 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
166 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
168 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
169 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
170 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
175 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
187 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
188 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
189 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
193 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
197 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
200 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
203 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
204 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
205 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
213 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
214 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
215 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
216 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
223 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
230 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
231 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
243 3300049651 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_A_0_drought Metagenome Rhizosphere
244 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
245 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
246 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
247 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
248 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
249 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
250 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
251 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
252 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
253 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
254 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
255 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
256 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
257 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
258 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
259 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
261 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
262 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
263 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
264 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
267 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
268 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.71
Rhizosphere 97.44
Stem 0
Stem Tuber 0
Unclassified 11.6

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307410_10001590 3300031852 Bacteria 10405
2 Ga0065715_10415664 3300005293 Bacteria 864
3 Ga0070658_10000609 3300005327 Bacteria 31011
4 Ga0070658_10003341 3300005327 Bacteria 13233
5 Ga0070658_10030115 3300005327 Bacteria 4362
6 Ga0070658_10043475 3300005327 Bacteria 3628
7 Ga0070658_10080107 3300005327 Bacteria 2682
8 Ga0070658_10099314 3300005327 Bacteria 2405
9 Ga0070658_10102492 3300005327 Bacteria 2367
10 Ga0070676_10000202 3300005328 Bacteria 25282
11 Ga0070676_10087010 3300005328 Bacteria 1907
12 Ga0070676_10101651 3300005328 Bacteria 1777
13 Ga0070676_10594567 3300005328 Unclassified 797
14 Ga0070683_100001847 3300005329 Bacteria 16521
15 Ga0070683_100007527 3300005329 Bacteria 9206
16 Ga0070683_100010593 3300005329 Bacteria 7926
17 Ga0070683_100038714 3300005329 Bacteria 4372
18 Ga0070683_100042214 3300005329 Bacteria 4199
19 Ga0070683_100144771 3300005329 Bacteria 2251
20 Ga0070683_100417127 3300005329 Bacteria 1280
21 Ga0070690_100070012 3300005330 Unclassified 2277
22 Ga0070670_100032787 3300005331 Bacteria 4475
23 Ga0070670_100256362 3300005331 Bacteria 1524
24 Ga0070677_10100612 3300005333 Bacteria 1274
25 Ga0068869_100008846 3300005334 Bacteria 6513
26 Ga0070666_10039222 3300005335 Bacteria 3156
27 Ga0070680_100000021 3300005336 Bacteria 81631
28 Ga0070680_100000286 3300005336 Bacteria 33685
29 Ga0070680_100000588 3300005336 Bacteria 25079
30 Ga0070680_100042578 3300005336 Bacteria 3685
31 Ga0070680_100161037 3300005336 Bacteria 1886
32 Ga0070680_100233486 3300005336 Bacteria 1554
33 Ga0068868_100174520 3300005338 Bacteria 1781
34 Ga0070660_100004322 3300005339 Bacteria 9809
35 Ga0070660_100006754 3300005339 Bacteria 7962
36 Ga0070660_100017371 3300005339 Bacteria 5244
37 Ga0070660_100031668 3300005339 Bacteria 3974
38 Ga0070660_100161816 3300005339 Bacteria 1804
39 Ga0070660_100178877 3300005339 Bacteria 1716
40 Ga0070689_100001204 3300005340 Bacteria 16372
41 Ga0070689_100228834 3300005340 Bacteria 1528
42 Ga0070687_100009330 3300005343 Bacteria 4201
43 Ga0070661_100002666 3300005344 Bacteria 12223
44 Ga0070661_100014883 3300005344 Bacteria 5488
45 Ga0070692_10079817 3300005345 Bacteria 1760
46 Ga0070692_10219452 3300005345 Bacteria 1123
47 Ga0070668_100000342 3300005347 Bacteria 30729
48 Ga0070668_100003438 3300005347 Bacteria 11689
49 Ga0070668_100008597 3300005347 Bacteria 7584
50 Ga0070668_100027769 3300005347 Unclassified 4296
51 Ga0070668_100221837 3300005347 Bacteria 1559
52 Ga0070668_100636922 3300005347 Bacteria 936
53 Ga0070669_100000791 3300005353 Bacteria 22970
54 Ga0070669_100021456 3300005353 Bacteria 4614
55 Ga0070669_100068728 3300005353 Bacteria 2615
56 Ga0070675_100039946 3300005354 Bacteria 3830
57 Ga0070675_100065552 3300005354 Bacteria 3003
58 Ga0070675_100208547 3300005354 Bacteria 1698
59 Ga0070675_100510680 3300005354 Bacteria 1084
60 Ga0070671_100362309 3300005355 Bacteria 1238
61 Ga0070674_100467990 3300005356 Unclassified 1044
62 Ga0070673_100013235 3300005364 Bacteria 5697
63 Ga0070673_100084738 3300005364 Unclassified 2578
64 Ga0070673_100138549 3300005364 Bacteria 2051
