F466554

General Info

Members Datasets Scaffolds Average Seq Length
586 319 1172 188

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10183594|Ga0157370_101835942
Length 202
Sequence MIWRDVVRYEVQDQTKPEPSELLAGHCQPFGTAEVIVGPEVWRRRAWRIYLWPGIAFGLGVLMWPVMTFFTNSAIHMVAHGAWAQALMVMGGAELGLAKGKLTSRWWKLATPVGLAVSGGAFLVHEQNGWFFARSAFLHHLVGWTLIGASLFTLALVFRPRSVFFKSAFALTVVALSVMLFSDRDLAPVFGHLSPLAGPPHR

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
92 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
93 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
94 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
98 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
114 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
175 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
178 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
184 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
188 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
189 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
190 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
191 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
192 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
193 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
194 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
195 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
196 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
197 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
198 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
212 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
213 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
214 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
215 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
216 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
219 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
220 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
224 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
225 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
226 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
227 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
228 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
229 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
230 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
231 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
232 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
233 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
234 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
235 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
236 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
237 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
238 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
241 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
242 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
243 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
244 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
245 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
246 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
252 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
261 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
262 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
282 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
283 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
286 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
287 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
292 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
294 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
295 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
296 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
297 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
298 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
299 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
300 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
301 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
302 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
303 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
304 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
305 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
306 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
307 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
311 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
315 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
316 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
317 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
318 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.63
Metatranscriptomes 1.37
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.97
Rhizosphere 93.69
Stem 0
Stem Tuber 0
Unclassified 20.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10183594 3300013104 Unclassified 1943
2 JGI24743J22301_10006366 3300001991 Unclassified 2010
3 JGI24738J21930_10008666 3300002075 Bacteria 2310
4 JGI24034J26672_10006743 3300002239 Bacteria 1661
5 Ga0070658_10086852 3300005327 Bacteria 2573
6 Ga0070676_10236332 3300005328 Bacteria 1213
7 Ga0070676_10656980 3300005328 Unclassified 762
8 Ga0070683_100017294 3300005329 Bacteria 6371
9 Ga0070683_100033968 3300005329 Bacteria 4655
10 Ga0070683_100101185 3300005329 Bacteria 2714
11 Ga0070683_100140535 3300005329 Unclassified 2288
12 Ga0070683_100223047 3300005329 Bacteria 1791
13 Ga0070683_100409981 3300005329 Unclassified 1292
14 Ga0070683_100684500 3300005329 Bacteria 982
15 Ga0070683_100787223 3300005329 Unclassified 911
16 Ga0070683_100951077 3300005329 Unclassified 824
17 Ga0070690_100027328 3300005330 Bacteria 3526
18 Ga0070677_10194631 3300005333 Bacteria 974
19 Ga0068869_100147771 3300005334 Bacteria 1820
20 Ga0068869_100455031 3300005334 Unclassified 1061
21 Ga0070680_100006018 3300005336 Bacteria 9200
22 Ga0070680_100167776 3300005336 Bacteria 1846
23 Ga0070680_100242601 3300005336 Bacteria 1523
