F466503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 585 | 296 | 585 | 198 |
Family's Representative Sequence
| Representative Sequence | 3300050507|nmdc:mga05p37_650826_c1|nmdc:mga05p37_650826_c1_155_937 |
| Length | 232 |
| Sequence | MEASARAQVPPRLKERYEQEIAPSLQKRFGYKSAMEIPRLEKITLNMGVGDAKQDSNVLDAASEQLATIAGQAPNVRRARKSIAAFKLRDGMPVGVTVTLRRARMWEFFDRLTAIAIPRIRDFRGLNARSFDGRGNYSMGVREQIIFPEIDYDAIDQVRGLDVTITTSAKTDEEAYILLRELGMPFSPEGAPGFEQLKEENPEAYEAPVREEDEGGEGDDAAPAEDGDRGQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 48 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 49 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 50 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 56 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 57 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 58 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 59 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 60 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 61 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 66 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 68 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 69 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 73 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 74 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 79 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 160 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 165 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 167 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 170 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 171 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 172 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 174 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 175 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 176 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 177 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 178 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 179 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 180 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 181 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 182 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 185 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 186 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 190 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 191 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 195 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 196 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 197 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 198 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 199 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 200 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 201 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 202 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 203 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 204 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 205 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 206 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 207 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 210 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 211 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 235 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 236 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 237 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 238 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 239 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 240 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 244 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 245 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 249 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 250 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 253 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 264 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 280 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 281 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 282 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 283 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 289 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 290 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 291 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 293 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 294 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.88 |
| Nodule | 0 |
| Rhizoplane | 5.13 |
| Rhizosphere | 92.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.68 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10009512 | 3300003203 | Bacteria | 4350 |
| 2 | JGI25407J50210_10011363 | 3300003373 | Bacteria | 2275 |
| 3 | Ga0065715_10147379 | 3300005293 | Bacteria | 1771 |
| 4 | Ga0070658_10253392 | 3300005327 | Bacteria | 1493 |
| 5 | Ga0070676_10037090 | 3300005328 | Bacteria | 2810 |
| 6 | Ga0070683_100314250 | 3300005329 | Bacteria | 1491 |
| 7 | Ga0070670_100002726 | 3300005331 | Bacteria | 14597 |
| 8 | Ga0070670_100702187 | 3300005331 | Bacteria | 910 |
| 9 | Ga0070677_10004529 | 3300005333 | Bacteria | 4536 |
| 10 | Ga0068869_100165469 | 3300005334 | Bacteria | 1725 |
| 11 | Ga0070666_10020483 | 3300005335 | Bacteria | 4275 |
| 12 | Ga0070666_10042517 | 3300005335 | Bacteria | 3041 |
| 13 | Ga0068868_100464117 | 3300005338 | Bacteria | 1103 |
| 14 | Ga0070689_100018801 | 3300005340 | Bacteria | 5099 |
| 15 | Ga0070689_100359837 | 3300005340 | Bacteria | 1222 |
| 16 | Ga0070661_100114078 | 3300005344 | Bacteria | 2020 |
| 17 | Ga0070668_100012868 | 3300005347 | Bacteria | 6228 |
| 18 | Ga0070669_100102281 | 3300005353 | Bacteria | 2163 |
| 19 | Ga0070675_100031032 | 3300005354 | Bacteria | 4318 |
| 20 | Ga0070674_100014259 | 3300005356 | Bacteria | 4938 |
| 21 | Ga0070674_100219712 | 3300005356 | Bacteria | 1477 |
| 22 | Ga0070673_100066457 | 3300005364 | Bacteria | 2880 |
| 23 | Ga0070673_100161776 | 3300005364 | Bacteria | 1904 |
| 24 | Ga0070688_100062951 | 3300005365 | Bacteria | 2350 |
| 25 | Ga0070688_100245927 | 3300005365 | Bacteria | 1272 |
| 26 | Ga0070659_100097880 | 3300005366 | Bacteria | 2358 |
| 27 | Ga0070667_100001611 | 3300005367 | Bacteria | 20202 |
| 28 | Ga0070667_100048136 | 3300005367 | Bacteria | 3588 |
| 29 | Ga0070667_100097551 | 3300005367 | Bacteria | 2535 |
| 30 | Ga0070709_10015515 | 3300005434 | Bacteria | 4337 |
| 31 | Ga0070714_100009500 | 3300005435 | Bacteria | 7649 |
| 32 | Ga0070714_100039749 | 3300005435 | Bacteria | 3961 |
| 33 | Ga0070714_100388700 | 3300005435 | Bacteria | 1316 |
| 34 | Ga0070713_100001795 | 3300005436 | Bacteria | 13831 |
| 35 | Ga0070713_100005685 | 3300005436 | Bacteria | 8558 |
| 36 | Ga0070713_100163538 | 3300005436 | Bacteria | 1988 |
| 37 | Ga0070713_100193708 | 3300005436 | Bacteria | 1833 |
| 38 | Ga0070711_100380163 | 3300005439 | Bacteria | 1142 |
| 39 | Ga0070700_100016206 | 3300005441 | Bacteria | 4243 |
| 40 | Ga0070700_100088583 | 3300005441 | Bacteria | 2014 |
| 41 | Ga0070694_100919813 | 3300005444 | Bacteria | 723 |
| 42 | Ga0070708_100044414 | 3300005445 | Bacteria | 3907 |
| 43 | Ga0070708_100270554 | 3300005445 | Bacteria | 1598 |
| 44 | Ga0070678_100005141 | 3300005456 | Bacteria | 7516 |
| 45 | Ga0070678_100006691 | 3300005456 | Bacteria | 6787 |
| 46 | Ga0070678_100021374 | 3300005456 | Bacteria | 4266 |
| 47 | Ga0070662_100031910 | 3300005457 | Bacteria | 3700 |
| 48 | Ga0070681_10007099 | 3300005458 | Bacteria | 10907 |