65 Ga0070688_100051296 3300005365 Bacteria 2573
66 Ga0070659_100008931 3300005366 Bacteria 7345
67 Ga0070659_100014054 3300005366 Bacteria 5975
68 Ga0070659_100031272 3300005366 Bacteria 4122
69 Ga0070659_100034515 3300005366 Bacteria 3935
70 Ga0070659_100234597 3300005366 Bacteria 1517
71 Ga0070667_100131033 3300005367 Unclassified 2188
72 Ga0070667_100141583 3300005367 Bacteria 2107
73 Ga0070667_100165046 3300005367 Bacteria 1953
74 Ga0070667_100473046 3300005367 Bacteria 1147
75 Ga0070709_10004046 3300005434 Bacteria 7913
76 Ga0070709_10026438 3300005434 Bacteria 3440
77 Ga0070709_10065014 3300005434 Bacteria 2334
78 Ga0070709_10094866 3300005434 Bacteria 1975
79 Ga0070714_100006293 3300005435 Bacteria 9152
80 Ga0070714_100033073 3300005435 Bacteria 4321
81 Ga0070714_100096537 3300005435 Bacteria 2597
82 Ga0070714_100136411 3300005435 Bacteria 2198
83 Ga0070713_100000373 3300005436 Bacteria 28702
84 Ga0070713_100006241 3300005436 Bacteria 8249
85 Ga0070713_100018516 3300005436 Bacteria 5292
86 Ga0070713_100041402 3300005436 Bacteria 3753
87 Ga0070710_10078234 3300005437 Unclassified 1924
88 Ga0070710_10171525 3300005437 Bacteria 1352
89 Ga0070701_10061000 3300005438 Unclassified 1987
90 Ga0070711_100054294 3300005439 Bacteria 2764
91 Ga0070711_100227735 3300005439 Bacteria 1452
92 Ga0070708_100000005 3300005445 Bacteria 159112
93 Ga0070663_100005510 3300005455 Bacteria 7524
94 Ga0070662_100000191 3300005457 Bacteria 35697
95 Ga0070662_100028199 3300005457 Bacteria 3905
96 Ga0070662_100121737 3300005457 Bacteria 2001
97 Ga0070662_100302321 3300005457 Bacteria 1300
98 Ga0070662_100347884 3300005457 Bacteria 1214
99 Ga0070662_100463579 3300005457 Bacteria 1053
100 Ga0070681_10003121 3300005458 Bacteria 15393
101 Ga0070681_10012350 3300005458 Bacteria 8469
102 Ga0070681_10056959 3300005458 Bacteria 3889
103 Ga0070681_10085848 3300005458 Bacteria 3100
104 Ga0070681_10090232 3300005458 Bacteria 3015
105 Ga0068867_100016587 3300005459 Bacteria 5230
106 Ga0068867_100085936 3300005459 Bacteria 2379
107 Ga0070685_10033724 3300005466 Bacteria 2879
108 Ga0070707_100212975 3300005468 Bacteria 1883
109 Ga0070699_100831684 3300005518 Unclassified 845
110 Ga0070679_100002336 3300005530 Bacteria 17153
111 Ga0070679_100002582 3300005530 Bacteria 16455
112 Ga0070679_100006655 3300005530 Bacteria 10776
113 Ga0070679_100006783 3300005530 Bacteria 10678
114 Ga0070679_100059703 3300005530 Bacteria 3801
115 Ga0070679_100066388 3300005530 Bacteria 3596
116 Ga0070679_100073787 3300005530 Bacteria 3403
117 Ga0070679_100182924 3300005530 Bacteria 2068
118 Ga0070679_100204763 3300005530 Bacteria 1938
119 Ga0070679_100205840 3300005530 Unclassified 1932
120 Ga0070679_100282758 3300005530 Bacteria 1611
121 Ga0070679_100309494 3300005530 Bacteria 1530
122 Ga0070684_100001527 3300005535 Bacteria 16734
123 Ga0070684_100011318 3300005535 Bacteria 7102
124 Ga0070684_100015216 3300005535 Bacteria 6257
125 Ga0070684_100274467 3300005535 Bacteria 1544
126 Ga0070684_100294413 3300005535 Bacteria 1489
127 Ga0070684_100316709 3300005535 Bacteria 1433
128 Ga0070684_100548052 3300005535 Bacteria 1073
129 Ga0070684_100599124 3300005535 Unclassified 1024
130 Ga0068853_100004998 3300005539 Bacteria 10334
131 Ga0068853_100043109 3300005539 Bacteria 3861
132 Ga0068853_100485390 3300005539 Bacteria 1165
133 Ga0070672_100009049 3300005543 Bacteria 6847
134 Ga0070672_100100024 3300005543 Bacteria 2351
135 Ga0070672_100136060 3300005543 Bacteria 2024
136 Ga0070672_100208677 3300005543 Bacteria 1635
137 Ga0070686_100069824 3300005544 Bacteria 2296
138 Ga0070693_100002466 3300005547 Bacteria 8526
139 Ga0070693_100061684 3300005547 Bacteria 2180
140 Ga0070665_100128875 3300005548 Bacteria 2532
141 Ga0070704_100080637 3300005549 Bacteria 2394
142 Ga0068855_100004447 3300005563 Bacteria 17125
143 Ga0068855_100115183 3300005563 Bacteria 3082
144 Ga0068855_100191587 3300005563 Bacteria 2306
145 Ga0068855_100277218 3300005563 Bacteria 1863
146 Ga0068855_100449158 3300005563 Bacteria 1407
147 Ga0070664_100008340 3300005564 Bacteria 8378
148 Ga0070664_100023504 3300005564 Bacteria 5092
149 Ga0070664_100055591 3300005564 Bacteria 3361
150 Ga0070664_100097659 3300005564 Bacteria 2550
151 Ga0070664_100355843 3300005564 Unclassified 1333
152 Ga0068857_100000695 3300005577 Bacteria 25023
153 Ga0068857_100004240 3300005577 Bacteria 12086
154 Ga0068857_100017694 3300005577 Bacteria 6251
155 Ga0068857_100018656 3300005577 Bacteria 6089
156 Ga0068854_100023551 3300005578 Bacteria 4207
157 Ga0068856_100012205 3300005614 Bacteria 8323
158 Ga0068856_100148039 3300005614 Unclassified 2356
159 Ga0070702_100034837 3300005615 Bacteria 2778
160 Ga0068852_100002159 3300005616 Bacteria 13499
161 Ga0068852_100041183 3300005616 Bacteria 3902
162 Ga0068852_100102281 3300005616 Bacteria 2588
163 Ga0068852_100107101 3300005616 Bacteria 2535
164 Ga0068852_100194057 3300005616 Bacteria 1918
165 Ga0068852_100565159 3300005616 Unclassified 1139
166 Ga0068852_100671893 3300005616 Bacteria 1044
167 Ga0068859_100032671 3300005617 Bacteria 5227
168 Ga0068864_100197682 3300005618 Bacteria 1846
169 Ga0068864_100219702 3300005618 Bacteria 1753
170 Ga0068861_100000689 3300005719 Bacteria 20187
171 Ga0068851_10016867 3300005834 Bacteria 3499
172 Ga0068870_10006389 3300005840 Bacteria 5190
173 Ga0068863_100047608 3300005841 Bacteria 4067
174 Ga0068863_100109857 3300005841 Bacteria 2625
175 Ga0068858_100004137 3300005842 Bacteria 14276
176 Ga0068858_100160220 3300005842 Bacteria 2118
177 Ga0068860_100006277 3300005843 Bacteria 11936
178 Ga0068860_100018280 3300005843 Bacteria 6823
179 Ga0068862_100000624 3300005844 Bacteria 36787
180 Ga0068862_100000855 3300005844 Bacteria 29895
181 Ga0081539_10027916 3300005985 Bacteria 3562
182 Ga0070717_10012080 3300006028 Bacteria 6580