24 Ga0070682_100040940 3300005337 Bacteria 2853
25 Ga0070682_100153540 3300005337 Bacteria 1583
26 Ga0070682_100233094 3300005337 Bacteria 1317
27 Ga0070682_100273331 3300005337 Unclassified 1228
28 Ga0070682_100371227 3300005337 Unclassified 1073
29 Ga0068868_100014725 3300005338 Bacteria 5769
30 Ga0068868_100180921 3300005338 Bacteria 1749
31 Ga0070660_100007836 3300005339 Bacteria 7448
32 Ga0070660_100186529 3300005339 Unclassified 1679
33 Ga0070689_100086004 3300005340 Bacteria 2473
34 Ga0070689_100294494 3300005340 Bacteria 1349
35 Ga0070691_10156928 3300005341 Bacteria 1170
36 Ga0070687_100450905 3300005343 Unclassified 856
37 Ga0070661_100012383 3300005344 Bacteria 5967
38 Ga0070661_100145391 3300005344 Bacteria 1789
39 Ga0070661_100264067 3300005344 Unclassified 1331
40 Ga0070661_100276067 3300005344 Unclassified 1303
41 Ga0070661_100459987 3300005344 Unclassified 1013
42 Ga0070692_10115949 3300005345 Unclassified 1487
43 Ga0070692_10491431 3300005345 Unclassified 793
44 Ga0070668_100273169 3300005347 Bacteria 1409
45 Ga0070669_100044095 3300005353 Bacteria 3250
46 Ga0070669_100116624 3300005353 Bacteria 2032
47 Ga0070675_100366329 3300005354 Unclassified 1280
48 Ga0070674_100052252 3300005356 Bacteria 2818
49 Ga0070674_100056166 3300005356 Bacteria 2729
50 Ga0070674_100150192 3300005356 Bacteria 1757
51 Ga0070673_100503711 3300005364 Unclassified 1095
52 Ga0070688_100540997 3300005365 Unclassified 884
53 Ga0070659_100017013 3300005366 Bacteria 5466
54 Ga0070659_100019969 3300005366 Bacteria 5086
55 Ga0070659_100047580 3300005366 Unclassified 3365
56 Ga0070667_100122914 3300005367 Bacteria 2260
57 Ga0070703_10022413 3300005406 Bacteria 1854
58 Ga0070714_100057964 3300005435 Bacteria 3316
59 Ga0070714_100387397 3300005435 Unclassified 1319
60 Ga0070713_100261567 3300005436 Unclassified 1581
61 Ga0070710_10539755 3300005437 Bacteria 804
62 Ga0070701_10006807 3300005438 Bacteria 4834
63 Ga0070701_10261436 3300005438 Bacteria 1049
64 Ga0070711_100329010 3300005439 Bacteria 1223
65 Ga0070705_100022464 3300005440 Bacteria 3371
66 Ga0070700_100087587 3300005441 Bacteria 2024
67 Ga0070700_100119740 3300005441 Bacteria 1762
68 Ga0070694_100031225 3300005444 Bacteria 3491
69 Ga0070708_100637985 3300005445 Unclassified 1004
70 Ga0070678_100683209 3300005456 Unclassified 923
71 Ga0070681_10012199 3300005458 Bacteria 8521
72 Ga0070681_10017876 3300005458 Bacteria 7086
73 Ga0070681_10133581 3300005458 Bacteria 2413
74 Ga0070681_10144597 3300005458 Bacteria 2307
75 Ga0070681_10222553 3300005458 Bacteria 1802
76 Ga0068867_100046704 3300005459 Bacteria 3181
77 Ga0070685_10006906 3300005466 Bacteria 5794
78 Ga0070685_10044958 3300005466 Bacteria 2530
79 Ga0070685_10799861 3300005466 Bacteria 695
80 Ga0070699_100221316 3300005518 Unclassified 1687
81 Ga0070699_100672869 3300005518 Bacteria 945
82 Ga0070679_100034843 3300005530 Bacteria 4992
83 Ga0070679_100035654 3300005530 Bacteria 4936
84 Ga0070679_100225579 3300005530 Bacteria 1834
85 Ga0070679_100295305 3300005530 Bacteria 1571
86 Ga0070679_100349878 3300005530 Unclassified 1425
87 Ga0070684_100017841 3300005535 Bacteria 5833
88 Ga0070684_100107167 3300005535 Bacteria 2502
89 Ga0070684_100254657 3300005535 Unclassified 1605
90 Ga0070697_100702618 3300005536 Bacteria 892
91 Ga0068853_100073211 3300005539 Bacteria 2986
92 Ga0068853_100328656 3300005539 Bacteria 1418
93 Ga0070672_100006240 3300005543 Bacteria 7987
94 Ga0070672_100070177 3300005543 Bacteria 2784
95 Ga0070686_100046725 3300005544 Bacteria 2733
96 Ga0070695_100047563 3300005545 Bacteria 2740
97 Ga0070696_100372406 3300005546 Bacteria 1111
98 Ga0070693_100109711 3300005547 Bacteria 1695
99 Ga0070665_100087746 3300005548 Bacteria 3116
100 Ga0068855_100015142 3300005563 Bacteria 9286
101 Ga0068855_100073760 3300005563 Bacteria 3964
102 Ga0068855_100093947 3300005563 Bacteria 3458
103 Ga0068855_100459488 3300005563 Bacteria 1388
104 Ga0070664_100507133 3300005564 Unclassified 1112
105 Ga0068857_100045176 3300005577 Bacteria 3907
106 Ga0068857_100689655 3300005577 Bacteria 970
107 Ga0068854_100871294 3300005578 Bacteria 790
108 Ga0068856_100329422 3300005614 Bacteria 1544
109 Ga0068856_100337368 3300005614 Unclassified 1525
110 Ga0070702_100024667 3300005615 Bacteria 3211
111 Ga0070702_100573433 3300005615 Unclassified 841
112 Ga0068852_100241861 3300005616 Unclassified 1725
113 Ga0068852_100551886 3300005616 Bacteria 1153
114 Ga0068859_100022305 3300005617 Bacteria 6348
115 Ga0068864_100541115 3300005618 Bacteria 1125
116 Ga0068864_100787980 3300005618 Unclassified 933
117 Ga0068861_100562971 3300005719 Unclassified 1040
118 Ga0068851_10463484 3300005834 Unclassified 755
119 Ga0068870_10094221 3300005840 Bacteria 1680
120 Ga0068870_10109595 3300005840 Bacteria 1574
121 Ga0068863_100110963 3300005841 Bacteria 2612
122 Ga0068858_100051606 3300005842 Bacteria 3805
123 Ga0068858_100145587 3300005842 Bacteria 2225
124 Ga0068860_100295029 3300005843 Bacteria 1587
125 Ga0081539_10010175 3300005985 Bacteria 7706
126 Ga0070717_10015531 3300006028 Bacteria 5886
127 Ga0075432_10052388 3300006058 Bacteria 1441
128 Ga0070716_100118697 3300006173 Bacteria 1652
129 Ga0070712_100147417 3300006175 Bacteria 1803
130 Ga0097621_100243842 3300006237 Bacteria 1572
131 Ga0097621_100456715 3300006237 Unclassified 1151
132 Ga0075431_100397865 3300006847 Bacteria 1379
133 Ga0075429_100350173 3300006880 Bacteria 1293
134 Ga0068865_100057631 3300006881 Bacteria 2711
135 Ga0097620_100022304 3300006931 Bacteria 6348
136 Ga0075435_100059620 3300007076 Bacteria 3094
137 Ga0105244_10074150 3300009036 Bacteria 1693
138 Ga0105240_10095108 3300009093 Bacteria 3633
139 Ga0105240_10100913 3300009093 Bacteria 3511
140 Ga0105240_10306976 3300009093 Unclassified 1813
141 Ga0111539_10075329 3300009094 Bacteria 3976
142 Ga0111539_11787869 3300009094 Unclassified 713
143 Ga0105245_11588251 3300009098 Bacteria 706
144 Ga0114129_10063896 3300009147 Bacteria 5137
145 Ga0114129_10193533 3300009147 Bacteria 2759
146 Ga0105243_10020255 3300009148 Bacteria 5045