| 49 | Ga0070681_10010917 | 3300005458 | Bacteria | 8982 |
| 50 | Ga0068867_100522388 | 3300005459 | Bacteria | 1024 |
| 51 | Ga0070685_10036875 | 3300005466 | Bacteria | 2766 |
| 52 | Ga0070685_10119525 | 3300005466 | Bacteria | 1634 |
| 53 | Ga0070706_100004600 | 3300005467 | Bacteria | 13242 |
| 54 | Ga0070707_100064367 | 3300005468 | Bacteria | 3521 |
| 55 | Ga0070698_100129739 | 3300005471 | Bacteria | 2477 |
| 56 | Ga0070698_100323539 | 3300005471 | Bacteria | 1473 |
| 57 | Ga0070699_100057447 | 3300005518 | Bacteria | 3371 |
| 58 | Ga0070699_100068029 | 3300005518 | Bacteria | 3093 |
| 59 | Ga0070699_100146878 | 3300005518 | Bacteria | 2084 |
| 60 | Ga0070699_100266738 | 3300005518 | Bacteria | 1532 |
| 61 | Ga0070699_100866728 | 3300005518 | Bacteria | 827 |
| 62 | Ga0070679_100085474 | 3300005530 | Bacteria | 3142 |
| 63 | Ga0070684_100632454 | 3300005535 | Bacteria | 996 |
| 64 | Ga0070697_100169968 | 3300005536 | Bacteria | 1844 |
| 65 | Ga0068853_100031768 | 3300005539 | Bacteria | 4468 |
| 66 | Ga0070672_100005015 | 3300005543 | Bacteria | 8727 |
| 67 | Ga0070686_100067971 | 3300005544 | Bacteria | 2323 |
| 68 | Ga0070693_100037693 | 3300005547 | Bacteria | 2697 |
| 69 | Ga0070665_100009861 | 3300005548 | Bacteria | 9655 |
| 70 | Ga0070665_100022127 | 3300005548 | Bacteria | 6394 |
| 71 | Ga0070665_100243577 | 3300005548 | Bacteria | 1798 |
| 72 | Ga0070704_100407482 | 3300005549 | Bacteria | 1162 |
| 73 | Ga0068855_100056659 | 3300005563 | Bacteria | 4598 |
| 74 | Ga0068855_100375706 | 3300005563 | Bacteria | 1561 |
| 75 | Ga0068855_101123421 | 3300005563 | Bacteria | 820 |
| 76 | Ga0068857_100012217 | 3300005577 | Bacteria | 7470 |
| 77 | Ga0068854_100729252 | 3300005578 | Bacteria | 858 |
| 78 | Ga0070702_100012107 | 3300005615 | Bacteria | 4310 |
| 79 | Ga0068852_100428745 | 3300005616 | Bacteria | 1305 |
| 80 | Ga0068859_100046188 | 3300005617 | Bacteria | 4374 |
| 81 | Ga0068859_100130549 | 3300005617 | Bacteria | 2584 |
| 82 | Ga0068859_100647831 | 3300005617 | Bacteria | 1148 |
| 83 | Ga0068864_100116524 | 3300005618 | Bacteria | 2384 |
| 84 | Ga0068864_100898083 | 3300005618 | Bacteria | 875 |
| 85 | Ga0068861_100208882 | 3300005719 | Bacteria | 1643 |
| 86 | Ga0068861_100230782 | 3300005719 | Bacteria | 1569 |
| 87 | Ga0068861_100334365 | 3300005719 | Bacteria | 1323 |
| 88 | Ga0068861_100336057 | 3300005719 | Bacteria | 1321 |
| 89 | Ga0068861_100985067 | 3300005719 | Bacteria | 804 |
| 90 | Ga0068851_10031533 | 3300005834 | Bacteria | 2633 |
| 91 | Ga0068851_10176404 | 3300005834 | Bacteria | 1182 |
| 92 | Ga0068870_10209898 | 3300005840 | Bacteria | 1185 |
| 93 | Ga0068863_100514679 | 3300005841 | Bacteria | 1179 |
| 94 | Ga0068858_100447954 | 3300005842 | Bacteria | 1244 |
| 95 | Ga0068858_100744003 | 3300005842 | Bacteria | 955 |
| 96 | Ga0068860_100071954 | 3300005843 | Bacteria | 3285 |
| 97 | Ga0068860_100170761 | 3300005843 | Bacteria | 2100 |
| 98 | Ga0068862_100001247 | 3300005844 | Bacteria | 23931 |
| 99 | Ga0081455_10006416 | 3300005937 | Bacteria | 12613 |
| 100 | Ga0081455_10011092 | 3300005937 | Bacteria | 9072 |
| 101 | Ga0081455_10017464 | 3300005937 | Bacteria | 6876 |
| 102 | Ga0081455_10019985 | 3300005937 | Bacteria | 6322 |
| 103 | Ga0081455_10093962 | 3300005937 | Bacteria | 2423 |
| 104 | Ga0081455_10165120 | 3300005937 | Bacteria | 1693 |
| 105 | Ga0081538_10001246 | 3300005981 | Bacteria | 26599 |
| 106 | Ga0081538_10008306 | 3300005981 | Bacteria | 8839 |
| 107 | Ga0081538_10022726 | 3300005981 | Bacteria | 4534 |
| 108 | Ga0081538_10026960 | 3300005981 | Bacteria | 3999 |
| 109 | Ga0081538_10076379 | 3300005981 | Bacteria | 1811 |
| 110 | Ga0081539_10014550 | 3300005985 | Bacteria | 5808 |
| 111 | Ga0070717_10062172 | 3300006028 | Bacteria | 3096 |
| 112 | Ga0070717_10075652 | 3300006028 | Bacteria | 2816 |
| 113 | Ga0075432_10034224 | 3300006058 | Bacteria | 1764 |
| 114 | Ga0070716_100003910 | 3300006173 | Bacteria | 7076 |
| 115 | Ga0070716_100272621 | 3300006173 | Bacteria | 1163 |
| 116 | Ga0070712_100044366 | 3300006175 | Bacteria | 3065 |
| 117 | Ga0070712_100078635 | 3300006175 | Bacteria | 2381 |
| 118 | Ga0075366_10007118 | 3300006195 | Bacteria | 6159 |
| 119 | Ga0075366_10016904 | 3300006195 | Bacteria | 4193 |
| 120 | Ga0097621_100180965 | 3300006237 | Bacteria | 1821 |
| 121 | Ga0097621_100204046 | 3300006237 | Bacteria | 1717 |
| 122 | Ga0068871_100066382 | 3300006358 | Bacteria | 2957 |
| 123 | Ga0068871_100092374 | 3300006358 | Bacteria | 2524 |
| 124 | Ga0068871_100111438 | 3300006358 | Bacteria | 2302 |
| 125 | Ga0068871_100340751 | 3300006358 | Bacteria | 1324 |
| 126 | Ga0075428_100132743 | 3300006844 | Bacteria | 2708 |
| 127 | Ga0075428_100236127 | 3300006844 | Bacteria | 1973 |
| 128 | Ga0075430_100049708 | 3300006846 | Bacteria | 3539 |
| 129 | Ga0075431_100075040 | 3300006847 | Bacteria | 3489 |
| 130 | Ga0075431_100348704 | 3300006847 | Bacteria | 1489 |
| 131 | Ga0075434_100036821 | 3300006871 | Bacteria | 4840 |
| 132 | Ga0075434_100239451 | 3300006871 | Bacteria | 1835 |
| 133 | Ga0075434_100279007 | 3300006871 | Bacteria | 1690 |
| 134 | Ga0075434_100716553 | 3300006871 | Bacteria | 1018 |
| 135 | Ga0068865_100285339 | 3300006881 | Bacteria | 1316 |
| 136 | Ga0075436_100000862 | 3300006914 | Bacteria | 20155 |
| 137 | Ga0075436_100018705 | 3300006914 | Bacteria | 4743 |
| 138 | Ga0097620_100046188 | 3300006931 | Bacteria | 4374 |
| 139 | Ga0097620_100130553 | 3300006931 | Bacteria | 2584 |
| 140 | Ga0097620_100253646 | 3300006931 | Bacteria | 1850 |
| 141 | Ga0097620_100647835 | 3300006931 | Bacteria | 1148 |
| 142 | Ga0075435_100120900 | 3300007076 | Bacteria | 2185 |
| 143 | Ga0105240_10152833 | 3300009093 | Bacteria | 2747 |
| 144 | Ga0105240_10252783 | 3300009093 | Bacteria | 2037 |
| 145 | Ga0111539_10019077 | 3300009094 | Bacteria | 8474 |
| 146 | Ga0111539_10021781 | 3300009094 | Bacteria | 7879 |
| 147 | Ga0111539_10342356 | 3300009094 | Bacteria | 1741 |
| 148 | Ga0111539_10404617 | 3300009094 | Bacteria | 1590 |
| 149 | Ga0111539_10690104 | 3300009094 | Bacteria | 1189 |
| 150 | Ga0105245_10040665 | 3300009098 | Bacteria | 4143 |
| 151 | Ga0105243_10035000 | 3300009148 | Bacteria | 3892 |
| 152 | Ga0105243_10245165 | 3300009148 | Bacteria | 1596 |
| 153 | Ga0105242_10009166 | 3300009176 | Bacteria | 7598 |
| 154 | Ga0105242_10046503 | 3300009176 | Bacteria | 3521 |
| 155 | Ga0105242_10716019 | 3300009176 | Bacteria | 981 |
| 156 | Ga0105248_10118027 | 3300009177 | Bacteria | 2992 |
| 157 | Ga0105248_10123110 | 3300009177 | Bacteria | 2926 |
| 158 | Ga0105248_10627912 | 3300009177 | Bacteria | 1212 |
| 159 | Ga0105238_10087095 | 3300009551 | Bacteria | 3110 |
| 160 | Ga0105249_10003640 | 3300009553 | Bacteria | 13325 |
| 161 | Ga0105249_10363778 | 3300009553 | Bacteria | 1469 |
| 162 | Ga0099796_10005277 | 3300010159 | Bacteria | 3211 |
| 163 | Ga0105239_10270107 | 3300010375 | Bacteria | 1913 |
| 164 | Ga0105246_10260205 | 3300011119 | Bacteria | 1382 |
| 165 | Ga0157370_10090984 | 3300013104 | Bacteria | 2865 |
| 166 | Ga0157369_10006334 | 3300013105 | Bacteria | 13736 |
| 167 | Ga0157374_10054005 | 3300013296 | Bacteria | 3747 |
| 168 | Ga0157374_10138530 | 3300013296 | Bacteria | 2361 |
| 169 | Ga0157374_10610582 | 3300013296 | Bacteria | 1101 |
| 170 | Ga0157378_10043237 | 3300013297 | Bacteria | 4000 |
| 171 | Ga0157378_10059479 | 3300013297 | Bacteria | 3409 |
| 172 | Ga0157378_10096241 | 3300013297 | Bacteria | 2698 |
| 173 | Ga0157378_10124450 | 3300013297 | Bacteria | 2381 |
| 174 | Ga0157378_10153148 | 3300013297 | Bacteria | 2149 |