183 Ga0070717_10195086 3300006028 Bacteria 1771
184 Ga0070717_10426272 3300006028 Unclassified 1193
185 Ga0070716_100042273 3300006173 Unclassified 2543
186 Ga0070712_100001791 3300006175 Bacteria 13136
187 Ga0070712_100030590 3300006175 Bacteria 3620
188 Ga0068871_100440837 3300006358 Unclassified 1166
189 Ga0075428_100052659 3300006844 Bacteria 4460
190 Ga0075433_10003086 3300006852 Bacteria 12806
191 Ga0075434_100004771 3300006871 Bacteria 12275
192 Ga0075434_100058729 3300006871 Bacteria 3823
193 Ga0075434_100647262 3300006871 Unclassified 1075
194 Ga0075429_100075577 3300006880 Bacteria 2935
195 Ga0068865_100008102 3300006881 Bacteria 6484
196 Ga0068865_100012179 3300006881 Bacteria 5409
197 Ga0068865_100433440 3300006881 Bacteria 1083
198 Ga0097620_100032672 3300006931 Bacteria 5227
199 Ga0111539_10019729 3300009094 Bacteria 8315
200 Ga0111539_10050652 3300009094 Bacteria 4947
201 Ga0111539_10369484 3300009094 Bacteria 1669
202 Ga0105245_10157772 3300009098 Bacteria 2150
203 Ga0114129_10018415 3300009147 Bacteria 9947
204 Ga0105242_10003283 3300009176 Bacteria 12611
205 Ga0105242_10050236 3300009176 Bacteria 3395
206 Ga0105248_10085211 3300009177 Bacteria 3556
207 Ga0105248_10200532 3300009177 Bacteria 2248
208 Ga0105237_10041023 3300009545 Bacteria 4668
209 Ga0105238_10028899 3300009551 Bacteria 5648
210 Ga0105249_10000027 3300009553 Bacteria 231352
211 Ga0105249_10000311 3300009553 Bacteria 49293
212 Ga0105249_10000548 3300009553 Bacteria 34740
213 Ga0105239_10105606 3300010375 Bacteria 3119
214 Ga0157373_10041352 3300013100 Bacteria 3297
215 Ga0157370_10005755 3300013104 Bacteria 13857
216 Ga0157370_10329890 3300013104 Unclassified 1407
217 Ga0157370_10541376 3300013104 Bacteria 1068
218 Ga0157369_10004039 3300013105 Bacteria 17394
219 Ga0157369_10014196 3300013105 Bacteria 8998
220 Ga0157369_10035130 3300013105 Bacteria 5498
221 Ga0157369_10600753 3300013105 Bacteria 1136
222 Ga0157374_10552055 3300013296 Bacteria 1160
223 Ga0163162_10006727 3300013306 Bacteria 11151
224 Ga0163162_10504392 3300013306 Unclassified 1340
225 Ga0163162_10948154 3300013306 Bacteria 972
226 Ga0157372_10038766 3300013307 Bacteria 5258
227 Ga0157372_10155228 3300013307 Bacteria 2643
228 Ga0157372_10171880 3300013307 Bacteria 2507
229 Ga0157372_10174789 3300013307 Bacteria 2486
230 Ga0157372_10206995 3300013307 Bacteria 2273
231 Ga0157372_10235316 3300013307 Bacteria 2124
232 Ga0157372_10239505 3300013307 Unclassified 2105
233 Ga0157372_10264148 3300013307 Bacteria 1999
234 Ga0157372_10269345 3300013307 Bacteria 1979
235 Ga0157372_10587801 3300013307 Bacteria 1298
236 Ga0157372_10934204 3300013307 Bacteria 1006
237 Ga0157372_11162226 3300013307 Unclassified 892
238 Ga0157375_10010633 3300013308 Bacteria 8103
239 Ga0157375_10049761 3300013308 Bacteria 4108
240 Ga0157375_10058007 3300013308 Bacteria 3829
241 Ga0157375_10181447 3300013308 Bacteria 2256
242 Ga0157375_10299212 3300013308 Bacteria 1772
243 Ga0163163_10022638 3300014325 Bacteria 5954
244 Ga0163163_10175861 3300014325 Bacteria 2187
245 Ga0157380_10001579 3300014326 Bacteria 14994
246 Ga0157380_10012818 3300014326 Bacteria 6092
247 Ga0182008_10037041 3300014497 Bacteria 2441
248 Ga0157377_10030256 3300014745 Bacteria 2932
249 Ga0157379_10002076 3300014968 Bacteria 16641
250 Ga0163161_10150235 3300017792 Unclassified 1770
251 Ga0213876_10011720 3300021384 Bacteria 4678
252 Ga0213876_10079249 3300021384 Unclassified 1736
253 Ga0207656_10017696 3300025321 Bacteria 2795
254 Ga0207642_10084931 3300025899 Unclassified 1548
255 Ga0207680_10009197 3300025903 Bacteria 4886
256 Ga0207699_10004917 3300025906 Bacteria 6395
257 Ga0207699_10080622 3300025906 Bacteria 2017
258 Ga0207645_10000228 3300025907 Bacteria 46574
259 Ga0207645_10021266 3300025907 Bacteria 4233
260 Ga0207643_10001648 3300025908 Bacteria 12562
261 Ga0207705_10001690 3300025909 Bacteria 17554
262 Ga0207705_10024710 3300025909 Bacteria 4287
263 Ga0207705_10032721 3300025909 Bacteria 3716
264 Ga0207705_10043061 3300025909 Bacteria 3242
265 Ga0207705_10078392 3300025909 Unclassified 2404
266 Ga0207705_10233833 3300025909 Bacteria 1398
267 Ga0207707_10020189 3300025912 Bacteria 5816
268 Ga0207707_10071122 3300025912 Bacteria 3031
269 Ga0207707_10128136 3300025912 Unclassified 2219
270 Ga0207707_10160848 3300025912 Bacteria 1963
271 Ga0207707_10164553 3300025912 Unclassified 1939
272 Ga0207707_10321148 3300025912 Bacteria 1337
273 Ga0207695_10020566 3300025913 Bacteria 7556
274 Ga0207695_10399493 3300025913 Bacteria 1259
275 Ga0207693_10009986 3300025915 Bacteria 7717
276 Ga0207693_10018794 3300025915 Bacteria 5500
277 Ga0207693_10281137 3300025915 Bacteria 1304
278 Ga0207660_10000239 3300025917 Bacteria 35581
279 Ga0207662_10001225 3300025918 Bacteria 12290
280 Ga0207662_10012040 3300025918 Bacteria 4811
281 Ga0207662_10071929 3300025918 Bacteria 2095
282 Ga0207657_10002488 3300025919 Bacteria 19923
283 Ga0207657_10128170 3300025919 Bacteria 2082
284 Ga0207657_10300571 3300025919 Bacteria 1271
285 Ga0207649_10008118 3300025920 Bacteria 5712
286 Ga0207649_10016939 3300025920 Bacteria 4122
287 Ga0207649_10064783 3300025920 Bacteria 2312
288 Ga0207652_10003671 3300025921 Bacteria 12628
289 Ga0207652_10054233 3300025921 Bacteria 3446
290 Ga0207652_10061069 3300025921 Bacteria 3254
291 Ga0207652_10070319 3300025921 Bacteria 3039
292 Ga0207652_10072853 3300025921 Bacteria 2987
293 Ga0207652_10089938 3300025921 Bacteria 2697
294 Ga0207652_10109637 3300025921 Unclassified 2447
295 Ga0207652_10135159 3300025921 Bacteria 2202
296 Ga0207652_10143979 3300025921 Bacteria 2132
297 Ga0207652_10173711 3300025921 Bacteria 1934
298 Ga0207652_10210469 3300025921 Bacteria 1751
299 Ga0207652_10274508 3300025921 Bacteria 1520
300 Ga0207646_10184800 3300025922 Bacteria 1883
301 Ga0207681_10037257 3300025923 Bacteria 3213