147 Ga0105243_10065081 3300009148 Bacteria 2927
148 Ga0105243_10088979 3300009148 Bacteria 2537
149 Ga0105241_10189481 3300009174 Bacteria 1711
150 Ga0105248_10119533 3300009177 Bacteria 2972
151 Ga0105248_11166390 3300009177 Bacteria 871
152 Ga0105237_10037958 3300009545 Bacteria 4866
153 Ga0105238_10019816 3300009551 Bacteria 6847
154 Ga0105238_10545873 3300009551 Unclassified 1163
155 Ga0105238_10569725 3300009551 Bacteria 1138
156 Ga0105249_10163867 3300009553 Bacteria 2151
157 Ga0105239_10050533 3300010375 Bacteria 4559
158 Ga0105239_10229729 3300010375 Bacteria 2082
159 Ga0105239_10459752 3300010375 Bacteria 1445
160 Ga0105239_10873871 3300010375 Bacteria 1031
161 Ga0105246_10123463 3300011119 Bacteria 1922
162 Ga0105246_10521901 3300011119 Unclassified 1012
163 Ga0157343_1002783 3300012488 Unclassified 979
164 Ga0157329_1006553 3300012491 Unclassified 823
165 Ga0157339_1013517 3300012505 Unclassified 782
166 Ga0157373_10041045 3300013100 Unclassified 3310
167 Ga0157370_10041884 3300013104 Bacteria 4415
168 Ga0157370_10077402 3300013104 Bacteria 3133
169 Ga0157370_10559641 3300013104 Bacteria 1048
170 Ga0157369_10020182 3300013105 Bacteria 7452
171 Ga0157369_10161819 3300013105 Bacteria 2363
172 Ga0157369_10503262 3300013105 Unclassified 1253
173 Ga0157374_10072884 3300013296 Bacteria 3241
174 Ga0157374_10134475 3300013296 Bacteria 2396
175 Ga0157378_10597225 3300013297 Bacteria 1115
176 Ga0163162_10143980 3300013306 Bacteria 2498
177 Ga0163162_10706881 3300013306 Unclassified 1129
178 Ga0163162_11911320 3300013306 Unclassified 679
179 Ga0157372_10022555 3300013307 Bacteria 6813
180 Ga0157372_10045835 3300013307 Bacteria 4852
181 Ga0157372_10192246 3300013307 Bacteria 2364
182 Ga0157372_10292448 3300013307 Bacteria 1894
183 Ga0157372_10839771 3300013307 Unclassified 1066
184 Ga0157375_10030776 3300013308 Bacteria 5066
185 Ga0157375_10214357 3300013308 Bacteria 2083
186 Ga0163163_10294222 3300014325 Bacteria 1676
187 Ga0163163_10379848 3300014325 Bacteria 1470
188 Ga0157380_10003878 3300014326 Bacteria 10314
189 Ga0157380_10150143 3300014326 Bacteria 2013
190 Ga0182008_10247254 3300014497 Bacteria 919
191 Ga0182008_10555281 3300014497 Bacteria 639
192 Ga0157377_10838474 3300014745 Bacteria 681
193 Ga0157379_10027580 3300014968 Bacteria 5056
194 Ga0157376_10083449 3300014969 Bacteria 2749
195 Ga0157376_10563755 3300014969 Unclassified 1129
196 Ga0182007_10043796 3300015262 Unclassified 1486
197 Ga0197907_10728943 3300020069 Unclassified 1155
198 Ga0206356_10776470 3300020070 Bacteria 2955
199 Ga0206354_11310300 3300020081 Unclassified 1079
200 Ga0206354_11390050 3300020081 Bacteria 1673
201 Ga0206353_10562474 3300020082 Bacteria 1087
202 Ga0213873_10027986 3300021358 Bacteria 1379
203 Ga0213871_10111194 3300021441 Bacteria 810
204 Ga0224712_10010540 3300022467 Bacteria 2831
205 Ga0224712_10013945 3300022467 Bacteria 2575
206 Ga0224712_10032730 3300022467 Unclassified 1897
207 Ga0207697_10117483 3300025315 Unclassified 1143
208 Ga0207653_10048389 3300025885 Bacteria 1409
209 Ga0207688_10004234 3300025901 Bacteria 7821
210 Ga0207647_10049686 3300025904 Unclassified 2600
211 Ga0207699_10346563 3300025906 Bacteria 1048
212 Ga0207645_10026134 3300025907 Bacteria 3775
213 Ga0207643_10036477 3300025908 Bacteria 2758
214 Ga0207643_10213450 3300025908 Bacteria 1179
215 Ga0207705_10245499 3300025909 Bacteria 1364
216 Ga0207705_10250297 3300025909 Unclassified 1351
217 Ga0207684_10087261 3300025910 Unclassified 2658
218 Ga0207654_10468483 3300025911 Bacteria 886
219 Ga0207707_10012848 3300025912 Bacteria 7286
220 Ga0207707_10026416 3300025912 Bacteria 5075
221 Ga0207707_10135237 3300025912 Unclassified 2155
222 Ga0207707_10188278 3300025912 Unclassified 1801
223 Ga0207707_10219899 3300025912 Unclassified 1653
224 Ga0207707_10269380 3300025912 Bacteria 1476
225 Ga0207695_10243043 3300025913 Bacteria 1701
226 Ga0207695_10354035 3300025913 Bacteria 1355
227 Ga0207671_10038688 3300025914 Unclassified 3535
228 Ga0207671_10052364 3300025914 Bacteria 3025
229 Ga0207693_10081434 3300025915 Bacteria 2534
230 Ga0207663_10109264 3300025916 Unclassified 1874
231 Ga0207660_10022174 3300025917 Bacteria 4277
232 Ga0207660_10194378 3300025917 Bacteria 1582
233 Ga0207662_10055526 3300025918 Bacteria 2363
234 Ga0207657_10002616 3300025919 Bacteria 19452
235 Ga0207657_10003306 3300025919 Bacteria 17240
236 Ga0207657_10066432 3300025919 Bacteria 3070
237 Ga0207649_10063100 3300025920 Unclassified 2338
238 Ga0207649_10117217 3300025920 Bacteria 1790
239 Ga0207652_10027877 3300025921 Bacteria 4710
240 Ga0207652_10051393 3300025921 Bacteria 3534
241 Ga0207652_10224122 3300025921 Bacteria 1694
242 Ga0207652_10398784 3300025921 Unclassified 1241
243 Ga0207646_10267604 3300025922 Unclassified 1545
244 Ga0207694_10052361 3300025924 Bacteria 3165
245 Ga0207694_10100337 3300025924 Unclassified 2293
246 Ga0207694_10469322 3300025924 Bacteria 1052
247 Ga0207650_10141067 3300025925 Bacteria 1894
248 Ga0207659_11156052 3300025926 Bacteria 665
249 Ga0207687_10198068 3300025927 Bacteria 1568
250 Ga0207687_10335789 3300025927 Unclassified 1227
251 Ga0207700_10037975 3300025928 Bacteria 3492
252 Ga0207664_10071176 3300025929 Bacteria 2801
253 Ga0207664_10217881 3300025929 Unclassified 1654
254 Ga0207664_10386615 3300025929 Bacteria 1243
255 Ga0207664_10541390 3300025929 Viruses 1044
256 Ga0207690_10008955 3300025932 Bacteria 5941
257 Ga0207690_10014643 3300025932 Bacteria 4740
258 Ga0207690_10035937 3300025932 Bacteria 3204
259 Ga0207690_10664297 3300025932 Bacteria 855
260 Ga0207690_10972036 3300025932 Unclassified 706
261 Ga0207706_10017090 3300025933 Bacteria 6541
262 Ga0207686_10019052 3300025934 Bacteria 3896
263 Ga0207709_10160664 3300025935 Unclassified 1567
264 Ga0207709_10171836 3300025935 Bacteria 1522
265 Ga0207709_10493167 3300025935 Unclassified 955
266 Ga0207670_10243948 3300025936 Unclassified 1385
267 Ga0207670_10702661 3300025936 Bacteria 837
268 Ga0207669_10115976 3300025937 Bacteria 1806
269 Ga0207704_10052276 3300025938 Bacteria 2476