| 175 | Ga0157378_10694815 | 3300013297 | Bacteria | 1036 |
| 176 | Ga0163162_10086874 | 3300013306 | Bacteria | 3205 |
| 177 | Ga0163162_10278343 | 3300013306 | Bacteria | 1805 |
| 178 | Ga0163162_10446724 | 3300013306 | Bacteria | 1425 |
| 179 | Ga0157372_10202803 | 3300013307 | Bacteria | 2298 |
| 180 | Ga0157375_10173624 | 3300013308 | Bacteria | 2304 |
| 181 | Ga0157375_11155259 | 3300013308 | Bacteria | 907 |
| 182 | Ga0157375_11753018 | 3300013308 | Bacteria | 736 |
| 183 | Ga0163163_10278391 | 3300014325 | Bacteria | 1724 |
| 184 | Ga0163163_10377128 | 3300014325 | Bacteria | 1476 |
| 185 | Ga0157380_10026469 | 3300014326 | Bacteria | 4403 |
| 186 | Ga0157377_10014255 | 3300014745 | Bacteria | 4041 |
| 187 | Ga0157377_10172095 | 3300014745 | Bacteria | 1355 |
| 188 | Ga0157379_10035775 | 3300014968 | Bacteria | 4428 |
| 189 | Ga0157379_10079870 | 3300014968 | Bacteria | 2930 |
| 190 | Ga0157376_10501861 | 3300014969 | Bacteria | 1193 |
| 191 | Ga0163161_10045011 | 3300017792 | Bacteria | 3181 |
| 192 | Ga0207697_10001157 | 3300025315 | Bacteria | 14504 |
| 193 | Ga0207656_10001578 | 3300025321 | Bacteria | 7582 |
| 194 | Ga0207656_10019865 | 3300025321 | Bacteria | 2662 |
| 195 | Ga0207682_10006357 | 3300025893 | Bacteria | 4766 |
| 196 | Ga0207682_10055309 | 3300025893 | Bacteria | 1650 |
| 197 | Ga0207692_10395199 | 3300025898 | Bacteria | 861 |
| 198 | Ga0207688_10002803 | 3300025901 | Bacteria | 9458 |
| 199 | Ga0207688_10040537 | 3300025901 | Bacteria | 2588 |
| 200 | Ga0207680_10054402 | 3300025903 | Bacteria | 2407 |
| 201 | Ga0207680_10067863 | 3300025903 | Bacteria | 2198 |
| 202 | Ga0207680_10118155 | 3300025903 | Bacteria | 1730 |
| 203 | Ga0207647_10089936 | 3300025904 | Bacteria | 1832 |
| 204 | Ga0207699_10069854 | 3300025906 | Bacteria | 2143 |
| 205 | Ga0207645_10004332 | 3300025907 | Bacteria | 10510 |
| 206 | Ga0207645_10250537 | 3300025907 | Bacteria | 1171 |
| 207 | Ga0207643_10001343 | 3300025908 | Bacteria | 14235 |
| 208 | Ga0207705_10172434 | 3300025909 | Bacteria | 1629 |
| 209 | Ga0207705_10230349 | 3300025909 | Bacteria | 1409 |
| 210 | Ga0207684_10011106 | 3300025910 | Bacteria | 7885 |
| 211 | Ga0207654_10015846 | 3300025911 | Bacteria | 3918 |
| 212 | Ga0207707_10005674 | 3300025912 | Bacteria | 10922 |
| 213 | Ga0207707_10015921 | 3300025912 | Bacteria | 6559 |
| 214 | Ga0207707_10192474 | 3300025912 | Bacteria | 1779 |
| 215 | Ga0207695_10045231 | 3300025913 | Bacteria | 4675 |
| 216 | Ga0207695_10725986 | 3300025913 | Bacteria | 874 |
| 217 | Ga0207693_10043512 | 3300025915 | Bacteria | 3533 |
| 218 | Ga0207693_10096919 | 3300025915 | Bacteria | 2313 |
| 219 | Ga0207693_10304066 | 3300025915 | Bacteria | 1249 |
| 220 | Ga0207693_10509639 | 3300025915 | Bacteria | 939 |
| 221 | Ga0207663_10045973 | 3300025916 | Bacteria | 2688 |
| 222 | Ga0207663_10050037 | 3300025916 | Bacteria | 2595 |
| 223 | Ga0207662_10050088 | 3300025918 | Bacteria | 2480 |
| 224 | Ga0207662_10073771 | 3300025918 | Bacteria | 2070 |
| 225 | Ga0207657_10109580 | 3300025919 | Bacteria | 2282 |
| 226 | Ga0207649_10101163 | 3300025920 | Bacteria | 1908 |
| 227 | Ga0207652_10155677 | 3300025921 | Bacteria | 2047 |
| 228 | Ga0207652_10258193 | 3300025921 | Bacteria | 1572 |
| 229 | Ga0207652_10287808 | 3300025921 | Bacteria | 1483 |
| 230 | Ga0207646_10027133 | 3300025922 | Bacteria | 5222 |
| 231 | Ga0207646_10363419 | 3300025922 | Bacteria | 1307 |
| 232 | Ga0207694_10007098 | 3300025924 | Bacteria | 8511 |
| 233 | Ga0207659_10001704 | 3300025926 | Bacteria | 13045 |
| 234 | Ga0207687_10165671 | 3300025927 | Bacteria | 1700 |
| 235 | Ga0207687_10194600 | 3300025927 | Bacteria | 1581 |
| 236 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 237 | Ga0207700_10003066 | 3300025928 | Bacteria | 9646 |
| 238 | Ga0207700_10445848 | 3300025928 | Bacteria | 1140 |
| 239 | Ga0207664_10007010 | 3300025929 | Bacteria | 7803 |
| 240 | Ga0207664_10110540 | 3300025929 | Bacteria | 2285 |
| 241 | Ga0207664_10426798 | 3300025929 | Bacteria | 1181 |
| 242 | Ga0207644_10136885 | 3300025931 | Bacteria | 1881 |
| 243 | Ga0207706_10006693 | 3300025933 | Bacteria | 10657 |
| 244 | Ga0207686_10018577 | 3300025934 | Bacteria | 3939 |
| 245 | Ga0207686_10237938 | 3300025934 | Bacteria | 1323 |
| 246 | Ga0207670_10146182 | 3300025936 | Bacteria | 1748 |
| 247 | Ga0207669_10065481 | 3300025937 | Bacteria | 2254 |
| 248 | Ga0207669_10077737 | 3300025937 | Bacteria | 2112 |
| 249 | Ga0207704_10108464 | 3300025938 | Bacteria | 1870 |
| 250 | Ga0207704_10270843 | 3300025938 | Bacteria | 1286 |
| 251 | Ga0207704_10370622 | 3300025938 | Bacteria | 1121 |
| 252 | Ga0207665_10088164 | 3300025939 | Bacteria | 2146 |
| 253 | Ga0207665_10088305 | 3300025939 | Bacteria | 2145 |
| 254 | Ga0207691_10008862 | 3300025940 | Bacteria | 9656 |
| 255 | Ga0207691_10010153 | 3300025940 | Bacteria | 9035 |
| 256 | Ga0207691_10035592 | 3300025940 | Bacteria | 4620 |
| 257 | Ga0207711_10084852 | 3300025941 | Bacteria | 2773 |
| 258 | Ga0207711_10091045 | 3300025941 | Bacteria | 2682 |
| 259 | Ga0207711_10122120 | 3300025941 | Bacteria | 2327 |
| 260 | Ga0207689_10008334 | 3300025942 | Bacteria | 9029 |
| 261 | Ga0207689_10046684 | 3300025942 | Bacteria | 3579 |
| 262 | Ga0207689_10181155 | 3300025942 | Bacteria | 1737 |
| 263 | Ga0207661_10260052 | 3300025944 | Bacteria | 1546 |
| 264 | Ga0207661_10426537 | 3300025944 | Bacteria | 1205 |
| 265 | Ga0207679_10513844 | 3300025945 | Bacteria | 1070 |
| 266 | Ga0207667_10019150 | 3300025949 | Bacteria | 7654 |
| 267 | Ga0207667_10223167 | 3300025949 | Bacteria | 1931 |
| 268 | Ga0207651_10184977 | 3300025960 | Bacteria | 1656 |
| 269 | Ga0207651_10251978 | 3300025960 | Bacteria | 1445 |
| 270 | Ga0207651_10367236 | 3300025960 | Bacteria | 1216 |
| 271 | Ga0207712_10003459 | 3300025961 | Bacteria | 9970 |
| 272 | Ga0207712_10104420 | 3300025961 | Bacteria | 2113 |
| 273 | Ga0207668_10002563 | 3300025972 | Bacteria | 10620 |
| 274 | Ga0207668_10073886 | 3300025972 | Bacteria | 2445 |
| 275 | Ga0207668_10122678 | 3300025972 | Bacteria | 1970 |
| 276 | Ga0207640_10618427 | 3300025981 | Bacteria | 919 |
| 277 | Ga0207658_10000840 | 3300025986 | Bacteria | 25652 |
| 278 | Ga0207658_10030611 | 3300025986 | Bacteria | 3813 |
| 279 | Ga0207703_10586810 | 3300026035 | Bacteria | 1053 |
| 280 | Ga0207639_10323530 | 3300026041 | Bacteria | 1370 |
| 281 | Ga0207708_10005800 | 3300026075 | Bacteria | 9127 |
| 282 | Ga0207702_10140039 | 3300026078 | Bacteria | 2188 |
| 283 | Ga0207641_10078861 | 3300026088 | Bacteria | 2853 |
| 284 | Ga0207648_10008905 | 3300026089 | Bacteria | 9661 |
| 285 | Ga0207676_10018878 | 3300026095 | Bacteria | 5020 |
| 286 | Ga0207676_10527716 | 3300026095 | Bacteria | 1125 |
| 287 | Ga0207676_10759764 | 3300026095 | Bacteria | 943 |
| 288 | Ga0207674_10022377 | 3300026116 | Bacteria | 6788 |
| 289 | Ga0207674_10058297 | 3300026116 | Bacteria | 3912 |
| 290 | Ga0207675_100006269 | 3300026118 | Bacteria | 11287 |
| 291 | Ga0207675_100125589 | 3300026118 | Bacteria | 2430 |
| 292 | Ga0207683_10007403 | 3300026121 | Bacteria | 9411 |
| 293 | Ga0207683_10008690 | 3300026121 | Bacteria | 8684 |
| 294 | Ga0207698_10025800 | 3300026142 | Bacteria | 4147 |
| 295 | Ga0207698_10214366 | 3300026142 | Bacteria | 1735 |
| 296 | Ga0207698_10767346 | 3300026142 | Bacteria | 964 |
| 297 | Ga0207428_10007467 | 3300027907 | Bacteria | 9965 |
| 298 | Ga0207428_10145127 | 3300027907 | Bacteria | 1809 |
| 299 | Ga0207428_10236826 | 3300027907 | Bacteria | 1365 |
| 300 | Ga0268266_10001628 | 3300028379 | Bacteria | 26120 |