302 Ga0207681_10312668 3300025923 Bacteria 1246
303 Ga0207681_10406549 3300025923 Bacteria 1100
304 Ga0207694_10002198 3300025924 Bacteria 16030
305 Ga0207650_10216031 3300025925 Bacteria 1541
306 Ga0207659_10007052 3300025926 Bacteria 6896
307 Ga0207659_10257110 3300025926 Bacteria 1419
308 Ga0207700_10000109 3300025928 Bacteria 49017
309 Ga0207700_10023254 3300025928 Bacteria 4269
310 Ga0207700_10029708 3300025928 Bacteria 3861
311 Ga0207700_10036740 3300025928 Bacteria 3541
312 Ga0207700_10072381 3300025928 Bacteria 2657
313 Ga0207664_10010328 3300025929 Bacteria 6594
314 Ga0207664_10092885 3300025929 Bacteria 2477
315 Ga0207664_10197133 3300025929 Unclassified 1736
316 Ga0207644_10006992 3300025931 Bacteria 7347
317 Ga0207644_10348518 3300025931 Unclassified 1202
318 Ga0207644_10360230 3300025931 Bacteria 1183
319 Ga0207644_10373306 3300025931 Bacteria 1162
320 Ga0207690_10002433 3300025932 Bacteria 11261
321 Ga0207690_10024908 3300025932 Bacteria 3751
322 Ga0207690_10043766 3300025932 Bacteria 2948
323 Ga0207690_10044426 3300025932 Bacteria 2928
324 Ga0207690_10320503 3300025932 Bacteria 1218
325 Ga0207706_10000163 3300025933 Bacteria 74486
326 Ga0207706_10086113 3300025933 Bacteria 2762
327 Ga0207706_10288363 3300025933 Bacteria 1431
328 Ga0207706_10332993 3300025933 Bacteria 1321
329 Ga0207706_10424729 3300025933 Bacteria 1151
330 Ga0207706_10619163 3300025933 Bacteria 929
331 Ga0207686_10006574 3300025934 Bacteria 6261
332 Ga0207670_10063677 3300025936 Bacteria 2524
333 Ga0207670_10569724 3300025936 Bacteria 927
334 Ga0207669_10081164 3300025937 Unclassified 2077
335 Ga0207704_10007389 3300025938 Bacteria 5187
336 Ga0207704_10117342 3300025938 Bacteria 1813
337 Ga0207704_10145204 3300025938 Bacteria 1665
338 Ga0207691_10004998 3300025940 Bacteria 12791
339 Ga0207691_10024153 3300025940 Bacteria 5716
340 Ga0207691_10032340 3300025940 Bacteria 4878
341 Ga0207691_10097978 3300025940 Bacteria 2620
342 Ga0207691_10132097 3300025940 Unclassified 2204
343 Ga0207711_10015302 3300025941 Bacteria 6368
344 Ga0207711_10066031 3300025941 Bacteria 3128
345 Ga0207689_10002731 3300025942 Bacteria 16321
346 Ga0207689_10306200 3300025942 Bacteria 1317
347 Ga0207661_10006040 3300025944 Bacteria 8555
348 Ga0207661_10125015 3300025944 Unclassified 2195
349 Ga0207661_10192334 3300025944 Bacteria 1789
350 Ga0207661_10320097 3300025944 Bacteria 1394
351 Ga0207679_10005079 3300025945 Bacteria 8229
352 Ga0207679_10010460 3300025945 Bacteria 5975
353 Ga0207679_10126579 3300025945 Bacteria 2042
354 Ga0207679_10219604 3300025945 Bacteria 1599
355 Ga0207679_10322814 3300025945 Bacteria 1337
356 Ga0207679_10402592 3300025945 Unclassified 1204
357 Ga0207679_10433988 3300025945 Bacteria 1162
358 Ga0207667_10068587 3300025949 Bacteria 3692
359 Ga0207667_10156028 3300025949 Bacteria 2348
360 Ga0207667_10204681 3300025949 Bacteria 2024
361 Ga0207712_10000100 3300025961 Bacteria 97244
362 Ga0207712_10003736 3300025961 Bacteria 9606
363 Ga0207712_10005730 3300025961 Bacteria 7832
364 Ga0207668_10004820 3300025972 Bacteria 7942
365 Ga0207668_10017406 3300025972 Bacteria 4503
366 Ga0207668_10022469 3300025972 Bacteria 4039
367 Ga0207640_10117609 3300025981 Bacteria 1897
368 Ga0207677_10028046 3300026023 Unclassified 3555
369 Ga0207677_10053596 3300026023 Bacteria 2747
370 Ga0207639_10018908 3300026041 Bacteria 4904
371 Ga0207639_10182969 3300026041 Bacteria 1784
372 Ga0207678_10017924 3300026067 Bacteria 6219
373 Ga0207678_10162975 3300026067 Bacteria 1904
374 Ga0207708_10041286 3300026075 Bacteria 3517
375 Ga0207702_10026256 3300026078 Bacteria 4834
376 Ga0207702_10212544 3300026078 Unclassified 1799
377 Ga0207702_10272019 3300026078 Bacteria 1598
378 Ga0207641_10233841 3300026088 Bacteria 1709
379 Ga0207641_10626899 3300026088 Unclassified 1055
380 Ga0207641_10698885 3300026088 Bacteria 998
381 Ga0207648_10400424 3300026089 Unclassified 1244
382 Ga0207676_10167387 3300026095 Bacteria 1911
383 Ga0207676_10431358 3300026095 Bacteria 1238
384 Ga0207674_10000542 3300026116 Bacteria 49512
385 Ga0207674_10001954 3300026116 Bacteria 26122
386 Ga0207674_10004803 3300026116 Bacteria 16180
387 Ga0207674_10015208 3300026116 Bacteria 8467
388 Ga0207675_100000031 3300026118 Bacteria 109006
389 Ga0207698_10004225 3300026142 Bacteria 8734
390 Ga0207698_10016289 3300026142 Bacteria 5006
391 Ga0207698_10085960 3300026142 Bacteria 2556
392 Ga0207698_10097947 3300026142 Bacteria 2422
393 Ga0207698_10280944 3300026142 Bacteria 1540
394 Ga0209970_1021503 3300027614 Bacteria 1093
395 Ga0209971_1006382 3300027682 Unclassified 2790
396 Ga0209966_1001799 3300027695 Bacteria 3626
397 Ga0209998_10000290 3300027717 Bacteria 15406
398 Ga0209974_10016143 3300027876 Bacteria 2479
399 Ga0268266_10101106 3300028379 Bacteria 2541
400 Ga0268266_10205393 3300028379 Unclassified 1805
401 Ga0268265_10002048 3300028380 Bacteria 15796
402 Ga0268265_10065718 3300028380 Bacteria 2800
403 Ga0268264_10071236 3300028381 Bacteria 2944
404 Ga0307413_10239169 3300031824 Bacteria 1339
405 Ga0307410_10090835 3300031852 Unclassified 2167
406 Ga0307406_10000403 3300031901 Bacteria 25059
407 Ga0307406_10010720 3300031901 Bacteria 5178
408 Ga0307406_10455767 3300031901 Unclassified 1027
409 Ga0307406_10494379 3300031901 Bacteria 990
410 Ga0307407_10002394 3300031903 Bacteria 7325
411 Ga0307407_10286537 3300031903 Bacteria 1143
412 Ga0307412_10172639 3300031911 Bacteria 1618
413 Ga0307409_100024689 3300031995 Bacteria 4197
414 Ga0307409_100604159 3300031995 Bacteria 1084
415 Ga0307416_100002313 3300032002 Bacteria 10884
416 Ga0307416_100003535 3300032002 Bacteria 9207
417 Ga0307416_100198290 3300032002 Bacteria 1902
418 Ga0307414_10020081 3300032004 Bacteria 4155
419 Ga0373926_0000758 3300035083 Bacteria 9029
420 Ga0373926_0005970 3300035083 Bacteria 4030
421 Ga0373934_0000286 3300035086 Bacteria 18178