270 Ga0207704_10440840 3300025938 Bacteria 1037
271 Ga0207665_10081005 3300025939 Bacteria 2234
272 Ga0207691_10034788 3300025940 Bacteria 4682
273 Ga0207711_10125064 3300025941 Bacteria 2299
274 Ga0207711_10983311 3300025941 Bacteria 783
275 Ga0207689_10056959 3300025942 Bacteria 3216
276 Ga0207661_10022570 3300025944 Bacteria 4743
277 Ga0207661_10183140 3300025944 Unclassified 1831
278 Ga0207661_10295640 3300025944 Bacteria 1450
279 Ga0207661_10303164 3300025944 Bacteria 1433
280 Ga0207661_10948536 3300025944 Bacteria 792
281 Ga0207667_10070437 3300025949 Bacteria 3639
282 Ga0207667_10495357 3300025949 Unclassified 1240
283 Ga0207667_10580842 3300025949 Bacteria 1131
284 Ga0207651_10106082 3300025960 Bacteria 2097
285 Ga0207651_10119667 3300025960 Unclassified 1994
286 Ga0207712_10160660 3300025961 Bacteria 1746
287 Ga0207668_10163561 3300025972 Bacteria 1737
288 Ga0207640_10203182 3300025981 Unclassified 1503
289 Ga0207640_10397572 3300025981 Unclassified 1121
290 Ga0207640_10926784 3300025981 Bacteria 762
291 Ga0207658_10186598 3300025986 Bacteria 1720
292 Ga0207677_10258934 3300026023 Bacteria 1417
293 Ga0207677_11050035 3300026023 Unclassified 741
294 Ga0207703_10099724 3300026035 Bacteria 2459
295 Ga0207703_10112950 3300026035 Bacteria 2321
296 Ga0207639_10088948 3300026041 Bacteria 2466
297 Ga0207639_10296533 3300026041 Bacteria 1428
298 Ga0207678_10077232 3300026067 Bacteria 2852
299 Ga0207678_10164457 3300026067 Bacteria 1895
300 Ga0207708_10016658 3300026075 Bacteria 5530
301 Ga0207702_10054264 3300026078 Bacteria 3395
302 Ga0207702_10277356 3300026078 Unclassified 1583
303 Ga0207641_10040658 3300026088 Bacteria 3894
304 Ga0207648_10026526 3300026089 Bacteria 5147
305 Ga0207648_11435332 3300026089 Bacteria 649
306 Ga0207674_10030776 3300026116 Bacteria 5641
307 Ga0207674_10216968 3300026116 Bacteria 1861
308 Ga0207674_10415440 3300026116 Bacteria 1300
309 Ga0207675_100065686 3300026118 Bacteria 3391
310 Ga0207683_10111300 3300026121 Bacteria 2452
311 Ga0207698_10015572 3300026142 Bacteria 5096
312 Ga0207698_10037907 3300026142 Bacteria 3555
313 Ga0209983_1081063 3300027665 Bacteria 727
314 Ga0207428_10005274 3300027907 Bacteria 12070
315 Ga0268266_10042189 3300028379 Bacteria 3896
316 Ga0268266_10095452 3300028379 Bacteria 2612
317 Ga0268264_10076363 3300028381 Bacteria 2850
318 Ga0265318_10150292 3300028577 Bacteria 854
319 Ga0265336_10078607 3300028666 Unclassified 985
320 Ga0265338_10199182 3300028800 Unclassified 1511
321 Ga0265338_10214827 3300028800 Bacteria 1441
322 Ga0265338_10354412 3300028800 Unclassified 1054
323 Ga0265320_10077390 3300031240 Bacteria 1557
324 Ga0265325_10146546 3300031241 Bacteria 1119
325 Ga0265340_10129342 3300031247 Unclassified 1159
326 Ga0265340_10133606 3300031247 Bacteria 1137
327 Ga0265331_10104384 3300031250 Bacteria 1302
328 Ga0265327_10026265 3300031251 Bacteria 3376
329 Ga0265327_10166766 3300031251 Bacteria 1014
330 Ga0265316_10266144 3300031344 Unclassified 1256
331 Ga0265316_10603680 3300031344 Unclassified 778
332 Ga0265314_10148096 3300031711 Unclassified 1443
333 Ga0265342_10119080 3300031712 Bacteria 1488
334 Ga0307415_100759985 3300032126 Bacteria 881
335 Ga0373958_0019653 3300034819 Unclassified 1236
336 Ga0373926_0033268 3300035083 Bacteria 1822
337 Ga0373928_0026124 3300035084 Unclassified 1263
338 Ga0373949_0016372 3300035090 Bacteria 1662
339 Ga0373951_0101773 3300035091 Unclassified 764
340 Ga0373936_0063635 3300035113 Bacteria 1511
341 Ga0373939_0016483 3300035114 Bacteria 1949
342 Ga0373941_0005053 3300035115 Bacteria 3078
343 Ga0373945_0003370 3300035116 Bacteria 5022
344 Ga0373945_0032415 3300035116 Bacteria 1851
345 Ga0373943_0002401 3300035170 Bacteria 8491
346 Ga0373943_0052964 3300035170 Bacteria 2002
347 Ga0373946_0033268 3300035171 Bacteria 2075
348 Ga0373946_0054634 3300035171 Bacteria 1681
349 Ga0373961_0022755 3300035241 Bacteria 1679
350 Ga0373931_0083380 3300035691 Bacteria 1768
351 Ga0373935_0004895 3300035692 Bacteria 7872
352 Ga0373927_0078946 3300035695 Bacteria 2132
353 Ga0373927_0087212 3300035695 Bacteria 2026
354 Ga0373947_0002591 3300035725 Bacteria 10859
355 Ga0373947_0003789 3300035725 Bacteria 8912
356 Ga0373925_0005252 3300037068 Bacteria 9673
357 Ga0373925_0020887 3300037068 Bacteria 4772
358 Ga0395899_0009269 3300037312 Bacteria 7558
359 Ga0395899_0037618 3300037312 Unclassified 3628
360 Ga0395899_0064759 3300037312 Bacteria 2687
361 Ga0395900_0008341 3300037418 Bacteria 10664
362 Ga0395900_0071595 3300037418 Bacteria 3564
363 Ga0395900_0084107 3300037418 Unclassified 3269
364 Ga0395900_0188197 3300037418 Unclassified 2095
365 Ga0395898_0017675 3300037466 Bacteria 7278
366 Ga0395898_0041374 3300037466 Bacteria 4552
367 Ga0395898_0067546 3300037466 Bacteria 3461
368 Ga0395898_0225850 3300037466 Unclassified 1786
369 Ga0395898_0352131 3300037466 Bacteria 1404
370 Ga0395898_0567937 3300037466 Bacteria 1077
371 Ga0395905_0007802 3300037471 Bacteria 10613
372 Ga0395905_0096555 3300037471 Bacteria 2775
373 Ga0395905_0124171 3300037471 Unclassified 2427
374 Ga0395901_0060862 3300038443 Bacteria 3929
375 Ga0395901_0147391 3300038443 Bacteria 2473
376 Ga0395901_0242966 3300038443 Bacteria 1877
377 Ga0395901_0774156 3300038443 Bacteria 951
378 Ga0395901_1281584 3300038443 Bacteria 695
379 Ga0436360_0977424 3300039438 Bacteria 842
380 Ga0436362_0631953 3300039453 Bacteria 1650
381 Ga0451807_1652234 3300041486 Bacteria 2152
382 Ga0451839_1352393 3300041496 Bacteria 816
383 Ga0451845_0246488 3300041501 Bacteria 1148
384 Ga0439448_0085296 3300042005 Bacteria 1064
385 Ga0466969_0010689 3300044656 Bacteria 4864
386 Ga0466966_0004482 3300044684 Bacteria 9213
387 Ga0466966_0058755 3300044684 Unclassified 2430
388 Ga0466961_0004553 3300044693 Bacteria 8695
389 Ga0466961_0190872 3300044693 Bacteria 1270
390 Ga0466963_0001277 3300044694 Bacteria 13358
391 Ga0466963_0018979 3300044694 Bacteria 4304
392 Ga0466963_0020604 3300044694 Bacteria 4147
393 Ga0466963_0021026 3300044694 Bacteria 4112
394 Ga0466963_0023258 3300044694 Bacteria 3932