| 301 | Ga0268266_10006169 | 3300028379 | Bacteria | 11019 |
| 302 | Ga0268266_10380414 | 3300028379 | Bacteria | 1331 |
| 303 | Ga0268265_10000667 | 3300028380 | Bacteria | 34047 |
| 304 | Ga0268265_10247238 | 3300028380 | Bacteria | 1577 |
| 305 | Ga0268264_10431947 | 3300028381 | Bacteria | 1272 |
| 306 | Ga0265337_1037670 | 3300028556 | Bacteria | 1406 |
| 307 | Ga0265319_1000030 | 3300028563 | Bacteria | 129742 |
| 308 | Ga0265319_1001800 | 3300028563 | Bacteria | 12257 |
| 309 | Ga0265334_10015907 | 3300028573 | Bacteria | 3119 |
| 310 | Ga0265318_10002940 | 3300028577 | Bacteria | 8845 |
| 311 | Ga0265318_10004027 | 3300028577 | Bacteria | 7219 |
| 312 | Ga0265318_10030930 | 3300028577 | Bacteria | 2079 |
| 313 | Ga0265322_10015941 | 3300028654 | Bacteria | 2169 |
| 314 | Ga0265338_10000156 | 3300028800 | Bacteria | 125065 |
| 315 | Ga0265338_10006510 | 3300028800 | Bacteria | 14847 |
| 316 | Ga0265338_10017394 | 3300028800 | Bacteria | 7751 |
| 317 | Ga0265338_10154817 | 3300028800 | Bacteria | 1777 |
| 318 | Ga0265324_10039877 | 3300029957 | Bacteria | 1628 |
| 319 | Ga0265332_10002675 | 3300031238 | Bacteria | 8936 |
| 320 | Ga0265328_10035883 | 3300031239 | Bacteria | 1833 |
| 321 | Ga0265320_10033040 | 3300031240 | Bacteria | 2644 |
| 322 | Ga0265320_10046676 | 3300031240 | Bacteria | 2121 |
| 323 | Ga0265325_10024792 | 3300031241 | Bacteria | 3259 |
| 324 | Ga0265325_10074450 | 3300031241 | Bacteria | 1698 |
| 325 | Ga0265329_10005644 | 3300031242 | Bacteria | 5034 |
| 326 | Ga0265329_10023036 | 3300031242 | Bacteria | 2078 |
| 327 | Ga0265340_10018011 | 3300031247 | Bacteria | 3651 |
| 328 | Ga0265339_10118988 | 3300031249 | Bacteria | 1359 |
| 329 | Ga0265331_10004043 | 3300031250 | Bacteria | 9240 |
| 330 | Ga0265331_10044959 | 3300031250 | Bacteria | 2133 |
| 331 | Ga0265327_10001971 | 3300031251 | Bacteria | 23393 |
| 332 | Ga0265327_10006243 | 3300031251 | Bacteria | 9601 |
| 333 | Ga0265327_10060671 | 3300031251 | Bacteria | 1932 |
| 334 | Ga0265327_10210607 | 3300031251 | Bacteria | 877 |
| 335 | Ga0265316_10009161 | 3300031344 | Bacteria | 9121 |
| 336 | Ga0265316_10029265 | 3300031344 | Bacteria | 4531 |
| 337 | Ga0265313_10055372 | 3300031595 | Bacteria | 1879 |
| 338 | Ga0265314_10000765 | 3300031711 | Bacteria | 38412 |
| 339 | Ga0265314_10006724 | 3300031711 | Bacteria | 10096 |
| 340 | Ga0265342_10011897 | 3300031712 | Bacteria | 5920 |
| 341 | Ga0265342_10065682 | 3300031712 | Bacteria | 2125 |
| 342 | Ga0265342_10074519 | 3300031712 | Bacteria | 1972 |
| 343 | Ga0307405_10005729 | 3300031731 | Bacteria | 6033 |
| 344 | Ga0307405_10039831 | 3300031731 | Bacteria | 2843 |
| 345 | Ga0307406_10125836 | 3300031901 | Bacteria | 1790 |
| 346 | Ga0307406_10351973 | 3300031901 | Bacteria | 1151 |
| 347 | Ga0307407_10926402 | 3300031903 | Bacteria | 670 |
| 348 | Ga0307409_100077068 | 3300031995 | Bacteria | 2676 |
| 349 | Ga0307416_100279359 | 3300032002 | Bacteria | 1645 |
| 350 | Ga0307414_10277386 | 3300032004 | Bacteria | 1407 |
| 351 | Ga0307415_100036284 | 3300032126 | Bacteria | 3228 |
| 352 | Ga0316586_1026237 | 3300033527 | Bacteria | 983 |
| 353 | Ga0373951_0151774 | 3300035091 | Bacteria | 650 |
| 354 | Ga0373943_0110785 | 3300035170 | Bacteria | 1448 |
| 355 | Ga0373931_0079776 | 3300035691 | Bacteria | 1804 |
| 356 | Ga0373935_0450985 | 3300035692 | Bacteria | 929 |
| 357 | Ga0373935_0479284 | 3300035692 | Bacteria | 901 |
| 358 | Ga0395899_0013274 | 3300037312 | Bacteria | 6304 |
| 359 | Ga0395899_0054068 | 3300037312 | Bacteria | 2972 |
| 360 | Ga0395899_0182217 | 3300037312 | Bacteria | 1474 |
| 361 | Ga0395900_0005930 | 3300037418 | Bacteria | 12755 |
| 362 | Ga0395900_0008939 | 3300037418 | Bacteria | 10272 |
| 363 | Ga0395900_0013779 | 3300037418 | Bacteria | 8252 |
| 364 | Ga0395900_0026290 | 3300037418 | Bacteria | 5960 |
| 365 | Ga0395900_0034072 | 3300037418 | Bacteria | 5242 |
| 366 | Ga0395900_0358545 | 3300037418 | Bacteria | 1430 |
| 367 | Ga0395898_0016565 | 3300037466 | Bacteria | 7535 |
| 368 | Ga0395898_0025218 | 3300037466 | Bacteria | 5994 |
| 369 | Ga0395898_0026248 | 3300037466 | Bacteria | 5864 |
| 370 | Ga0395898_0104333 | 3300037466 | Bacteria | 2719 |
| 371 | Ga0395898_0119192 | 3300037466 | Bacteria | 2528 |
| 372 | Ga0395905_0000698 | 3300037471 | Bacteria | 44490 |
| 373 | Ga0395905_0012695 | 3300037471 | Bacteria | 8103 |
| 374 | Ga0395905_0027635 | 3300037471 | Bacteria | 5350 |
| 375 | Ga0395905_0045213 | 3300037471 | Bacteria | 4130 |
| 376 | Ga0395905_0048048 | 3300037471 | Bacteria | 3999 |
| 377 | Ga0395905_0323818 | 3300037471 | Bacteria | 1431 |
| 378 | Ga0395905_0650156 | 3300037471 | Bacteria | 956 |
| 379 | Ga0395901_0000608 | 3300038443 | Bacteria | 41717 |
| 380 | Ga0395901_0005869 | 3300038443 | Bacteria | 12423 |
| 381 | Ga0395901_0009856 | 3300038443 | Bacteria | 9683 |
| 382 | Ga0395901_0033769 | 3300038443 | Bacteria | 5283 |
| 383 | Ga0395901_0072850 | 3300038443 | Bacteria | 3581 |
| 384 | Ga0395901_0513691 | 3300038443 | Bacteria | 1218 |
| 385 | Ga0395901_0593873 | 3300038443 | Bacteria | 1117 |
| 386 | Ga0436363_0498253 | 3300039450 | Bacteria | 9613 |
| 387 | Ga0439439_0040867 | 3300041406 | Bacteria | 1201 |
| 388 | Ga0451853_3403525 | 3300041512 | Bacteria | 1091 |
| 389 | Ga0439441_043107 | 3300042001 | Bacteria | 910 |
| 390 | Ga0439432_170637 | 3300042006 | Bacteria | 635 |
| 391 | Ga0450907_016895 | 3300042146 | Bacteria | 1217 |
| 392 | Ga0439446_0004585 | 3300042156 | Bacteria | 3505 |
| 393 | Ga0466965_0080401 | 3300044683 | Bacteria | 1647 |
| 394 | Ga0466963_0432990 | 3300044694 | Bacteria | 928 |
| 395 | Ga0466964_0004587 | 3300044706 | Bacteria | 5108 |
| 396 | Ga0466958_0014240 | 3300045836 | Bacteria | 4541 |
| 397 | Ga0466967_0005405 | 3300045976 | Bacteria | 8847 |
| 398 | Ga0495629_0297317 | 3300046459 | Bacteria | 1106 |
| 399 | Ga0495641_0050391 | 3300046461 | Bacteria | 1903 |
| 400 | Ga0495580_0178884 | 3300046472 | Bacteria | 1465 |
| 401 | Ga0495582_0069503 | 3300046473 | Bacteria | 1947 |
| 402 | Ga0495582_0249321 | 3300046473 | Bacteria | 1018 |
| 403 | Ga0495608_0037016 | 3300046511 | Bacteria | 3282 |
| 404 | Ga0495628_0000864 | 3300046516 | Bacteria | 28036 |
| 405 | Ga0495631_0108437 | 3300046518 | Bacteria | 1194 |
| 406 | Ga0495663_0058419 | 3300046525 | Bacteria | 1209 |
| 407 | Ga0495652_0311155 | 3300046529 | Bacteria | 1141 |
| 408 | Ga0495598_0011640 | 3300046537 | Bacteria | 2139 |
| 409 | Ga0495598_0020881 | 3300046537 | Bacteria | 1735 |
| 410 | Ga0495621_0003232 | 3300046539 | Bacteria | 4478 |
| 411 | Ga0495621_0007620 | 3300046539 | Bacteria | 3213 |
| 412 | Ga0495656_0236034 | 3300046615 | Bacteria | 919 |
| 413 | Ga0495625_0000109 | 3300046660 | Bacteria | 125064 |
| 414 | Ga0495647_0044024 | 3300046681 | Bacteria | 1710 |
| 415 | Ga0495658_0253694 | 3300046683 | Bacteria | 1107 |
| 416 | Ga0495613_0179845 | 3300046689 | Bacteria | 1498 |
| 417 | Ga0495589_0405885 | 3300046794 | Bacteria | 625 |
| 418 | Ga0495672_0103504 | 3300047320 | Bacteria | 1540 |
| 419 | Ga0495676_0082052 | 3300047321 | Bacteria | 2441 |
| 420 | Ga0495680_0433016 | 3300047322 | Bacteria | 903 |
| 421 | Ga0495602_0003702 | 3300048088 | Bacteria | 15861 |
| 422 | Ga0496101_0020085 | 3300048904 | Bacteria | 4568 |
| 423 | Ga0496102_0113199 | 3300048905 | Bacteria | 2531 |
| 424 | Ga0496103_0180619 | 3300048906 | Bacteria | 1356 |
| 425 | Ga0496104_0004171 | 3300048907 | Bacteria | 12543 |
| 426 | Ga0496104_0036479 | 3300048907 | Bacteria | 4597 |
| 427 | Ga0496104_0144557 | 3300048907 | Bacteria | 2284 |
| 428 | Ga0496104_0286930 | 3300048907 | Bacteria | 1558 |