422 Ga0373934_0011148 3300035086 Bacteria 3383
423 Ga0373944_0007894 3300035089 Unclassified 2865
424 Ga0373923_0015328 3300035111 Bacteria 2892
425 Ga0373936_0008707 3300035113 Unclassified 3821
426 Ga0373936_0174507 3300035113 Bacteria 941
427 Ga0373945_0043844 3300035116 Unclassified 1624
428 Ga0373956_0016689 3300035119 Bacteria 3085
429 Ga0373957_0017231 3300035120 Bacteria 2512
430 Ga0373957_0038374 3300035120 Bacteria 1793
431 Ga0373943_0001191 3300035170 Bacteria 11617
432 Ga0373943_0277259 3300035170 Bacteria 947
433 Ga0373946_0002010 3300035171 Bacteria 7123
434 Ga0373955_0000722 3300035172 Bacteria 14149
435 Ga0373955_0002487 3300035172 Bacteria 8051
436 Ga0373935_0007486 3300035692 Bacteria 6536
437 Ga0373935_0036615 3300035692 Bacteria 3069
438 Ga0373927_0003313 3300035695 Bacteria 11585
439 Ga0373927_0152268 3300035695 Unclassified 1514
440 Ga0373933_0000684 3300035724 Bacteria 20904
441 Ga0373933_0042489 3300035724 Bacteria 2687
442 Ga0373947_0001562 3300035725 Bacteria 14019
443 Ga0373947_0373855 3300035725 Unclassified 959
444 Ga0373937_0000681 3300036401 Bacteria 29570
445 Ga0373937_0006842 3300036401 Bacteria 9837
446 Ga0373937_0071314 3300036401 Bacteria 3204
447 Ga0373925_0001024 3300037068 Bacteria 25293
448 Ga0373925_0051090 3300037068 Bacteria 3085
449 Ga0373925_0473111 3300037068 Bacteria 1027
450 Ga0395899_0030876 3300037312 Bacteria 4028
451 Ga0395900_0065395 3300037418 Bacteria 3736
452 Ga0395905_0064600 3300037471 Bacteria 3425
453 Ga0395905_0143545 3300037471 Bacteria 2246
454 Ga0436364_0710458 3300037853 Bacteria 1612
455 Ga0395901_0003731 3300038443 Bacteria 15347
456 Ga0436365_0330386 3300039437 Bacteria 30524
457 Ga0436365_1726193 3300039437 Bacteria 4702
458 Ga0466958_0108710 3300045836 Bacteria 1730
459 Ga0466958_0280190 3300045836 Unclassified 1068
460 Ga0466967_0166904 3300045976 Bacteria 2069
461 Ga0466967_0189602 3300045976 Bacteria 1943
462 Ga0495592_0004112 3300046454 Bacteria 10586
463 Ga0495603_0001948 3300046455 Bacteria 12171
464 Ga0495629_0003484 3300046459 Bacteria 11898
465 Ga0495629_0033778 3300046459 Unclassified 3617
466 Ga0495629_0040775 3300046459 Bacteria 3266
467 Ga0495629_0051726 3300046459 Bacteria 2875
468 Ga0495629_0067416 3300046459 Bacteria 2497
469 Ga0495641_0028384 3300046461 Unclassified 2709
470 Ga0495653_0004057 3300046463 Bacteria 11830
471 Ga0495580_0004847 3300046472 Bacteria 11257
472 Ga0495580_0005572 3300046472 Bacteria 10377
473 Ga0495580_0026758 3300046472 Unclassified 4201
474 Ga0495580_0118772 3300046472 Bacteria 1836
475 Ga0495582_0001445 3300046473 Bacteria 13401
476 Ga0495582_0011239 3300046473 Bacteria 4932
477 Ga0495582_0085690 3300046473 Bacteria 1753
478 Ga0495639_0000193 3300046475 Bacteria 31937
479 Ga0495664_0021193 3300046477 Bacteria 3754
480 Ga0495664_0083640 3300046477 Bacteria 1915
481 Ga0495594_0003332 3300046499 Bacteria 8306
482 Ga0495594_0007708 3300046499 Bacteria 5536
483 Ga0495594_0043501 3300046499 Bacteria 2462
484 Ga0495594_0071252 3300046499 Unclassified 1933
485 Ga0495608_0001523 3300046511 Bacteria 16498
486 Ga0495628_0003263 3300046516 Bacteria 14526
487 Ga0495630_0003923 3300046517 Bacteria 10396
488 Ga0495630_0007326 3300046517 Bacteria 7879
489 Ga0495630_0010576 3300046517 Bacteria 6666
490 Ga0495666_0009812 3300046526 Bacteria 4785
491 Ga0495652_0013948 3300046529 Bacteria 7224
492 Ga0495652_0021990 3300046529 Bacteria 5666
493 Ga0495665_0000024 3300046531 Bacteria 59245
494 Ga0495665_0001552 3300046531 Bacteria 12259
495 Ga0495665_0035504 3300046531 Bacteria 2663
496 Ga0495665_0055652 3300046531 Bacteria 2089
497 Ga0495665_0185429 3300046531 Bacteria 1080
498 Ga0495640_0093541 3300046533 Bacteria 1981
499 Ga0495586_0014621 3300046535 Unclassified 4171
500 Ga0495587_0000282 3300046536 Bacteria 35998
501 Ga0495587_0000415 3300046536 Bacteria 30020
502 Ga0495645_0000080 3300046543 Bacteria 66039
503 Ga0495645_0001764 3300046543 Bacteria 14716
504 Ga0495645_0129208 3300046543 Unclassified 1772
505 Ga0495667_0011386 3300046559 Bacteria 6022
506 Ga0495667_0013276 3300046559 Bacteria 5576
507 Ga0495634_0083341 3300046642 Bacteria 2087
508 Ga0495635_0000274 3300046663 Bacteria 33218
509 Ga0495588_0001712 3300046674 Bacteria 9341
510 Ga0495588_0213937 3300046674 Unclassified 1018
511 Ga0495657_0026396 3300046675 Bacteria 4112
512 Ga0495599_0079431 3300046678 Archaea 2048
513 Ga0495623_0000459 3300046679 Bacteria 26742
514 Ga0495623_0053537 3300046679 Bacteria 2547
515 Ga0495646_0000543 3300046680 Bacteria 20320
516 Ga0495658_0000169 3300046683 Bacteria 37045
517 Ga0495658_0057108 3300046683 Bacteria 2228
518 Ga0495658_0239193 3300046683 Unclassified 1140
519 Ga0495613_0011499 3300046689 Bacteria 6584
520 Ga0495600_0000321 3300046809 Bacteria 25438
521 Ga0495581_0022458 3300047315 Bacteria 3656
522 Ga0495581_0024191 3300047315 Bacteria 3520
523 Ga0495581_0054628 3300047315 Bacteria 2305
524 Ga0495581_0059792 3300047315 Bacteria 2202
525 Ga0495604_0003729 3300047317 Bacteria 12131
526 Ga0495674_0008830 3300047319 Bacteria 9585
527 Ga0495674_0078459 3300047319 Bacteria 2837
528 Ga0495674_0194622 3300047319 Bacteria 1684
529 Ga0495675_0009222 3300047444 Bacteria 6138
530 Ga0495675_0014425 3300047444 Bacteria 4993
531 Ga0495685_085584 3300047447 Bacteria 1048
532 Ga0495684_0010797 3300047471 Bacteria 7060
533 Ga0495684_0023946 3300047471 Bacteria 4695
534 Ga0495593_0000715 3300047673 Bacteria 19217
535 Ga0495602_0032559 3300048088 Bacteria 4906
536 Ga0495614_0000001 3300048089 Bacteria 137656
537 Ga0496101_0084055 3300048904 Unclassified 2357
538 Ga0496105_0194858 3300048908 Bacteria 1656
539 Ga0496106_0514103 3300048909 Unclassified 962
540 Ga0496107_0069478 3300048910 Bacteria 2557
541 Ga0496108_0097137 3300048911 Bacteria 2510
542 Ga0496110_0253007 3300048913 Bacteria 1603
543 Ga0496111_0486102 3300048914 Bacteria 909