395 Ga0466963_0061743 3300044694 Bacteria 2506
396 Ga0466963_0351596 3300044694 Bacteria 1038
397 Ga0466964_0024791 3300044706 Bacteria 2338
398 Ga0466964_0035711 3300044706 Unclassified 1989
399 Ga0466964_0060857 3300044706 Bacteria 1571
400 Ga0466964_0152778 3300044706 Bacteria 1072
401 Ga0466971_0031527 3300044719 Bacteria 2373
402 Ga0466971_0032258 3300044719 Unclassified 2347
403 Ga0466971_0217528 3300044719 Bacteria 905
404 Ga0466971_0254384 3300044719 Bacteria 837
405 Ga0466968_0038010 3300044735 Unclassified 2022
406 Ga0466970_0048998 3300044765 Bacteria 2253
407 Ga0466957_0014206 3300044842 Bacteria 4634
408 Ga0466957_0016349 3300044842 Bacteria 4340
409 Ga0466959_0000902 3300045049 Bacteria 17530
410 Ga0466959_0571559 3300045049 Bacteria 761
411 Ga0466958_0009127 3300045836 Bacteria 5512
412 Ga0466958_0086359 3300045836 Unclassified 1936
413 Ga0466958_0353756 3300045836 Unclassified 946
414 Ga0466967_0000295 3300045976 Bacteria 22299
415 Ga0466967_0009431 3300045976 Bacteria 7240
416 Ga0466967_0014038 3300045976 Bacteria 6221
417 Ga0466967_0018070 3300045976 Bacteria 5624
418 Ga0466967_0048503 3300045976 Bacteria 3708
419 Ga0466967_0054798 3300045976 Bacteria 3511
420 Ga0466967_0065452 3300045976 Bacteria 3235
421 Ga0466967_0081192 3300045976 Bacteria 2928
422 Ga0466967_0085884 3300045976 Unclassified 2850
423 Ga0466967_0251097 3300045976 Bacteria 1690
424 Ga0466967_0281228 3300045976 Bacteria 1596
425 Ga0466967_1266740 3300045976 Bacteria 734
426 Ga0495592_0242645 3300046454 Bacteria 1195
427 Ga0495603_0001090 3300046455 Bacteria 15774
428 Ga0495603_0009649 3300046455 Bacteria 5838
429 Ga0495603_0072612 3300046455 Bacteria 2022
430 Ga0495629_0001237 3300046459 Bacteria 20090
431 Ga0495629_0118994 3300046459 Bacteria 1840
432 Ga0495641_0000345 3300046461 Bacteria 38081
433 Ga0495641_0003783 3300046461 Bacteria 11099
434 Ga0495580_0457105 3300046472 Unclassified 856
435 Ga0495582_0000583 3300046473 Bacteria 20199
436 Ga0495582_0002034 3300046473 Bacteria 11334
437 Ga0495605_0055174 3300046474 Bacteria 1921
438 Ga0495639_0004574 3300046475 Bacteria 5932
439 Ga0495662_0015965 3300046476 Bacteria 3643
440 Ga0495594_0022191 3300046499 Bacteria 3394
441 Ga0495594_0048573 3300046499 Bacteria 2332
442 Ga0495616_0182180 3300046513 Bacteria 933
443 Ga0495618_0033604 3300046514 Bacteria 3216
444 Ga0495630_0004419 3300046517 Bacteria 9869
445 Ga0495630_0066560 3300046517 Bacteria 2708
446 Ga0495666_0008527 3300046526 Bacteria 5137
447 Ga0495654_0268742 3300046530 Bacteria 705
448 Ga0495665_0302041 3300046531 Bacteria 819
449 Ga0495640_0050343 3300046533 Bacteria 2870
450 Ga0495586_0010644 3300046535 Bacteria 4891
451 Ga0495667_0011795 3300046559 Bacteria 5920
452 Ga0495634_0246755 3300046642 Bacteria 1093
453 Ga0495635_0038002 3300046663 Bacteria 3332
454 Ga0495635_0375830 3300046663 Bacteria 946
455 Ga0495588_0008165 3300046674 Bacteria 4792
456 Ga0495647_0001143 3300046681 Bacteria 8146
457 Ga0495658_0002495 3300046683 Bacteria 9254
458 Ga0495658_0016290 3300046683 Bacteria 3826
459 Ga0495613_0006070 3300046689 Bacteria 9041
460 Ga0495624_0046846 3300046690 Bacteria 2748
461 Ga0495589_0032178 3300046794 Bacteria 2638
462 Ga0495581_0000640 3300047315 Bacteria 18312
463 Ga0495674_0203189 3300047319 Bacteria 1643
464 Ga0495676_0004984 3300047321 Bacteria 12176
465 Ga0495676_0018524 3300047321 Bacteria 6139
466 Ga0495680_0214208 3300047322 Bacteria 1378
467 Ga0495677_0189439 3300047445 Bacteria 798
468 Ga0495684_0061876 3300047471 Bacteria 2847
469 Ga0495684_0541424 3300047471 Unclassified 794
470 Ga0495593_0026751 3300047673 Bacteria 3181
471 Ga0495614_0029977 3300048089 Bacteria 2340
472 Ga0496100_0141091 3300048903 Unclassified 1708
473 Ga0496100_0222286 3300048903 Bacteria 1386
474 Ga0496101_0090605 3300048904 Bacteria 2274
475 Ga0496101_0154472 3300048904 Bacteria 1757
476 Ga0496102_0254293 3300048905 Bacteria 1656
477 Ga0496102_0635142 3300048905 Bacteria 991
478 Ga0496102_1543135 3300048905 Bacteria 583
479 Ga0496104_0096766 3300048907 Bacteria 2824
480 Ga0496104_0101413 3300048907 Bacteria 2756
481 Ga0496104_0761960 3300048907 Unclassified 875
482 Ga0496105_0158380 3300048908 Bacteria 1859
483 Ga0496105_0251251 3300048908 Bacteria 1432
484 Ga0496106_0096807 3300048909 Bacteria 2284
485 Ga0496106_0588498 3300048909 Unclassified 892
486 Ga0496107_0041299 3300048910 Bacteria 3312
487 Ga0496108_0005772 3300048911 Bacteria 10028
488 Ga0496109_0004102 3300048912 Bacteria 12174
489 Ga0496109_0063055 3300048912 Bacteria 3390
490 Ga0496109_0196143 3300048912 Bacteria 1898
491 Ga0496109_0259197 3300048912 Unclassified 1638
492 Ga0496109_0469087 3300048912 Bacteria 1189
493 Ga0496110_0016037 3300048913 Bacteria 6247
494 Ga0496110_0316851 3300048913 Bacteria 1421
495 Ga0496110_1100318 3300048913 Bacteria 703
496 Ga0496111_0115551 3300048914 Bacteria 1978
497 Ga0496112_0029595 3300048915 Bacteria 5296
498 Ga0496112_0253032 3300048915 Bacteria 1712
499 Ga0496112_0562508 3300048915 Bacteria 1074
500 Ga0496113_0218146 3300048916 Unclassified 1520
501 Ga0496114_0091789 3300048917 Bacteria 2579
502 Ga0496114_0165663 3300048917 Unclassified 1924
503 Ga0496114_0262083 3300048917 Bacteria 1522
504 Ga0496115_0050947 3300048918 Bacteria 3319
505 Ga0496115_0463608 3300048918 Unclassified 1022
506 Ga0501031_0006713 3300049568 Bacteria 7507
507 Ga0501031_0377528 3300049568 Unclassified 917
508 Ga0501032_0020001 3300049569 Bacteria 4671
509 Ga0501033_0048639 3300049570 Bacteria 3149
510 Ga0501034_0108038 3300049571 Bacteria 2774
511 Ga0501034_0175386 3300049571 Bacteria 2110
512 Ga0501036_0016691 3300049572 Bacteria 6131
513 Ga0501037_0028062 3300049573 Bacteria 4157
514 Ga0501038_0024053 3300049574 Bacteria 5438
515 Ga0501038_0478459 3300049574 Bacteria 955
516 Ga0501039_0050809 3300049575 Bacteria 3208
517 Ga0501040_0046151 3300049576 Bacteria 2973
518 Ga0501040_0108193 3300049576 Bacteria 1943
519 Ga0501041_0009301 3300049577 Bacteria 5786
520 Ga0501042_0006449 3300049578 Bacteria 7616
521 Ga0501043_0008368 3300049579 Bacteria 8144