| 429 | Ga0496104_0313047 | 3300048907 | Bacteria | 1483 |
| 430 | Ga0496105_0073103 | 3300048908 | Bacteria | 2833 |
| 431 | Ga0496106_0203026 | 3300048909 | Bacteria | 1578 |
| 432 | Ga0496106_0869023 | 3300048909 | Bacteria | 713 |
| 433 | Ga0496107_0085981 | 3300048910 | Bacteria | 2295 |
| 434 | Ga0496108_0030984 | 3300048911 | Bacteria | 4433 |
| 435 | Ga0496109_0001046 | 3300048912 | Bacteria | 22890 |
| 436 | Ga0496109_0409228 | 3300048912 | Bacteria | 1282 |
| 437 | Ga0496109_0478288 | 3300048912 | Bacteria | 1176 |
| 438 | Ga0496109_0858826 | 3300048912 | Bacteria | 845 |
| 439 | Ga0496109_0863305 | 3300048912 | Bacteria | 843 |
| 440 | Ga0496110_0023971 | 3300048913 | Bacteria | 5197 |
| 441 | Ga0496110_0044560 | 3300048913 | Bacteria | 3874 |
| 442 | Ga0496110_0289792 | 3300048913 | Bacteria | 1491 |
| 443 | Ga0496110_0807903 | 3300048913 | Bacteria | 842 |
| 444 | Ga0496111_0013650 | 3300048914 | Bacteria | 5534 |
| 445 | Ga0496111_0033779 | 3300048914 | Bacteria | 3649 |
| 446 | Ga0496111_0116205 | 3300048914 | Bacteria | 1973 |
| 447 | Ga0496112_0020180 | 3300048915 | Bacteria | 6311 |
| 448 | Ga0496113_0070012 | 3300048916 | Bacteria | 2665 |
| 449 | Ga0496113_0558675 | 3300048916 | Bacteria | 918 |
| 450 | Ga0496114_0124403 | 3300048917 | Bacteria | 2221 |
| 451 | Ga0496115_0066743 | 3300048918 | Bacteria | 2908 |
| 452 | Ga0496118_0123676 | 3300048921 | Bacteria | 1680 |
| 453 | Ga0496126_0128675 | 3300048929 | Bacteria | 2190 |
| 454 | Ga0501031_0088981 | 3300049568 | Bacteria | 2013 |
| 455 | Ga0501032_0078142 | 3300049569 | Bacteria | 2203 |
| 456 | Ga0501033_0239283 | 3300049570 | Bacteria | 1288 |
| 457 | Ga0501036_0030174 | 3300049572 | Bacteria | 4581 |
| 458 | Ga0501036_0261058 | 3300049572 | Bacteria | 1451 |
| 459 | Ga0501036_0370468 | 3300049572 | Bacteria | 1195 |
| 460 | Ga0501037_0195276 | 3300049573 | Bacteria | 1432 |
| 461 | Ga0501038_0064358 | 3300049574 | Bacteria | 3127 |
| 462 | Ga0501039_0074777 | 3300049575 | Bacteria | 2633 |
| 463 | Ga0501039_0099046 | 3300049575 | Bacteria | 2275 |
| 464 | Ga0501040_0273674 | 3300049576 | Bacteria | 1206 |
| 465 | Ga0501041_0165312 | 3300049577 | Bacteria | 1384 |
| 466 | Ga0501041_0239829 | 3300049577 | Bacteria | 1139 |
| 467 | Ga0501041_0347148 | 3300049577 | Bacteria | 937 |
| 468 | Ga0501042_0035728 | 3300049578 | Bacteria | 3525 |
| 469 | Ga0501042_0080578 | 3300049578 | Bacteria | 2332 |
| 470 | Ga0501047_0040997 | 3300049581 | Bacteria | 4475 |
| 471 | Ga0501047_0229954 | 3300049581 | Bacteria | 1708 |
| 472 | Ga0501048_0045135 | 3300049582 | Bacteria | 3149 |
| 473 | Ga0501048_0114451 | 3300049582 | Bacteria | 1905 |
| 474 | Ga0501048_0681164 | 3300049582 | Bacteria | 738 |
| 475 | Ga0501067_0007685 | 3300049583 | Bacteria | 5996 |
| 476 | Ga0501069_0001064 | 3300049585 | Bacteria | 13167 |
| 477 | Ga0501069_0135705 | 3300049585 | Bacteria | 1410 |
| 478 | Ga0501069_0163824 | 3300049585 | Bacteria | 1281 |
| 479 | Ga0501070_0001356 | 3300049586 | Bacteria | 21938 |
| 480 | Ga0501070_0262614 | 3300049586 | Bacteria | 1411 |
| 481 | Ga0501071_0005936 | 3300049587 | Bacteria | 7901 |
| 482 | Ga0501071_0113761 | 3300049587 | Bacteria | 2001 |
| 483 | Ga0501071_0225069 | 3300049587 | Bacteria | 1412 |
| 484 | Ga0501071_0268774 | 3300049587 | Bacteria | 1289 |
| 485 | Ga0501071_0295470 | 3300049587 | Bacteria | 1227 |
| 486 | Ga0501071_0552800 | 3300049587 | Bacteria | 884 |
| 487 | Ga0501071_0568526 | 3300049587 | Bacteria | 871 |
| 488 | Ga0501072_0028773 | 3300049588 | Bacteria | 4338 |
| 489 | Ga0501072_0131588 | 3300049588 | Bacteria | 1994 |
| 490 | Ga0501072_0176075 | 3300049588 | Bacteria | 1706 |
| 491 | Ga0501073_0000321 | 3300049589 | Bacteria | 32033 |
| 492 | Ga0501073_0008056 | 3300049589 | Bacteria | 7819 |
| 493 | Ga0501073_0234408 | 3300049589 | Bacteria | 1268 |
| 494 | Ga0501074_0000097 | 3300049590 | Bacteria | 42311 |
| 495 | Ga0501074_0486723 | 3300049590 | Bacteria | 874 |
| 496 | Ga0501075_0024398 | 3300049591 | Bacteria | 4434 |
| 497 | Ga0501075_0050657 | 3300049591 | Bacteria | 3121 |
| 498 | Ga0501075_0059923 | 3300049591 | Bacteria | 2868 |
| 499 | Ga0501075_0177394 | 3300049591 | Bacteria | 1626 |
| 500 | Ga0501076_0044620 | 3300049592 | Bacteria | 3496 |
| 501 | Ga0501076_0045816 | 3300049592 | Bacteria | 3453 |
| 502 | Ga0501076_0047645 | 3300049592 | Bacteria | 3389 |
| 503 | Ga0501076_0201287 | 3300049592 | Bacteria | 1626 |
| 504 | Ga0501076_0243582 | 3300049592 | Bacteria | 1471 |
| 505 | Ga0501076_0409028 | 3300049592 | Bacteria | 1116 |
| 506 | Ga0501077_0082333 | 3300049593 | Bacteria | 2039 |
| 507 | Ga0501077_0224189 | 3300049593 | Bacteria | 1195 |
| 508 | Ga0501079_0009081 | 3300049741 | Bacteria | 7529 |
| 509 | Ga0501079_0033610 | 3300049741 | Bacteria | 3945 |
| 510 | Ga0501079_0039713 | 3300049741 | Bacteria | 3630 |
| 511 | Ga0501079_0062866 | 3300049741 | Bacteria | 2863 |
| 512 | Ga0501079_0090710 | 3300049741 | Bacteria | 2368 |
| 513 | Ga0501079_0241649 | 3300049741 | Bacteria | 1411 |
| 514 | Ga0501079_0291398 | 3300049741 | Bacteria | 1276 |
| 515 | Ga0501080_0001428 | 3300049742 | Bacteria | 20060 |
| 516 | Ga0501080_0011166 | 3300049742 | Bacteria | 8223 |
| 517 | Ga0501080_0145010 | 3300049742 | Bacteria | 2195 |
| 518 | Ga0501080_0192882 | 3300049742 | Bacteria | 1872 |
| 519 | Ga0501080_0386668 | 3300049742 | Bacteria | 1260 |
| 520 | Ga0501080_0733350 | 3300049742 | Bacteria | 870 |
| 521 | Ga0501081_0017769 | 3300049743 | Bacteria | 4713 |
| 522 | Ga0501081_0031168 | 3300049743 | Bacteria | 3613 |
| 523 | Ga0501081_0222270 | 3300049743 | Bacteria | 1373 |
| 524 | Ga0501081_0405089 | 3300049743 | Bacteria | 1010 |
| 525 | Ga0501083_0004051 | 3300049744 | Bacteria | 10308 |
| 526 | Ga0501035_0123252 | 3300049822 | Bacteria | 2264 |
| 527 | Ga0501035_0157565 | 3300049822 | Bacteria | 1967 |
| 528 | Ga0501035_0219973 | 3300049822 | Bacteria | 1622 |
| 529 | Ga0501035_0854993 | 3300049822 | Bacteria | 723 |
| 530 | Ga0501044_0217134 | 3300049823 | Bacteria | 1864 |
| 531 | Ga0501044_1064687 | 3300049823 | Bacteria | 679 |
| 532 | Ga0501045_0077628 | 3300049824 | Bacteria | 2447 |
| 533 | Ga0501045_0236958 | 3300049824 | Bacteria | 1358 |
| 534 | Ga0501045_0257870 | 3300049824 | Bacteria | 1298 |
| 535 | Ga0501045_0363386 | 3300049824 | Bacteria | 1077 |
| 536 | nmdc:mga03683_93487_c1 | 3300050489 | Bacteria | 1313 |
| 537 | nmdc:mga00v17_5329_c1 | 3300050491 | Bacteria | 6775 |
| 538 | nmdc:mga0yw44_157392_c1 | 3300050492 | Bacteria | 1485 |
| 539 | nmdc:mga0yw44_3077_c1 | 3300050492 | Bacteria | 7306 |
| 540 | nmdc:mga0yw44_36915_c1 | 3300050492 | Bacteria | 2882 |
| 541 | nmdc:mga0k408_13809_c1 | 3300050493 | Bacteria | 4436 |
| 542 | nmdc:mga0k408_1928_c1 | 3300050493 | Bacteria | 11118 |
| 543 | nmdc:mga05p37_19710_c1 | 3300050507 | Bacteria | 8160 |
| 544 | nmdc:mga05p37_27608_c1 | 3300050507 | Bacteria | 6913 |
| 545 | nmdc:mga05p37_393889_c1 | 3300050507 | Bacteria | 1619 |
| 546 | nmdc:mga05p37_650826_c1 | 3300050507 | Bacteria | 1180 |
| 547 | nmdc:mga05p37_788941_c1 | 3300050507 | Bacteria | 1041 |
| 548 | nmdc:mga09592_133603_c1 | 3300050508 | Bacteria | 2136 |
| 549 | nmdc:mga0qj67_83118_c1 | 3300050509 | Bacteria | 2567 |
| 550 | nmdc:mga06r32_198902_c1 | 3300050510 | Bacteria | 1992 |
| 551 | nmdc:mga08y16_11064_c1 | 3300050511 | Bacteria | 9474 |
| 552 | nmdc:mga08y16_170967_c1 | 3300050511 | Bacteria | 2257 |
| 553 | nmdc:mga08y16_17581_c1 | 3300050511 | Bacteria | 7532 |
| 554 | nmdc:mga08y16_374461_c1 | 3300050511 | Bacteria | 1460 |
| 555 | nmdc:mga08y16_378054_c1 | 3300050511 | Bacteria | 1452 |