544 Ga0496112_0123649 3300048915 Bacteria 2558
545 Ga0496112_0371223 3300048915 Bacteria 1372
546 Ga0496113_0017213 3300048916 Bacteria 5013
547 Ga0501292_002236 3300049515 Bacteria 2478
548 Ga0501032_0028859 3300049569 Bacteria 3811
549 Ga0501034_0915444 3300049571 Bacteria 764
550 Ga0501038_0224023 3300049574 Bacteria 1499
551 Ga0501039_0350596 3300049575 Bacteria 1160
552 Ga0501070_0029268 3300049586 Bacteria 4620
553 Ga0501201_003384 3300049651 Unclassified 1463
554 Ga0501216_000664 3300049660 Bacteria 4217
555 Ga0501217_003787 3300049661 Bacteria 3074
556 Ga0501223_004879 3300049663 Bacteria 2843
557 Ga0501228_001968 3300049666 Unclassified 1561
558 Ga0501230_019021 3300049667 Bacteria 1180
559 Ga0501235_000192 3300049669 Bacteria 10731
560 Ga0501239_008406 3300049672 Bacteria 1102
561 Ga0501249_000568 3300049679 Bacteria 8787
562 Ga0501257_009200 3300049686 Bacteria 2228
563 Ga0501221_002223 3300049704 Unclassified 3224
564 Ga0501225_0000530 3300049705 Bacteria 11922
565 Ga0501245_001460 3300049708 Bacteria 3063
566 Ga0501266_000608 3300049763 Bacteria 4654
567 Ga0501268_000336 3300049765 Bacteria 4868
568 Ga0501271_000615 3300049768 Bacteria 3064
569 Ga0501035_0176774 3300049822 Bacteria 1841
570 Ga0501212_005838 3300049851 Unclassified 1641
571 nmdc:mga05p37_13061_c2 3300050507 Unclassified 4374
572 nmdc:mga05p37_1344053_c1 3300050507 Bacteria 724
573 nmdc:mga05p37_773619_c1 3300050507 Unclassified 1054
574 nmdc:mga05p37_781825_c1 3300050507 Unclassified 1047
575 nmdc:mga09592_18019_c1 3300050508 Bacteria 5788
576 nmdc:mga08y16_158700_c1 3300050511 Bacteria 2350
577 nmdc:mga08y16_46363_c1 3300050511 Unclassified 4550
578 nmdc:mga08y16_60393_c1 3300050511 Unclassified 3960
579 nmdc:mga0n895_3023_c1 3300050512 Bacteria 12325
580 nmdc:mga0n895_461337_c1 3300050512 Bacteria 1282
581 nmdc:mga0n895_9473_c1 3300050512 Bacteria 3861
582 nmdc:mga0a205_59640_c1 3300050515 Bacteria 3685
583 Ga0495601_0051568 3300053077 Bacteria 2597
584 Ga0495601_0084088 3300053077 Bacteria 2044
585 Ga0495595_0053534 3300053084 Bacteria 1875
586 Ga0495619_0001805 3300053085 Bacteria 14242
587 Ga0307410_10001590
588 Ga0065715_10415664
589 Ga0070658_10000609
590 Ga0070658_10003341
591 Ga0070658_10030115
592 Ga0070658_10043475
593 Ga0070658_10080107
594 Ga0070658_10099314
595 Ga0070658_10102492
596 Ga0070676_10000202
597 Ga0070676_10087010
598 Ga0070676_10101651
599 Ga0070676_10594567
600 Ga0070683_100001847
601 Ga0070683_100007527
602 Ga0070683_100010593
603 Ga0070683_100038714
604 Ga0070683_100042214
605 Ga0070683_100144771
606 Ga0070683_100417127
607 Ga0070690_100070012
608 Ga0070670_100032787
609 Ga0070670_100256362
610 Ga0070677_10100612
611 Ga0068869_100008846
612 Ga0070666_10039222
613 Ga0070680_100000021
614 Ga0070680_100000286
615 Ga0070680_100000588
616 Ga0070680_100042578
617 Ga0070680_100161037
618 Ga0070680_100233486
619 Ga0068868_100174520
620 Ga0070660_100004322
621 Ga0070660_100006754
622 Ga0070660_100017371
623 Ga0070660_100031668
624 Ga0070660_100161816
625 Ga0070660_100178877
626 Ga0070689_100001204
627 Ga0070689_100228834
628 Ga0070687_100009330
629 Ga0070661_100002666
630 Ga0070661_100014883
631 Ga0070692_10079817
632 Ga0070692_10219452
633 Ga0070668_100000342
634 Ga0070668_100003438
635 Ga0070668_100008597
636 Ga0070668_100027769
637 Ga0070668_100221837
638 Ga0070668_100636922
639 Ga0070669_100000791
640 Ga0070669_100021456
641 Ga0070669_100068728
642 Ga0070675_100039946
643 Ga0070675_100065552
644 Ga0070675_100208547
645 Ga0070675_100510680
646 Ga0070671_100362309
647 Ga0070674_100467990
648 Ga0070673_100013235
649 Ga0070673_100084738
650 Ga0070673_100138549
651 Ga0070688_100051296
652 Ga0070659_100008931
653 Ga0070659_100014054
654 Ga0070659_100031272
655 Ga0070659_100034515
656 Ga0070659_100234597
657 Ga0070667_100131033
658 Ga0070667_100141583
659 Ga0070667_100165046
660 Ga0070667_100473046
661 Ga0070709_10004046
662 Ga0070709_10026438
663 Ga0070709_10065014
664 Ga0070709_10094866
665 Ga0070714_100006293
666 Ga0070714_100033073
667 Ga0070714_100096537
668 Ga0070714_100136411
669 Ga0070713_100000373
670 Ga0070713_100006241
671 Ga0070713_100018516
672 Ga0070713_100041402
673 Ga0070710_10078234
674 Ga0070710_10171525
675 Ga0070701_10061000
676 Ga0070711_100054294
677 Ga0070711_100227735
678 Ga0070708_100000005
679 Ga0070663_100005510
680 Ga0070662_100000191
681 Ga0070662_100028199
682 Ga0070662_100121737
683 Ga0070662_100302321
684 Ga0070662_100347884
685 Ga0070662_100463579
686 Ga0070681_10003121
687 Ga0070681_10012350
688 Ga0070681_10056959
689 Ga0070681_10085848
690 Ga0070681_10090232
691 Ga0068867_100016587
692 Ga0068867_100085936
693 Ga0070685_10033724
694 Ga0070707_100212975
695 Ga0070699_100831684
696 Ga0070679_100002336
697 Ga0070679_100002582
698 Ga0070679_100006655
699 Ga0070679_100006783
700 Ga0070679_100059703
701 Ga0070679_100066388
702 Ga0070679_100073787
703 Ga0070679_100182924
704 Ga0070679_100204763
705 Ga0070679_100205840
706 Ga0070679_100282758
707 Ga0070679_100309494
708 Ga0070684_100001527
709 Ga0070684_100011318
710 Ga0070684_100015216
711 Ga0070684_100274467
712 Ga0070684_100294413
713 Ga0070684_100316709
714 Ga0070684_100548052
715 Ga0070684_100599124
716 Ga0068853_100004998
717 Ga0068853_100043109
718 Ga0068853_100485390
719 Ga0070672_100009049
720 Ga0070672_100100024
721 Ga0070672_100136060
722 Ga0070672_100208677
723 Ga0070686_100069824
724 Ga0070693_100002466
725 Ga0070693_100061684
726 Ga0070665_100128875
727 Ga0070704_100080637
728 Ga0068855_100004447
729 Ga0068855_100115183
730 Ga0068855_100191587
731 Ga0068855_100277218
732 Ga0068855_100449158
733 Ga0070664_100008340
734 Ga0070664_100023504
735 Ga0070664_100055591
736 Ga0070664_100097659
737 Ga0070664_100355843
738 Ga0068857_100000695
739 Ga0068857_100004240
740 Ga0068857_100017694
741 Ga0068857_100018656
742 Ga0068854_100023551