522 Ga0501046_0025748 3300049580 Bacteria 4811
523 Ga0501046_0128016 3300049580 Bacteria 1927
524 Ga0501047_0030097 3300049581 Bacteria 5234
525 Ga0501048_0012536 3300049582 Bacteria 6307
526 Ga0501048_0400522 3300049582 Bacteria 981
527 Ga0501067_0004338 3300049583 Bacteria 7808
528 Ga0501067_0019904 3300049583 Bacteria 3714
529 Ga0501067_0178719 3300049583 Bacteria 1182
530 Ga0501068_0015431 3300049584 Bacteria 4387
531 Ga0501069_0003400 3300049585 Bacteria 8170
532 Ga0501069_0013509 3300049585 Bacteria 4354
533 Ga0501069_0197158 3300049585 Bacteria 1166
534 Ga0501069_0237202 3300049585 Bacteria 1062
535 Ga0501070_0001086 3300049586 Bacteria 24422
536 Ga0501070_0010988 3300049586 Bacteria 7643
537 Ga0501070_0236742 3300049586 Bacteria 1495
538 Ga0501070_0276922 3300049586 Bacteria 1369
539 Ga0501070_0384927 3300049586 Unclassified 1136
540 Ga0501070_0779090 3300049586 Bacteria 752
541 Ga0501071_0011094 3300049587 Bacteria 6057
542 Ga0501071_0022665 3300049587 Bacteria 4379
543 Ga0501072_0011344 3300049588 Bacteria 6809
544 Ga0501072_0018943 3300049588 Bacteria 5313
545 Ga0501072_0228319 3300049588 Unclassified 1483
546 Ga0501073_0017713 3300049589 Bacteria 5156
547 Ga0501073_0426348 3300049589 Bacteria 917
548 Ga0501075_0008927 3300049591 Bacteria 6994
549 Ga0501075_0126311 3300049591 Bacteria 1947
550 Ga0501076_0005822 3300049592 Bacteria 8890
551 Ga0501076_0032766 3300049592 Bacteria 4057
552 Ga0501076_0036207 3300049592 Bacteria 3866
553 Ga0501076_0148898 3300049592 Unclassified 1903
554 Ga0501077_0054130 3300049593 Bacteria 2548
555 Ga0501077_0088613 3300049593 Unclassified 1961
556 Ga0501079_0060738 3300049741 Bacteria 2916
557 Ga0501079_0349417 3300049741 Bacteria 1158
558 Ga0501080_0020836 3300049742 Bacteria 6068
559 Ga0501080_0179200 3300049742 Bacteria 1951
560 Ga0501081_0014597 3300049743 Bacteria 5182
561 Ga0501081_0115027 3300049743 Unclassified 1912
562 Ga0501081_0496362 3300049743 Bacteria 909
563 Ga0501083_0047399 3300049744 Bacteria 2903
564 Ga0501083_0169915 3300049744 Bacteria 1425
565 Ga0501044_0255010 3300049823 Unclassified 1694
566 Ga0501044_0515259 3300049823 Bacteria 1096
567 Ga0501045_0014789 3300049824 Bacteria 5532
568 Ga0501045_0089631 3300049824 Bacteria 2272
569 nmdc:mga05p37_41910_c1 3300050507 Bacteria 2789
570 nmdc:mga05p37_643853_c1 3300050507 Bacteria 1188
571 nmdc:mga09592_359885_c1 3300050508 Unclassified 1259
572 nmdc:mga09592_463844_c1 3300050508 Bacteria 1092
573 nmdc:mga08y16_7122_c1 3300050511 Bacteria 11737
574 nmdc:mga0rr50_393141_c1 3300050513 Bacteria 1170
575 nmdc:mga0a205_111109_c1 3300050515 Bacteria 2639
576 nmdc:mga0a205_324536_c1 3300050515 Bacteria 1410
577 Ga0495619_0025292 3300053085 Bacteria 3811
578 Ga0501084_0019945 3300054114 Bacteria 5587
579 Ga0501084_0132743 3300054114 Unclassified 2096
580 Ga0501084_0361703 3300054114 Bacteria 1226
581 Ga0501082_0012646 3300060353 Bacteria 7255
582 Ga0501082_0039535 3300060353 Bacteria 4069
583 Ga0466962_0034861 3300061719 Unclassified 2410
584 Ga0530510_0028867 3300061734 Bacteria 3978
585 Ga0530510_0032048 3300061734 Bacteria 3779
586 Ga0530510_0131761 3300061734 Unclassified 1839
587 Ga0157370_10183594
588 JGI24743J22301_10006366
589 JGI24738J21930_10008666
590 JGI24034J26672_10006743
591 Ga0070658_10086852
592 Ga0070676_10236332
593 Ga0070676_10656980
594 Ga0070683_100017294
595 Ga0070683_100033968
596 Ga0070683_100101185
597 Ga0070683_100140535
598 Ga0070683_100223047
599 Ga0070683_100409981
600 Ga0070683_100684500
601 Ga0070683_100787223
602 Ga0070683_100951077
603 Ga0070690_100027328
604 Ga0070677_10194631
605 Ga0068869_100147771
606 Ga0068869_100455031
607 Ga0070680_100006018
608 Ga0070680_100167776
609 Ga0070680_100242601
610 Ga0070682_100040940
611 Ga0070682_100153540
612 Ga0070682_100233094
613 Ga0070682_100273331
614 Ga0070682_100371227
615 Ga0068868_100014725
616 Ga0068868_100180921
617 Ga0070660_100007836
618 Ga0070660_100186529
619 Ga0070689_100086004
620 Ga0070689_100294494
621 Ga0070691_10156928
622 Ga0070687_100450905
623 Ga0070661_100012383
624 Ga0070661_100145391
625 Ga0070661_100264067
626 Ga0070661_100276067
627 Ga0070661_100459987
628 Ga0070692_10115949
629 Ga0070692_10491431
630 Ga0070668_100273169
631 Ga0070669_100044095
632 Ga0070669_100116624
633 Ga0070675_100366329
634 Ga0070674_100052252
635 Ga0070674_100056166
636 Ga0070674_100150192
637 Ga0070673_100503711
638 Ga0070688_100540997
639 Ga0070659_100017013
640 Ga0070659_100019969
641 Ga0070659_100047580
642 Ga0070667_100122914
643 Ga0070703_10022413
644 Ga0070714_100057964
645 Ga0070714_100387397
646 Ga0070713_100261567
647 Ga0070710_10539755
648 Ga0070701_10006807
649 Ga0070701_10261436
650 Ga0070711_100329010
651 Ga0070705_100022464
652 Ga0070700_100087587
653 Ga0070700_100119740
654 Ga0070694_100031225
655 Ga0070708_100637985
656 Ga0070678_100683209
657 Ga0070681_10012199
658 Ga0070681_10017876
659 Ga0070681_10133581
660 Ga0070681_10144597
661 Ga0070681_10222553
662 Ga0068867_100046704
663 Ga0070685_10006906
664 Ga0070685_10044958
665 Ga0070685_10799861
666 Ga0070699_100221316
667 Ga0070699_100672869
668 Ga0070679_100034843
669 Ga0070679_100035654
670 Ga0070679_100225579
671 Ga0070679_100295305
672 Ga0070679_100349878
673 Ga0070684_100017841
674 Ga0070684_100107167
675 Ga0070684_100254657
676 Ga0070697_100702618
677 Ga0068853_100073211
678 Ga0068853_100328656
679 Ga0070672_100006240
680 Ga0070672_100070177
681 Ga0070686_100046725
682 Ga0070695_100047563
683 Ga0070696_100372406
684 Ga0070693_100109711
685 Ga0070665_100087746
686 Ga0068855_100015142
687 Ga0068855_100073760
688 Ga0068855_100093947
689 Ga0068855_100459488
690 Ga0070664_100507133
691 Ga0068857_100045176
692 Ga0068857_100689655
693 Ga0068854_100871294
694 Ga0068856_100329422
695 Ga0068856_100337368
696 Ga0070702_100024667
697 Ga0070702_100573433
698 Ga0068852_100241861
699 Ga0068852_100551886
700 Ga0068859_100022305
701 Ga0068864_100541115
702 Ga0068864_100787980
703 Ga0068861_100562971
704 Ga0068851_10463484
705 Ga0068870_10094221
706 Ga0068870_10109595
707 Ga0068863_100110963