| 556 | nmdc:mga08y16_81215_c1 | 3300050511 | Bacteria | 3380 |
| 557 | nmdc:mga0n895_149141_c1 | 3300050512 | Bacteria | 2368 |
| 558 | nmdc:mga0n895_158049_c1 | 3300050512 | Bacteria | 2298 |
| 559 | nmdc:mga0n895_386018_c1 | 3300050512 | Bacteria | 1417 |
| 560 | nmdc:mga0n895_40300_c1 | 3300050512 | Bacteria | 4537 |
| 561 | nmdc:mga0n895_45630_c1 | 3300050512 | Bacteria | 4277 |
| 562 | nmdc:mga0n895_512190_c1 | 3300050512 | Bacteria | 1208 |
| 563 | nmdc:mga0rr50_111313_c1 | 3300050513 | Bacteria | 2167 |
| 564 | nmdc:mga0rr50_1901_c1 | 3300050513 | Bacteria | 11593 |
| 565 | nmdc:mga08x19_14562_c1 | 3300050514 | Bacteria | 4771 |
| 566 | nmdc:mga08x19_2026_c1 | 3300050514 | Bacteria | 12425 |
| 567 | nmdc:mga08x19_285719_c1 | 3300050514 | Bacteria | 1144 |
| 568 | nmdc:mga0a205_146054_c1 | 3300050515 | Bacteria | 2265 |
| 569 | nmdc:mga0a205_7331_c1 | 3300050515 | Bacteria | 9985 |
| 570 | nmdc:mga0sz30_1133_c1 | 3300050516 | Bacteria | 9551 |
| 571 | Ga0500641_0008546 | 3300053096 | Bacteria | 3658 |
| 572 | Ga0501084_0021259 | 3300054114 | Bacteria | 5410 |
| 573 | Ga0501084_0129594 | 3300054114 | Bacteria | 2123 |
| 574 | Ga0501084_0220205 | 3300054114 | Bacteria | 1601 |
| 575 | Ga0501084_0401447 | 3300054114 | Bacteria | 1158 |
| 576 | Ga0501082_0070390 | 3300060353 | Bacteria | 3012 |
| 577 | Ga0501082_0072001 | 3300060353 | Bacteria | 2977 |
| 578 | Ga0501082_0073915 | 3300060353 | Bacteria | 2935 |
| 579 | Ga0501082_0846532 | 3300060353 | Bacteria | 800 |
| 580 | Ga0501082_0865579 | 3300060353 | Bacteria | 790 |
| 581 | Ga0530510_0006651 | 3300061734 | Bacteria | 8063 |
| 582 | Ga0530510_0018622 | 3300061734 | Bacteria | 4923 |
| 583 | Ga0530510_0056671 | 3300061734 | Bacteria | 2831 |
| 584 | Ga0530510_0070582 | 3300061734 | Bacteria | 2535 |
| 585 | Ga0530510_0330134 | 3300061734 | Bacteria | 1144 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048909 | Ga0496106_0869023 | Ga0496106_0869023_13_696 | 157 |
| 2 | 3300050512 | nmdc:mga0n895_158049_c1 | nmdc:mga0n895_158049_c1_279_1073 | 174 |
| 3 | 3300049575 | Ga0501039_0099046 | Ga0501039_0099046_1638_2237 | 175 |
| 4 | 3300048909 | Ga0496106_0203026 | Ga0496106_0203026_465_1253 | 178 |
| 5 | 3300003373 | JGI25407J50210_10011363 | JGI25407J50210_100113633 | 179 |
| 6 | 3300005834 | Ga0068851_10176404 | Ga0068851_101764042 | 179 |
| 7 | 3300005981 | Ga0081538_10008306 | Ga0081538_100083066 | 179 |
| 8 | 3300009177 | Ga0105248_10118027 | Ga0105248_101180275 | 179 |
| 9 | 3300013297 | Ga0157378_10059479 | Ga0157378_100594793 | 179 |
| 10 | 3300013306 | Ga0163162_10278343 | Ga0163162_102783433 | 179 |
| 11 | 3300025941 | Ga0207711_10122120 | Ga0207711_101221203 | 179 |
| 12 | 3300041512 | Ga0451853_3403525 | Ga0451853_3403525_22_768 | 179 |
| 13 | 3300005444 | Ga0070694_100919813 | Ga0070694_1009198131 | 180 |
| 14 | 3300005518 | Ga0070699_100146878 | Ga0070699_1001468781 | 181 |
| 15 | 3300006058 | Ga0075432_10034224 | Ga0075432_100342244 | 181 |
| 16 | 3300006844 | Ga0075428_100132743 | Ga0075428_1001327432 | 181 |
| 17 | 3300009094 | Ga0111539_10019077 | Ga0111539_100190779 | 181 |
| 18 | 3300027907 | Ga0207428_10007467 | Ga0207428_1000746717 | 181 |
| 19 | 3300028800 | Ga0265338_10154817 | Ga0265338_101548173 | 181 |
| 20 | 3300046539 | Ga0495621_0007620 | Ga0495621_0007620_1110_1841 | 181 |
| 21 | 3300050511 | nmdc:mga08y16_11064_c1 | nmdc:mga08y16_11064_c1_4250_4966 | 181 |
| 22 | 3300005331 | Ga0070670_100702187 | Ga0070670_1007021871 | 182 |
| 23 | 3300005334 | Ga0068869_100165469 | Ga0068869_1001654693 | 182 |
| 24 | 3300005340 | Ga0070689_100018801 | Ga0070689_1000188019 | 182 |
| 25 | 3300005344 | Ga0070661_100114078 | Ga0070661_1001140784 | 182 |
| 26 | 3300005354 | Ga0070675_100031032 | Ga0070675_1000310328 | 182 |
| 27 | 3300005356 | Ga0070674_100219712 | Ga0070674_1002197122 | 182 |
| 28 | 3300005364 | Ga0070673_100161776 | Ga0070673_1001617762 | 182 |
| 29 | 3300005441 | Ga0070700_100088583 | Ga0070700_1000885832 | 182 |
| 30 | 3300005466 | Ga0070685_10036875 | Ga0070685_100368755 | 182 |
| 31 | 3300005543 | Ga0070672_100005015 | Ga0070672_1000050155 | 182 |
| 32 | 3300005577 | Ga0068857_100012217 | Ga0068857_1000122178 | 182 |
| 33 | 3300005617 | Ga0068859_100647831 | Ga0068859_1006478312 | 182 |
| 34 | 3300005719 | Ga0068861_100230782 | Ga0068861_1002307822 | 182 |
| 35 | 3300005840 | Ga0068870_10209898 | Ga0068870_102098981 | 182 |
| 36 | 3300006931 | Ga0097620_100647835 | Ga0097620_1006478351 | 182 |
| 37 | 3300013297 | Ga0157378_10096241 | Ga0157378_100962413 | 182 |
| 38 | 3300014745 | Ga0157377_10014255 | Ga0157377_100142558 | 182 |
| 39 | 3300025901 | Ga0207688_10040537 | Ga0207688_100405373 | 182 |
| 40 | 3300025912 | Ga0207707_10192474 | Ga0207707_101924743 | 182 |
| 41 | 3300025926 | Ga0207659_10001704 | Ga0207659_1000170414 | 182 |
| 42 | 3300025936 | Ga0207670_10146182 | Ga0207670_101461822 | 182 |
| 43 | 3300025940 | Ga0207691_10008862 | Ga0207691_1000886215 | 182 |
| 44 | 3300025942 | Ga0207689_10046684 | Ga0207689_100466843 | 182 |
| 45 | 3300025960 | Ga0207651_10367236 | Ga0207651_103672362 | 182 |
| 46 | 3300026116 | Ga0207674_10022377 | Ga0207674_1002237710 | 182 |
| 47 | 3300026118 | Ga0207675_100125589 | Ga0207675_1001255896 | 182 |
| 48 | 3300044683 | Ga0466965_0080401 | Ga0466965_0080401_18_608 | 182 |
| 49 | 3300044694 | Ga0466963_0432990 | Ga0466963_0432990_234_824 | 182 |
| 50 | 3300049569 | Ga0501032_0078142 | Ga0501032_0078142_119_709 | 182 |
| 51 | 3300049570 | Ga0501033_0239283 | Ga0501033_0239283_209_790 | 182 |
| 52 | 3300049572 | Ga0501036_0370468 | Ga0501036_0370468_177_767 | 182 |
| 53 | 3300049574 | Ga0501038_0064358 | Ga0501038_0064358_1638_2228 | 182 |
| 54 | 3300049582 | Ga0501048_0114451 | Ga0501048_0114451_876_1457 | 182 |
| 55 | 3300049585 | Ga0501069_0163824 | Ga0501069_0163824_206_787 | 182 |
| 56 | 3300049587 | Ga0501071_0225069 | Ga0501071_0225069_450_1040 | 182 |
| 57 | 3300049589 | Ga0501073_0234408 | Ga0501073_0234408_375_965 | 182 |
| 58 | 3300049593 | Ga0501077_0082333 | Ga0501077_0082333_807_1397 | 182 |
| 59 | 3300049742 | Ga0501080_0192882 | Ga0501080_0192882_1179_1760 | 182 |
| 60 | 3300049822 | Ga0501035_0854993 | Ga0501035_0854993_40_621 | 182 |
| 61 | 3300049824 | Ga0501045_0236958 | Ga0501045_0236958_700_1290 | 182 |
| 62 | 3300054114 | Ga0501084_0401447 | Ga0501084_0401447_119_709 | 182 |
| 63 | 3300060353 | Ga0501082_0865579 | Ga0501082_0865579_82_672 | 182 |
| 64 | 3300061734 | Ga0530510_0018622 | Ga0530510_0018622_3910_4500 | 182 |
| 65 | 3300005364 | Ga0070673_100066457 | Ga0070673_1000664572 | 183 |
| 66 | 3300005367 | Ga0070667_100048136 | Ga0070667_1000481364 | 183 |
| 67 | 3300005445 | Ga0070708_100270554 | Ga0070708_1002705542 | 183 |
| 68 | 3300005456 | Ga0070678_100005141 | Ga0070678_1000051419 | 183 |
| 69 | 3300005456 | Ga0070678_100006691 | Ga0070678_10000669112 | 183 |
| 70 | 3300005458 | Ga0070681_10010917 | Ga0070681_100109179 | 183 |
| 71 | 3300005459 | Ga0068867_100522388 | Ga0068867_1005223882 | 183 |
| 72 | 3300005468 | Ga0070707_100064367 | Ga0070707_1000643677 | 183 |
| 73 | 3300005518 | Ga0070699_100866728 | Ga0070699_1008667281 | 183 |
| 74 | 3300005530 | Ga0070679_100085474 | Ga0070679_1000854746 | 183 |
| 75 | 3300005535 | Ga0070684_100632454 | Ga0070684_1006324542 | 183 |
| 76 | 3300005548 | Ga0070665_100009861 | Ga0070665_1000098614 | 183 |
| 77 | 3300005842 | Ga0068858_100744003 | Ga0068858_1007440032 | 183 |
| 78 | 3300006195 | Ga0075366_10016904 | Ga0075366_100169047 | 183 |
| 79 | 3300006871 | Ga0075434_100036821 | Ga0075434_1000368212 | 183 |