743 Ga0068856_100012205
744 Ga0068856_100148039
745 Ga0070702_100034837
746 Ga0068852_100002159
747 Ga0068852_100041183
748 Ga0068852_100102281
749 Ga0068852_100107101
750 Ga0068852_100194057
751 Ga0068852_100565159
752 Ga0068852_100671893
753 Ga0068859_100032671
754 Ga0068864_100197682
755 Ga0068864_100219702
756 Ga0068861_100000689
757 Ga0068851_10016867
758 Ga0068870_10006389
759 Ga0068863_100047608
760 Ga0068863_100109857
761 Ga0068858_100004137
762 Ga0068858_100160220
763 Ga0068860_100006277
764 Ga0068860_100018280
765 Ga0068862_100000624
766 Ga0068862_100000855
767 Ga0081539_10027916
768 Ga0070717_10012080
769 Ga0070717_10195086
770 Ga0070717_10426272
771 Ga0070716_100042273
772 Ga0070712_100001791
773 Ga0070712_100030590
774 Ga0068871_100440837
775 Ga0075428_100052659
776 Ga0075433_10003086
777 Ga0075434_100004771
778 Ga0075434_100058729
779 Ga0075434_100647262
780 Ga0075429_100075577
781 Ga0068865_100008102
782 Ga0068865_100012179
783 Ga0068865_100433440
784 Ga0097620_100032672
785 Ga0111539_10019729
786 Ga0111539_10050652
787 Ga0111539_10369484
788 Ga0105245_10157772
789 Ga0114129_10018415
790 Ga0105242_10003283
791 Ga0105242_10050236
792 Ga0105248_10085211
793 Ga0105248_10200532
794 Ga0105237_10041023
795 Ga0105238_10028899
796 Ga0105249_10000027
797 Ga0105249_10000311
798 Ga0105249_10000548
799 Ga0105239_10105606
800 Ga0157373_10041352
801 Ga0157370_10005755
802 Ga0157370_10329890
803 Ga0157370_10541376
804 Ga0157369_10004039
805 Ga0157369_10014196
806 Ga0157369_10035130
807 Ga0157369_10600753
808 Ga0157374_10552055
809 Ga0163162_10006727
810 Ga0163162_10504392
811 Ga0163162_10948154
812 Ga0157372_10038766
813 Ga0157372_10155228
814 Ga0157372_10171880
815 Ga0157372_10174789
816 Ga0157372_10206995
817 Ga0157372_10235316
818 Ga0157372_10239505
819 Ga0157372_10264148
820 Ga0157372_10269345
821 Ga0157372_10587801
822 Ga0157372_10934204
823 Ga0157372_11162226
824 Ga0157375_10010633
825 Ga0157375_10049761
826 Ga0157375_10058007
827 Ga0157375_10181447
828 Ga0157375_10299212
829 Ga0163163_10022638
830 Ga0163163_10175861
831 Ga0157380_10001579
832 Ga0157380_10012818
833 Ga0182008_10037041
834 Ga0157377_10030256
835 Ga0157379_10002076
836 Ga0163161_10150235
837 Ga0213876_10011720
838 Ga0213876_10079249
839 Ga0207656_10017696
840 Ga0207642_10084931
841 Ga0207680_10009197
842 Ga0207699_10004917
843 Ga0207699_10080622
844 Ga0207645_10000228
845 Ga0207645_10021266
846 Ga0207643_10001648
847 Ga0207705_10001690
848 Ga0207705_10024710
849 Ga0207705_10032721
850 Ga0207705_10043061
851 Ga0207705_10078392
852 Ga0207705_10233833
853 Ga0207707_10020189
854 Ga0207707_10071122
855 Ga0207707_10128136
856 Ga0207707_10160848
857 Ga0207707_10164553
858 Ga0207707_10321148
859 Ga0207695_10020566
860 Ga0207695_10399493
861 Ga0207693_10009986
862 Ga0207693_10018794
863 Ga0207693_10281137
864 Ga0207660_10000239
865 Ga0207662_10001225
866 Ga0207662_10012040
867 Ga0207662_10071929
868 Ga0207657_10002488
869 Ga0207657_10128170
870 Ga0207657_10300571
871 Ga0207649_10008118
872 Ga0207649_10016939
873 Ga0207649_10064783
874 Ga0207652_10003671
875 Ga0207652_10054233
876 Ga0207652_10061069
877 Ga0207652_10070319
878 Ga0207652_10072853
879 Ga0207652_10089938
880 Ga0207652_10109637
881 Ga0207652_10135159
882 Ga0207652_10143979
883 Ga0207652_10173711
884 Ga0207652_10210469
885 Ga0207652_10274508
886 Ga0207646_10184800
887 Ga0207681_10037257
888 Ga0207681_10312668
889 Ga0207681_10406549
890 Ga0207694_10002198
891 Ga0207650_10216031
892 Ga0207659_10007052
893 Ga0207659_10257110
894 Ga0207700_10000109
895 Ga0207700_10023254
896 Ga0207700_10029708
897 Ga0207700_10036740
898 Ga0207700_10072381
899 Ga0207664_10010328
900 Ga0207664_10092885
901 Ga0207664_10197133
902 Ga0207644_10006992
903 Ga0207644_10348518
904 Ga0207644_10360230
905 Ga0207644_10373306
906 Ga0207690_10002433
907 Ga0207690_10024908
908 Ga0207690_10043766
909 Ga0207690_10044426
910 Ga0207690_10320503
911 Ga0207706_10000163
912 Ga0207706_10086113
913 Ga0207706_10288363
914 Ga0207706_10332993
915 Ga0207706_10424729
916 Ga0207706_10619163
917 Ga0207686_10006574
918 Ga0207670_10063677
919 Ga0207670_10569724
920 Ga0207669_10081164
921 Ga0207704_10007389
922 Ga0207704_10117342
923 Ga0207704_10145204
924 Ga0207691_10004998
925 Ga0207691_10024153
926 Ga0207691_10032340
927 Ga0207691_10097978
928 Ga0207691_10132097
929 Ga0207711_10015302
930 Ga0207711_10066031
931 Ga0207689_10002731
932 Ga0207689_10306200
933 Ga0207661_10006040
934 Ga0207661_10125015
935 Ga0207661_10192334
936 Ga0207661_10320097
937 Ga0207679_10005079
938 Ga0207679_10010460
939 Ga0207679_10126579
940 Ga0207679_10219604
941 Ga0207679_10322814
942 Ga0207679_10402592
943 Ga0207679_10433988
944 Ga0207667_10068587
945 Ga0207667_10156028
946 Ga0207667_10204681
947 Ga0207712_10000100
948 Ga0207712_10003736
949 Ga0207712_10005730
950 Ga0207668_10004820
951 Ga0207668_10017406
952 Ga0207668_10022469
953 Ga0207640_10117609
954 Ga0207677_10028046
955 Ga0207677_10053596
956 Ga0207639_10018908
957 Ga0207639_10182969
958 Ga0207678_10017924
959 Ga0207678_10162975
960 Ga0207708_10041286
961 Ga0207702_10026256
962 Ga0207702_10212544
963 Ga0207702_10272019
964 Ga0207641_10233841
965 Ga0207641_10626899
966 Ga0207641_10698885
967 Ga0207648_10400424
968 Ga0207676_10167387
969 Ga0207676_10431358
970 Ga0207674_10000542
971 Ga0207674_10001954
972 Ga0207674_10004803
973 Ga0207674_10015208
974 Ga0207675_100000031
975 Ga0207698_10004225
976 Ga0207698_10016289
977 Ga0207698_10085960
978 Ga0207698_10097947
979 Ga0207698_10280944
980 Ga0209970_1021503
981 Ga0209971_1006382
982 Ga0209966_1001799
983 Ga0209998_10000290
984 Ga0209974_10016143
985 Ga0268266_10101106
986 Ga0268266_10205393
987 Ga0268265_10002048
988 Ga0268265_10065718
989 Ga0268264_10071236
990 Ga0307413_10239169
991 Ga0307410_10090835
992 Ga0307406_10000403
993 Ga0307406_10010720