708 Ga0068858_100051606
709 Ga0068858_100145587
710 Ga0068860_100295029
711 Ga0081539_10010175
712 Ga0070717_10015531
713 Ga0075432_10052388
714 Ga0070716_100118697
715 Ga0070712_100147417
716 Ga0097621_100243842
717 Ga0097621_100456715
718 Ga0075431_100397865
719 Ga0075429_100350173
720 Ga0068865_100057631
721 Ga0097620_100022304
722 Ga0075435_100059620
723 Ga0105244_10074150
724 Ga0105240_10095108
725 Ga0105240_10100913
726 Ga0105240_10306976
727 Ga0111539_10075329
728 Ga0111539_11787869
729 Ga0105245_11588251
730 Ga0114129_10063896
731 Ga0114129_10193533
732 Ga0105243_10020255
733 Ga0105243_10065081
734 Ga0105243_10088979
735 Ga0105241_10189481
736 Ga0105248_10119533
737 Ga0105248_11166390
738 Ga0105237_10037958
739 Ga0105238_10019816
740 Ga0105238_10545873
741 Ga0105238_10569725
742 Ga0105249_10163867
743 Ga0105239_10050533
744 Ga0105239_10229729
745 Ga0105239_10459752
746 Ga0105239_10873871
747 Ga0105246_10123463
748 Ga0105246_10521901
749 Ga0157343_1002783
750 Ga0157329_1006553
751 Ga0157339_1013517
752 Ga0157373_10041045
753 Ga0157370_10041884
754 Ga0157370_10077402
755 Ga0157370_10559641
756 Ga0157369_10020182
757 Ga0157369_10161819
758 Ga0157369_10503262
759 Ga0157374_10072884
760 Ga0157374_10134475
761 Ga0157378_10597225
762 Ga0163162_10143980
763 Ga0163162_10706881
764 Ga0163162_11911320
765 Ga0157372_10022555
766 Ga0157372_10045835
767 Ga0157372_10192246
768 Ga0157372_10292448
769 Ga0157372_10839771
770 Ga0157375_10030776
771 Ga0157375_10214357
772 Ga0163163_10294222
773 Ga0163163_10379848
774 Ga0157380_10003878
775 Ga0157380_10150143
776 Ga0182008_10247254
777 Ga0182008_10555281
778 Ga0157377_10838474
779 Ga0157379_10027580
780 Ga0157376_10083449
781 Ga0157376_10563755
782 Ga0182007_10043796
783 Ga0197907_10728943
784 Ga0206356_10776470
785 Ga0206354_11310300
786 Ga0206354_11390050
787 Ga0206353_10562474
788 Ga0213873_10027986
789 Ga0213871_10111194
790 Ga0224712_10010540
791 Ga0224712_10013945
792 Ga0224712_10032730
793 Ga0207697_10117483
794 Ga0207653_10048389
795 Ga0207688_10004234
796 Ga0207647_10049686
797 Ga0207699_10346563
798 Ga0207645_10026134
799 Ga0207643_10036477
800 Ga0207643_10213450
801 Ga0207705_10245499
802 Ga0207705_10250297
803 Ga0207684_10087261
804 Ga0207654_10468483
805 Ga0207707_10012848
806 Ga0207707_10026416
807 Ga0207707_10135237
808 Ga0207707_10188278
809 Ga0207707_10219899
810 Ga0207707_10269380
811 Ga0207695_10243043
812 Ga0207695_10354035
813 Ga0207671_10038688
814 Ga0207671_10052364
815 Ga0207693_10081434
816 Ga0207663_10109264
817 Ga0207660_10022174
818 Ga0207660_10194378
819 Ga0207662_10055526
820 Ga0207657_10002616
821 Ga0207657_10003306
822 Ga0207657_10066432
823 Ga0207649_10063100
824 Ga0207649_10117217
825 Ga0207652_10027877
826 Ga0207652_10051393
827 Ga0207652_10224122
828 Ga0207652_10398784
829 Ga0207646_10267604
830 Ga0207694_10052361
831 Ga0207694_10100337
832 Ga0207694_10469322
833 Ga0207650_10141067
834 Ga0207659_11156052
835 Ga0207687_10198068
836 Ga0207687_10335789
837 Ga0207700_10037975
838 Ga0207664_10071176
839 Ga0207664_10217881
840 Ga0207664_10386615
841 Ga0207664_10541390
842 Ga0207690_10008955
843 Ga0207690_10014643
844 Ga0207690_10035937
845 Ga0207690_10664297
846 Ga0207690_10972036
847 Ga0207706_10017090
848 Ga0207686_10019052
849 Ga0207709_10160664
850 Ga0207709_10171836
851 Ga0207709_10493167
852 Ga0207670_10243948
853 Ga0207670_10702661
854 Ga0207669_10115976
855 Ga0207704_10052276
856 Ga0207704_10440840
857 Ga0207665_10081005
858 Ga0207691_10034788
859 Ga0207711_10125064
860 Ga0207711_10983311
861 Ga0207689_10056959
862 Ga0207661_10022570
863 Ga0207661_10183140
864 Ga0207661_10295640
865 Ga0207661_10303164
866 Ga0207661_10948536
867 Ga0207667_10070437
868 Ga0207667_10495357
869 Ga0207667_10580842
870 Ga0207651_10106082
871 Ga0207651_10119667
872 Ga0207712_10160660
873 Ga0207668_10163561
874 Ga0207640_10203182
875 Ga0207640_10397572
876 Ga0207640_10926784
877 Ga0207658_10186598
878 Ga0207677_10258934
879 Ga0207677_11050035
880 Ga0207703_10099724
881 Ga0207703_10112950
882 Ga0207639_10088948
883 Ga0207639_10296533
884 Ga0207678_10077232
885 Ga0207678_10164457
886 Ga0207708_10016658
887 Ga0207702_10054264
888 Ga0207702_10277356
889 Ga0207641_10040658
890 Ga0207648_10026526
891 Ga0207648_11435332
892 Ga0207674_10030776
893 Ga0207674_10216968
894 Ga0207674_10415440
895 Ga0207675_100065686
896 Ga0207683_10111300
897 Ga0207698_10015572
898 Ga0207698_10037907
899 Ga0209983_1081063
900 Ga0207428_10005274
901 Ga0268266_10042189
902 Ga0268266_10095452
903 Ga0268264_10076363
904 Ga0265318_10150292
905 Ga0265336_10078607
906 Ga0265338_10199182
907 Ga0265338_10214827
908 Ga0265338_10354412
909 Ga0265320_10077390
910 Ga0265325_10146546
911 Ga0265340_10129342
912 Ga0265340_10133606
913 Ga0265331_10104384
914 Ga0265327_10026265
915 Ga0265327_10166766
916 Ga0265316_10266144
917 Ga0265316_10603680
918 Ga0265314_10148096
919 Ga0265342_10119080
920 Ga0307415_100759985
921 Ga0373958_0019653
922 Ga0373926_0033268
923 Ga0373928_0026124
924 Ga0373949_0016372
925 Ga0373951_0101773
926 Ga0373936_0063635
927 Ga0373939_0016483
928 Ga0373941_0005053
929 Ga0373945_0003370
930 Ga0373945_0032415
931 Ga0373943_0002401
932 Ga0373943_0052964
933 Ga0373946_0033268
934 Ga0373946_0054634
935 Ga0373961_0022755
936 Ga0373931_0083380
937 Ga0373935_0004895
938 Ga0373927_0078946
939 Ga0373927_0087212
940 Ga0373947_0002591
941 Ga0373947_0003789
942 Ga0373925_0005252
943 Ga0373925_0020887
944 Ga0395899_0009269
945 Ga0395899_0037618
946 Ga0395899_0064759
947 Ga0395900_0008341
948 Ga0395900_0071595
949 Ga0395900_0084107
950 Ga0395900_0188197
951 Ga0395898_0017675
952 Ga0395898_0041374
953 Ga0395898_0067546
954 Ga0395898_0225850
955 Ga0395898_0352131
956 Ga0395898_0567937
957 Ga0395905_0007802
958 Ga0395905_0096555
959 Ga0395905_0124171
960 Ga0395901_0060862
961 Ga0395901_0147391
962 Ga0395901_0242966
963 Ga0395901_0774156
964 Ga0395901_1281584
965 Ga0436360_0977424
966 Ga0436362_0631953
967 Ga0451807_1652234
968 Ga0451839_1352393
969 Ga0451845_0246488
970 Ga0439448_0085296
971 Ga0466969_0010689