| 80 | 3300006871 | Ga0075434_100279007 | Ga0075434_1002790073 | 183 |
| 81 | 3300006914 | Ga0075436_100000862 | Ga0075436_10000086217 | 183 |
| 82 | 3300009148 | Ga0105243_10245165 | Ga0105243_102451652 | 183 |
| 83 | 3300009176 | Ga0105242_10716019 | Ga0105242_107160192 | 183 |
| 84 | 3300010375 | Ga0105239_10270107 | Ga0105239_102701073 | 183 |
| 85 | 3300013297 | Ga0157378_10153148 | Ga0157378_101531484 | 183 |
| 86 | 3300013308 | Ga0157375_11753018 | Ga0157375_117530182 | 183 |
| 87 | 3300025912 | Ga0207707_10015921 | Ga0207707_100159218 | 183 |
| 88 | 3300025921 | Ga0207652_10287808 | Ga0207652_102878083 | 183 |
| 89 | 3300025922 | Ga0207646_10027133 | Ga0207646_100271339 | 183 |
| 90 | 3300025938 | Ga0207704_10108464 | Ga0207704_101084643 | 183 |
| 91 | 3300025938 | Ga0207704_10270843 | Ga0207704_102708433 | 183 |
| 92 | 3300025938 | Ga0207704_10370622 | Ga0207704_103706222 | 183 |
| 93 | 3300025940 | Ga0207691_10035592 | Ga0207691_100355921 | 183 |
| 94 | 3300025972 | Ga0207668_10122678 | Ga0207668_101226783 | 183 |
| 95 | 3300025986 | Ga0207658_10030611 | Ga0207658_100306114 | 183 |
| 96 | 3300026035 | Ga0207703_10586810 | Ga0207703_105868102 | 183 |
| 97 | 3300026095 | Ga0207676_10527716 | Ga0207676_105277162 | 183 |
| 98 | 3300026121 | Ga0207683_10008690 | Ga0207683_100086904 | 183 |
| 99 | 3300028379 | Ga0268266_10006169 | Ga0268266_100061693 | 183 |
| 100 | 3300028800 | Ga0265338_10006510 | Ga0265338_1000651016 | 183 |
| 101 | 3300031251 | Ga0265327_10006243 | Ga0265327_100062438 | 183 |
| 102 | 3300042001 | Ga0439441_043107 | Ga0439441_043107_165_890 | 183 |
| 103 | 3300046472 | Ga0495580_0178884 | Ga0495580_0178884_126_707 | 183 |
| 104 | 3300046511 | Ga0495608_0037016 | Ga0495608_0037016_369_1106 | 183 |
| 105 | 3300046794 | Ga0495589_0405885 | Ga0495589_0405885_49_612 | 183 |
| 106 | 3300048907 | Ga0496104_0144557 | Ga0496104_0144557_1084_1656 | 183 |
| 107 | 3300048908 | Ga0496105_0073103 | Ga0496105_0073103_1798_2370 | 183 |
| 108 | 3300048912 | Ga0496109_0409228 | Ga0496109_0409228_686_1249 | 183 |
| 109 | 3300048912 | Ga0496109_0478288 | Ga0496109_0478288_363_923 | 183 |
| 110 | 3300048912 | Ga0496109_0863305 | Ga0496109_0863305_209_781 | 183 |
| 111 | 3300048913 | Ga0496110_0807903 | Ga0496110_0807903_123_686 | 183 |
| 112 | 3300050493 | nmdc:mga0k408_13809_c1 | nmdc:mga0k408_13809_c1_2903_3619 | 183 |
| 113 | 3300050512 | nmdc:mga0n895_149141_c1 | nmdc:mga0n895_149141_c1_690_1457 | 183 |
| 114 | 3300050512 | nmdc:mga0n895_512190_c1 | nmdc:mga0n895_512190_c1_31_612 | 183 |
| 115 | 3300050514 | nmdc:mga08x19_2026_c1 | nmdc:mga08x19_2026_c1_7128_7895 | 183 |
| 116 | 3300050514 | nmdc:mga08x19_285719_c1 | nmdc:mga08x19_285719_c1_226_807 | 183 |
| 117 | 3300005293 | Ga0065715_10147379 | Ga0065715_101473793 | 184 |
| 118 | 3300005328 | Ga0070676_10037090 | Ga0070676_100370905 | 184 |
| 119 | 3300005333 | Ga0070677_10004529 | Ga0070677_100045298 | 184 |
| 120 | 3300005335 | Ga0070666_10020483 | Ga0070666_100204833 | 184 |
| 121 | 3300005338 | Ga0068868_100464117 | Ga0068868_1004641172 | 184 |
| 122 | 3300005353 | Ga0070669_100102281 | Ga0070669_1001022813 | 184 |
| 123 | 3300005356 | Ga0070674_100014259 | Ga0070674_1000142597 | 184 |
| 124 | 3300005365 | Ga0070688_100062951 | Ga0070688_1000629514 | 184 |
| 125 | 3300005365 | Ga0070688_100245927 | Ga0070688_1002459272 | 184 |
| 126 | 3300005367 | Ga0070667_100097551 | Ga0070667_1000975513 | 184 |
| 127 | 3300005441 | Ga0070700_100016206 | Ga0070700_1000162066 | 184 |
| 128 | 3300005456 | Ga0070678_100021374 | Ga0070678_1000213747 | 184 |
| 129 | 3300005457 | Ga0070662_100031910 | Ga0070662_1000319106 | 184 |
| 130 | 3300005466 | Ga0070685_10119525 | Ga0070685_101195253 | 184 |
| 131 | 3300005544 | Ga0070686_100067971 | Ga0070686_1000679712 | 184 |
| 132 | 3300005548 | Ga0070665_100243577 | Ga0070665_1002435772 | 184 |
| 133 | 3300005578 | Ga0068854_100729252 | Ga0068854_1007292522 | 184 |
| 134 | 3300005615 | Ga0070702_100012107 | Ga0070702_1000121074 | 184 |
| 135 | 3300005617 | Ga0068859_100046188 | Ga0068859_1000461887 | 184 |
| 136 | 3300005719 | Ga0068861_100208882 | Ga0068861_1002088822 | 184 |
| 137 | 3300005841 | Ga0068863_100514679 | Ga0068863_1005146792 | 184 |
| 138 | 3300005843 | Ga0068860_100170761 | Ga0068860_1001707613 | 184 |
| 139 | 3300006237 | Ga0097621_100180965 | Ga0097621_1001809653 | 184 |
| 140 | 3300006358 | Ga0068871_100066382 | Ga0068871_1000663824 | 184 |
| 141 | 3300006931 | Ga0097620_100046188 | Ga0097620_1000461884 | 184 |
| 142 | 3300009094 | Ga0111539_10342356 | Ga0111539_103423562 | 184 |
| 143 | 3300009098 | Ga0105245_10040665 | Ga0105245_100406657 | 184 |
| 144 | 3300009148 | Ga0105243_10035000 | Ga0105243_100350007 | 184 |
| 145 | 3300009176 | Ga0105242_10009166 | Ga0105242_1000916615 | 184 |
| 146 | 3300009177 | Ga0105248_10627912 | Ga0105248_106279122 | 184 |
| 147 | 3300009553 | Ga0105249_10363778 | Ga0105249_103637783 | 184 |
| 148 | 3300010159 | Ga0099796_10005277 | Ga0099796_100052774 | 184 |
| 149 | 3300011119 | Ga0105246_10260205 | Ga0105246_102602051 | 184 |
| 150 | 3300013296 | Ga0157374_10138530 | Ga0157374_101385301 | 184 |
| 151 | 3300013297 | Ga0157378_10043237 | Ga0157378_100432376 | 184 |
| 152 | 3300013297 | Ga0157378_10694815 | Ga0157378_106948152 | 184 |
| 153 | 3300013306 | Ga0163162_10446724 | Ga0163162_104467243 | 184 |
| 154 | 3300013308 | Ga0157375_11155259 | Ga0157375_111552592 | 184 |
| 155 | 3300014325 | Ga0163163_10278391 | Ga0163163_102783912 | 184 |
| 156 | 3300014326 | Ga0157380_10026469 | Ga0157380_100264694 | 184 |
| 157 | 3300014745 | Ga0157377_10172095 | Ga0157377_101720953 | 184 |
| 158 | 3300014968 | Ga0157379_10079870 | Ga0157379_100798706 | 184 |
| 159 | 3300014969 | Ga0157376_10501861 | Ga0157376_105018612 | 184 |
| 160 | 3300017792 | Ga0163161_10045011 | Ga0163161_100450113 | 184 |
| 161 | 3300025315 | Ga0207697_10001157 | Ga0207697_1000115713 | 184 |
| 162 | 3300025893 | Ga0207682_10006357 | Ga0207682_100063575 | 184 |
| 163 | 3300025901 | Ga0207688_10002803 | Ga0207688_100028035 | 184 |
| 164 | 3300025903 | Ga0207680_10067863 | Ga0207680_100678634 | 184 |
| 165 | 3300025907 | Ga0207645_10004332 | Ga0207645_100043329 | 184 |
| 166 | 3300025907 | Ga0207645_10250537 | Ga0207645_102505372 | 184 |
| 167 | 3300025908 | Ga0207643_10001343 | Ga0207643_1000134315 | 184 |
| 168 | 3300025918 | Ga0207662_10073771 | Ga0207662_100737713 | 184 |
| 169 | 3300025921 | Ga0207652_10258193 | Ga0207652_102581932 | 184 |
| 170 | 3300025927 | Ga0207687_10165671 | Ga0207687_101656713 | 184 |
| 171 | 3300025931 | Ga0207644_10136885 | Ga0207644_101368855 | 184 |
| 172 | 3300025933 | Ga0207706_10006693 | Ga0207706_100066939 | 184 |
| 173 | 3300025934 | Ga0207686_10018577 | Ga0207686_100185778 | 184 |
| 174 | 3300025937 | Ga0207669_10065481 | Ga0207669_100654815 | 184 |
| 175 | 3300025940 | Ga0207691_10010153 | Ga0207691_100101536 | 184 |
| 176 | 3300025941 | Ga0207711_10091045 | Ga0207711_100910453 | 184 |
| 177 | 3300025942 | Ga0207689_10008334 | Ga0207689_100083346 | 184 |
| 178 | 3300025960 | Ga0207651_10184977 | Ga0207651_101849773 | 184 |
| 179 | 3300025961 | Ga0207712_10104420 | Ga0207712_101044203 | 184 |
| 180 | 3300025972 | Ga0207668_10073886 | Ga0207668_100738862 | 184 |
| 181 | 3300025981 | Ga0207640_10618427 | Ga0207640_106184272 | 184 |
| 182 | 3300026075 | Ga0207708_10005800 | Ga0207708_100058006 | 184 |
| 183 | 3300026088 | Ga0207641_10078861 | Ga0207641_100788614 | 184 |
| 184 | 3300026089 | Ga0207648_10008905 | Ga0207648_100089058 | 184 |
| 185 | 3300026095 | Ga0207676_10018878 | Ga0207676_100188781 | 184 |