994 Ga0307406_10455767
995 Ga0307406_10494379
996 Ga0307407_10002394
997 Ga0307407_10286537
998 Ga0307412_10172639
999 Ga0307409_100024689
1000 Ga0307409_100604159
1001 Ga0307416_100002313
1002 Ga0307416_100003535
1003 Ga0307416_100198290
1004 Ga0307414_10020081
1005 Ga0373926_0000758
1006 Ga0373926_0005970
1007 Ga0373934_0000286
1008 Ga0373934_0011148
1009 Ga0373944_0007894
1010 Ga0373923_0015328
1011 Ga0373936_0008707
1012 Ga0373936_0174507
1013 Ga0373945_0043844
1014 Ga0373956_0016689
1015 Ga0373957_0017231
1016 Ga0373957_0038374
1017 Ga0373943_0001191
1018 Ga0373943_0277259
1019 Ga0373946_0002010
1020 Ga0373955_0000722
1021 Ga0373955_0002487
1022 Ga0373935_0007486
1023 Ga0373935_0036615
1024 Ga0373927_0003313
1025 Ga0373927_0152268
1026 Ga0373933_0000684
1027 Ga0373933_0042489
1028 Ga0373947_0001562
1029 Ga0373947_0373855
1030 Ga0373937_0000681
1031 Ga0373937_0006842
1032 Ga0373937_0071314
1033 Ga0373925_0001024
1034 Ga0373925_0051090
1035 Ga0373925_0473111
1036 Ga0395899_0030876
1037 Ga0395900_0065395
1038 Ga0395905_0064600
1039 Ga0395905_0143545
1040 Ga0436364_0710458
1041 Ga0395901_0003731
1042 Ga0436365_0330386
1043 Ga0436365_1726193
1044 Ga0466958_0108710
1045 Ga0466958_0280190
1046 Ga0466967_0166904
1047 Ga0466967_0189602
1048 Ga0495592_0004112
1049 Ga0495603_0001948
1050 Ga0495629_0003484
1051 Ga0495629_0033778
1052 Ga0495629_0040775
1053 Ga0495629_0051726
1054 Ga0495629_0067416
1055 Ga0495641_0028384
1056 Ga0495653_0004057
1057 Ga0495580_0004847
1058 Ga0495580_0005572
1059 Ga0495580_0026758
1060 Ga0495580_0118772
1061 Ga0495582_0001445
1062 Ga0495582_0011239
1063 Ga0495582_0085690
1064 Ga0495639_0000193
1065 Ga0495664_0021193
1066 Ga0495664_0083640
1067 Ga0495594_0003332
1068 Ga0495594_0007708
1069 Ga0495594_0043501
1070 Ga0495594_0071252
1071 Ga0495608_0001523
1072 Ga0495628_0003263
1073 Ga0495630_0003923
1074 Ga0495630_0007326
1075 Ga0495630_0010576
1076 Ga0495666_0009812
1077 Ga0495652_0013948
1078 Ga0495652_0021990
1079 Ga0495665_0000024
1080 Ga0495665_0001552
1081 Ga0495665_0035504
1082 Ga0495665_0055652
1083 Ga0495665_0185429
1084 Ga0495640_0093541
1085 Ga0495586_0014621
1086 Ga0495587_0000282
1087 Ga0495587_0000415
1088 Ga0495645_0000080
1089 Ga0495645_0001764
1090 Ga0495645_0129208
1091 Ga0495667_0011386
1092 Ga0495667_0013276
1093 Ga0495634_0083341
1094 Ga0495635_0000274
1095 Ga0495588_0001712
1096 Ga0495588_0213937
1097 Ga0495657_0026396
1098 Ga0495599_0079431
1099 Ga0495623_0000459
1100 Ga0495623_0053537
1101 Ga0495646_0000543
1102 Ga0495658_0000169
1103 Ga0495658_0057108
1104 Ga0495658_0239193
1105 Ga0495613_0011499
1106 Ga0495600_0000321
1107 Ga0495581_0022458
1108 Ga0495581_0024191
1109 Ga0495581_0054628
1110 Ga0495581_0059792
1111 Ga0495604_0003729
1112 Ga0495674_0008830
1113 Ga0495674_0078459
1114 Ga0495674_0194622
1115 Ga0495675_0009222
1116 Ga0495675_0014425
1117 Ga0495685_085584
1118 Ga0495684_0010797
1119 Ga0495684_0023946
1120 Ga0495593_0000715
1121 Ga0495602_0032559
1122 Ga0495614_0000001
1123 Ga0496101_0084055
1124 Ga0496105_0194858
1125 Ga0496106_0514103
1126 Ga0496107_0069478
1127 Ga0496108_0097137
1128 Ga0496110_0253007
1129 Ga0496111_0486102
1130 Ga0496112_0123649
1131 Ga0496112_0371223
1132 Ga0496113_0017213
1133 Ga0501292_002236
1134 Ga0501032_0028859
1135 Ga0501034_0915444
1136 Ga0501038_0224023
1137 Ga0501039_0350596
1138 Ga0501070_0029268
1139 Ga0501201_003384
1140 Ga0501216_000664
1141 Ga0501217_003787
1142 Ga0501223_004879
1143 Ga0501228_001968
1144 Ga0501230_019021
1145 Ga0501235_000192
1146 Ga0501239_008406
1147 Ga0501249_000568
1148 Ga0501257_009200
1149 Ga0501221_002223
1150 Ga0501225_0000530
1151 Ga0501245_001460
1152 Ga0501266_000608
1153 Ga0501268_000336
1154 Ga0501271_000615
1155 Ga0501035_0176774
1156 Ga0501212_005838
1157 nmdc:mga05p37_13061_c2
1158 nmdc:mga05p37_1344053_c1
1159 nmdc:mga05p37_773619_c1
1160 nmdc:mga05p37_781825_c1
1161 nmdc:mga09592_18019_c1
1162 nmdc:mga08y16_158700_c1
1163 nmdc:mga08y16_46363_c1
1164 nmdc:mga08y16_60393_c1
1165 nmdc:mga0n895_3023_c1
1166 nmdc:mga0n895_461337_c1
1167 nmdc:mga0n895_9473_c1
1168 nmdc:mga0a205_59640_c1
1169 Ga0495601_0051568
1170 Ga0495601_0084088
1171 Ga0495595_0053534
1172 Ga0495619_0001805

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00877

NLPC_P60

NlpC/P60 family

187

287

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7v6t-assembly2.cif.gz_B crystal structure of bacterial peptidase 0.8662 119 249
7cfl-assembly4.cif.gz_D x-ray structure of autolysin acd24020 catalytic domain from clostridium difficile 0.8611 119 248
7v6s-assembly2.cif.gz_B crystal structure of bacterial peptidase 0.8588 120 249
7cfl-assembly4.cif.gz_D x-ray structure of autolysin acd24020 catalytic domain from clostridium difficile 0.8547 119 248
7cfl-assembly1.cif.gz_A x-ray structure of autolysin acd24020 catalytic domain from clostridium difficile 0.8538 119 248
ID Description Score Start End Superfamily
af_P0ADT8_18_85_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.9245 5 55 2.30.30.40
af_Q2FXU3_37_103_2.30.30.40 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.9145 1 56 2.30.30.40
4krtB03 Mainly Beta;Roll;SH3 type barrels.;SH3 Domains 0.905 1 58 2.30.30.40
3h41A03 Alpha Beta;Alpha-Beta Complex;endopeptidase fold (from Nostoc punctiforme);endopeptidase domain like (from Nostoc punctiforme) 0.8978 118 249 3.90.1720.10
af_K7LJT2_10_49_2.30.30.140 Mainly Beta;Roll;SH3 type barrels.; 0.8938 28 51 2.30.30.140
ID Description Score Start End GO Terms
AF-A0A846P4K7-F1-model_v4 SH3 domain-containing protein 1.001 1 57 GO:0016020
GO:0055085
AF-A0A1V5XJF4-F1-model_v4 Bacterial SH3 domain protein 0.9962 1 54
AF-A0A2H6GNC3-F1-model_v4 Bacterial SH3 domain protein 0.9844 1 56
AF-A0A2S5SU47-F1-model_v4 Peptide-binding protein 0.9814 1 54
AF-A0A1F5AUW3-F1-model_v4 SH3b domain-containing protein 0.9808 1 59 GO:0030288

Map