972 Ga0466966_0004482
973 Ga0466966_0058755
974 Ga0466961_0004553
975 Ga0466961_0190872
976 Ga0466963_0001277
977 Ga0466963_0018979
978 Ga0466963_0020604
979 Ga0466963_0021026
980 Ga0466963_0023258
981 Ga0466963_0061743
982 Ga0466963_0351596
983 Ga0466964_0024791
984 Ga0466964_0035711
985 Ga0466964_0060857
986 Ga0466964_0152778
987 Ga0466971_0031527
988 Ga0466971_0032258
989 Ga0466971_0217528
990 Ga0466971_0254384
991 Ga0466968_0038010
992 Ga0466970_0048998
993 Ga0466957_0014206
994 Ga0466957_0016349
995 Ga0466959_0000902
996 Ga0466959_0571559
997 Ga0466958_0009127
998 Ga0466958_0086359
999 Ga0466958_0353756
1000 Ga0466967_0000295
1001 Ga0466967_0009431
1002 Ga0466967_0014038
1003 Ga0466967_0018070
1004 Ga0466967_0048503
1005 Ga0466967_0054798
1006 Ga0466967_0065452
1007 Ga0466967_0081192
1008 Ga0466967_0085884
1009 Ga0466967_0251097
1010 Ga0466967_0281228
1011 Ga0466967_1266740
1012 Ga0495592_0242645
1013 Ga0495603_0001090
1014 Ga0495603_0009649
1015 Ga0495603_0072612
1016 Ga0495629_0001237
1017 Ga0495629_0118994
1018 Ga0495641_0000345
1019 Ga0495641_0003783
1020 Ga0495580_0457105
1021 Ga0495582_0000583
1022 Ga0495582_0002034
1023 Ga0495605_0055174
1024 Ga0495639_0004574
1025 Ga0495662_0015965
1026 Ga0495594_0022191
1027 Ga0495594_0048573
1028 Ga0495616_0182180
1029 Ga0495618_0033604
1030 Ga0495630_0004419
1031 Ga0495630_0066560
1032 Ga0495666_0008527
1033 Ga0495654_0268742
1034 Ga0495665_0302041
1035 Ga0495640_0050343
1036 Ga0495586_0010644
1037 Ga0495667_0011795
1038 Ga0495634_0246755
1039 Ga0495635_0038002
1040 Ga0495635_0375830
1041 Ga0495588_0008165
1042 Ga0495647_0001143
1043 Ga0495658_0002495
1044 Ga0495658_0016290
1045 Ga0495613_0006070
1046 Ga0495624_0046846
1047 Ga0495589_0032178
1048 Ga0495581_0000640
1049 Ga0495674_0203189
1050 Ga0495676_0004984
1051 Ga0495676_0018524
1052 Ga0495680_0214208
1053 Ga0495677_0189439
1054 Ga0495684_0061876
1055 Ga0495684_0541424
1056 Ga0495593_0026751
1057 Ga0495614_0029977
1058 Ga0496100_0141091
1059 Ga0496100_0222286
1060 Ga0496101_0090605
1061 Ga0496101_0154472
1062 Ga0496102_0254293
1063 Ga0496102_0635142
1064 Ga0496102_1543135
1065 Ga0496104_0096766
1066 Ga0496104_0101413
1067 Ga0496104_0761960
1068 Ga0496105_0158380
1069 Ga0496105_0251251
1070 Ga0496106_0096807
1071 Ga0496106_0588498
1072 Ga0496107_0041299
1073 Ga0496108_0005772
1074 Ga0496109_0004102
1075 Ga0496109_0063055
1076 Ga0496109_0196143
1077 Ga0496109_0259197
1078 Ga0496109_0469087
1079 Ga0496110_0016037
1080 Ga0496110_0316851
1081 Ga0496110_1100318
1082 Ga0496111_0115551
1083 Ga0496112_0029595
1084 Ga0496112_0253032
1085 Ga0496112_0562508
1086 Ga0496113_0218146
1087 Ga0496114_0091789
1088 Ga0496114_0165663
1089 Ga0496114_0262083
1090 Ga0496115_0050947
1091 Ga0496115_0463608
1092 Ga0501031_0006713
1093 Ga0501031_0377528
1094 Ga0501032_0020001
1095 Ga0501033_0048639
1096 Ga0501034_0108038
1097 Ga0501034_0175386
1098 Ga0501036_0016691
1099 Ga0501037_0028062
1100 Ga0501038_0024053
1101 Ga0501038_0478459
1102 Ga0501039_0050809
1103 Ga0501040_0046151
1104 Ga0501040_0108193
1105 Ga0501041_0009301
1106 Ga0501042_0006449
1107 Ga0501043_0008368
1108 Ga0501046_0025748
1109 Ga0501046_0128016
1110 Ga0501047_0030097
1111 Ga0501048_0012536
1112 Ga0501048_0400522
1113 Ga0501067_0004338
1114 Ga0501067_0019904
1115 Ga0501067_0178719
1116 Ga0501068_0015431
1117 Ga0501069_0003400
1118 Ga0501069_0013509
1119 Ga0501069_0197158
1120 Ga0501069_0237202
1121 Ga0501070_0001086
1122 Ga0501070_0010988
1123 Ga0501070_0236742
1124 Ga0501070_0276922
1125 Ga0501070_0384927
1126 Ga0501070_0779090
1127 Ga0501071_0011094
1128 Ga0501071_0022665
1129 Ga0501072_0011344
1130 Ga0501072_0018943
1131 Ga0501072_0228319
1132 Ga0501073_0017713
1133 Ga0501073_0426348
1134 Ga0501075_0008927
1135 Ga0501075_0126311
1136 Ga0501076_0005822
1137 Ga0501076_0032766
1138 Ga0501076_0036207
1139 Ga0501076_0148898
1140 Ga0501077_0054130
1141 Ga0501077_0088613
1142 Ga0501079_0060738
1143 Ga0501079_0349417
1144 Ga0501080_0020836
1145 Ga0501080_0179200
1146 Ga0501081_0014597
1147 Ga0501081_0115027
1148 Ga0501081_0496362
1149 Ga0501083_0047399
1150 Ga0501083_0169915
1151 Ga0501044_0255010
1152 Ga0501044_0515259
1153 Ga0501045_0014789
1154 Ga0501045_0089631
1155 nmdc:mga05p37_41910_c1
1156 nmdc:mga05p37_643853_c1
1157 nmdc:mga09592_359885_c1
1158 nmdc:mga09592_463844_c1
1159 nmdc:mga08y16_7122_c1
1160 nmdc:mga0rr50_393141_c1
1161 nmdc:mga0a205_111109_c1
1162 nmdc:mga0a205_324536_c1
1163 Ga0495619_0025292
1164 Ga0501084_0019945
1165 Ga0501084_0132743
1166 Ga0501084_0361703
1167 Ga0501082_0012646
1168 Ga0501082_0039535
1169 Ga0466962_0034861
1170 Ga0530510_0028867
1171 Ga0530510_0032048
1172 Ga0530510_0131761

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.7197 6 174
7oqz-assembly1.cif.gz_A cryo-em structure of human tmem45a 0.6403 6 174
1qkr-assembly1.cif.gz_A crystal structure of the vinculin tail and a pathway for activation 0.6213 48 175
5l0c-assembly2.cif.gz_D-3 human metavinculin (residues 959-1134) in complex with pip2 0.6168 48 180
5nx8-assembly1.cif.gz_C crystal structure of neanderthal adenylosuccinate lyase (adsl) 0.6019 93 176
ID Description Score Start End Superfamily
af_I1LQ93_116_258_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.8448 96 174 1.20.140.150
af_Q9FFY4_132_273_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.7765 96 187 1.20.1070.10
af_P00522_1513_1620_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.657 65 176 1.20.120.330
af_P53584_2_421_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.6465 4 177 1.20.1250.20
af_P00522_1513_1620_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.6418 65 176 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A537ZDG8-F1-model_v4 DUF998 domain-containing protein 0.9617 1 171 GO:0016020
AF-A0A537ZDG8-F1-model_v4 DUF998 domain-containing protein 0.9508 1 171 GO:0016020
AF-A0A7M2Z0Z7-F1-model_v4 Uncharacterized protein 0.9275 1 193 GO:0016020
AF-A0A7M2Z0Z7-F1-model_v4 Uncharacterized protein 0.9228 1 193 GO:0016020
AF-A0A7X1PD47-F1-model_v4 Uncharacterized protein 0.8915 1 173 GO:0016020

Map