| 186 | 3300026116 | Ga0207674_10058297 | Ga0207674_100582976 | 184 |
| 187 | 3300026118 | Ga0207675_100006269 | Ga0207675_10000626915 | 184 |
| 188 | 3300026121 | Ga0207683_10007403 | Ga0207683_1000740315 | 184 |
| 189 | 3300028379 | Ga0268266_10380414 | Ga0268266_103804143 | 184 |
| 190 | 3300028380 | Ga0268265_10247238 | Ga0268265_102472383 | 184 |
| 191 | 3300028577 | Ga0265318_10002940 | Ga0265318_100029408 | 184 |
| 192 | 3300031238 | Ga0265332_10002675 | Ga0265332_100026756 | 184 |
| 193 | 3300031240 | Ga0265320_10033040 | Ga0265320_100330405 | 184 |
| 194 | 3300031242 | Ga0265329_10005644 | Ga0265329_100056443 | 184 |
| 195 | 3300031250 | Ga0265331_10004043 | Ga0265331_1000404315 | 184 |
| 196 | 3300031251 | Ga0265327_10210607 | Ga0265327_102106071 | 184 |
| 197 | 3300031344 | Ga0265316_10029265 | Ga0265316_100292658 | 184 |
| 198 | 3300031711 | Ga0265314_10000765 | Ga0265314_1000076528 | 184 |
| 199 | 3300031712 | Ga0265342_10065682 | Ga0265342_100656824 | 184 |
| 200 | 3300035091 | Ga0373951_0151774 | Ga0373951_0151774_31_618 | 184 |
| 201 | 3300046537 | Ga0495598_0011640 | Ga0495598_0011640_1455_2042 | 184 |
| 202 | 3300048907 | Ga0496104_0313047 | Ga0496104_0313047_578_1165 | 184 |
| 203 | 3300050508 | nmdc:mga09592_133603_c1 | nmdc:mga09592_133603_c1_1461_2048 | 184 |
| 204 | 3300050511 | nmdc:mga08y16_81215_c1 | nmdc:mga08y16_81215_c1_1753_2340 | 184 |
| 205 | 3300005719 | Ga0068861_100985067 | Ga0068861_1009850672 | 185 |
| 206 | 3300005937 | Ga0081455_10019985 | Ga0081455_100199854 | 185 |
| 207 | 3300006881 | Ga0068865_100285339 | Ga0068865_1002853392 | 185 |
| 208 | 3300009094 | Ga0111539_10690104 | Ga0111539_106901042 | 185 |
| 209 | 3300009176 | Ga0105242_10046503 | Ga0105242_100465033 | 185 |
| 210 | 3300009177 | Ga0105248_10123110 | Ga0105248_101231103 | 185 |
| 211 | 3300013306 | Ga0163162_10086874 | Ga0163162_100868747 | 185 |
| 212 | 3300013308 | Ga0157375_10173624 | Ga0157375_101736243 | 185 |
| 213 | 3300025934 | Ga0207686_10237938 | Ga0207686_102379383 | 185 |
| 214 | 3300025941 | Ga0207711_10084852 | Ga0207711_100848523 | 185 |
| 215 | 3300041406 | Ga0439439_0040867 | Ga0439439_0040867_411_983 | 185 |
| 216 | 3300042006 | Ga0439432_170637 | Ga0439432_170637_10_582 | 185 |
| 217 | 3300042156 | Ga0439446_0004585 | Ga0439446_0004585_920_1492 | 185 |
| 218 | 3300049572 | Ga0501036_0261058 | Ga0501036_0261058_418_1107 | 185 |
| 219 | 3300049575 | Ga0501039_0074777 | Ga0501039_0074777_1884_2573 | 185 |
| 220 | 3300049576 | Ga0501040_0273674 | Ga0501040_0273674_235_804 | 185 |
| 221 | 3300049577 | Ga0501041_0165312 | Ga0501041_0165312_690_1259 | 185 |
| 222 | 3300049577 | Ga0501041_0239829 | Ga0501041_0239829_455_1027 | 185 |
| 223 | 3300049581 | Ga0501047_0229954 | Ga0501047_0229954_291_983 | 185 |
| 224 | 3300049582 | Ga0501048_0681164 | Ga0501048_0681164_141_710 | 185 |
| 225 | 3300049587 | Ga0501071_0005936 | Ga0501071_0005936_6294_6983 | 185 |
| 226 | 3300049587 | Ga0501071_0295470 | Ga0501071_0295470_211_780 | 185 |
| 227 | 3300049587 | Ga0501071_0568526 | Ga0501071_0568526_290_850 | 185 |
| 228 | 3300049589 | Ga0501073_0008056 | Ga0501073_0008056_5167_5856 | 185 |
| 229 | 3300049590 | Ga0501074_0486723 | Ga0501074_0486723_284_853 | 185 |
| 230 | 3300049591 | Ga0501075_0024398 | Ga0501075_0024398_1927_2616 | 185 |
| 231 | 3300049591 | Ga0501075_0059923 | Ga0501075_0059923_516_1085 | 185 |
| 232 | 3300049592 | Ga0501076_0044620 | Ga0501076_0044620_2132_2701 | 185 |
| 233 | 3300049592 | Ga0501076_0047645 | Ga0501076_0047645_849_1538 | 185 |
| 234 | 3300049592 | Ga0501076_0243582 | Ga0501076_0243582_810_1382 | 185 |
| 235 | 3300049592 | Ga0501076_0409028 | Ga0501076_0409028_346_906 | 185 |
| 236 | 3300049593 | Ga0501077_0224189 | Ga0501077_0224189_444_1007 | 185 |
| 237 | 3300049741 | Ga0501079_0039713 | Ga0501079_0039713_1873_2562 | 185 |
| 238 | 3300049741 | Ga0501079_0241649 | Ga0501079_0241649_476_1048 | 185 |
| 239 | 3300049741 | Ga0501079_0291398 | Ga0501079_0291398_253_822 | 185 |
| 240 | 3300049742 | Ga0501080_0001428 | Ga0501080_0001428_16524_17213 | 185 |
| 241 | 3300049742 | Ga0501080_0386668 | Ga0501080_0386668_306_875 | 185 |
| 242 | 3300049742 | Ga0501080_0733350 | Ga0501080_0733350_68_634 | 185 |
| 243 | 3300049743 | Ga0501081_0017769 | Ga0501081_0017769_2015_2584 | 185 |
| 244 | 3300049743 | Ga0501081_0031168 | Ga0501081_0031168_1043_1732 | 185 |
| 245 | 3300049823 | Ga0501044_0217134 | Ga0501044_0217134_287_979 | 185 |
| 246 | 3300049824 | Ga0501045_0077628 | Ga0501045_0077628_1796_2365 | 185 |
| 247 | 3300049824 | Ga0501045_0257870 | Ga0501045_0257870_498_1070 | 185 |
| 248 | 3300054114 | Ga0501084_0220205 | Ga0501084_0220205_820_1392 | 185 |
| 249 | 3300060353 | Ga0501082_0070390 | Ga0501082_0070390_1942_2511 | 185 |
| 250 | 3300060353 | Ga0501082_0846532 | Ga0501082_0846532_113_673 | 185 |
| 251 | 3300061734 | Ga0530510_0006651 | Ga0530510_0006651_5065_5634 | 185 |
| 252 | 3300005327 | Ga0070658_10253392 | Ga0070658_102533922 | 186 |
| 253 | 3300005434 | Ga0070709_10015515 | Ga0070709_100155154 | 186 |
| 254 | 3300005435 | Ga0070714_100009500 | Ga0070714_1000095008 | 186 |
| 255 | 3300005435 | Ga0070714_100039749 | Ga0070714_1000397498 | 186 |
| 256 | 3300005436 | Ga0070713_100001795 | Ga0070713_10000179516 | 186 |
| 257 | 3300005439 | Ga0070711_100380163 | Ga0070711_1003801632 | 186 |
| 258 | 3300005458 | Ga0070681_10007099 | Ga0070681_1000709914 | 186 |
| 259 | 3300005548 | Ga0070665_100022127 | Ga0070665_1000221276 | 186 |
| 260 | 3300005937 | Ga0081455_10165120 | Ga0081455_101651203 | 186 |
| 261 | 3300006028 | Ga0070717_10062172 | Ga0070717_100621723 | 186 |
| 262 | 3300006173 | Ga0070716_100003910 | Ga0070716_10000391015 | 186 |
| 263 | 3300006173 | Ga0070716_100272621 | Ga0070716_1002726212 | 186 |
| 264 | 3300006175 | Ga0070712_100044366 | Ga0070712_1000443664 | 186 |
| 265 | 3300006871 | Ga0075434_100716553 | Ga0075434_1007165532 | 186 |
| 266 | 3300009094 | Ga0111539_10404617 | Ga0111539_104046174 | 186 |
| 267 | 3300025898 | Ga0207692_10395199 | Ga0207692_103951992 | 186 |
| 268 | 3300025909 | Ga0207705_10172434 | Ga0207705_101724343 | 186 |
| 269 | 3300025909 | Ga0207705_10230349 | Ga0207705_102303493 | 186 |
| 270 | 3300025911 | Ga0207654_10015846 | Ga0207654_100158468 | 186 |
| 271 | 3300025912 | Ga0207707_10005674 | Ga0207707_1000567415 | 186 |
| 272 | 3300025915 | Ga0207693_10096919 | Ga0207693_100969194 | 186 |
| 273 | 3300025915 | Ga0207693_10304066 | Ga0207693_103040662 | 186 |
| 274 | 3300025916 | Ga0207663_10045973 | Ga0207663_100459733 | 186 |
| 275 | 3300025919 | Ga0207657_10109580 | Ga0207657_101095804 | 186 |
| 276 | 3300025921 | Ga0207652_10155677 | Ga0207652_101556771 | 186 |
| 277 | 3300025929 | Ga0207664_10007010 | Ga0207664_100070109 | 186 |
| 278 | 3300025929 | Ga0207664_10426798 | Ga0207664_104267983 | 186 |
| 279 | 3300025939 | Ga0207665_10088305 | Ga0207665_100883052 | 186 |
| 280 | 3300028577 | Ga0265318_10004027 | Ga0265318_100040279 | 186 |
| 281 | 3300033527 | Ga0316586_1026237 | Ga0316586_10262371 | 186 |
| 282 | 3300035692 | Ga0373935_0450985 | Ga0373935_0450985_72_806 | 186 |
| 283 | 3300037312 | Ga0395899_0013274 | Ga0395899_0013274_865_1467 | 186 |
| 284 | 3300037418 | Ga0395900_0005930 | Ga0395900_0005930_522_1124 | 186 |
| 285 | 3300037418 | Ga0395900_0008939 | Ga0395900_0008939_9027_9629 | 186 |
| 286 | 3300037466 | Ga0395898_0025218 | Ga0395898_0025218_522_1124 | 186 |
| 287 | 3300037471 | Ga0395905_0000698 | Ga0395905_0000698_5089_5691 | 186 |
| 288 | 3300037471 | Ga0395905_0012695 | Ga0395905_0012695_2050_2652 | 186 |
| 289 | 3300038443 | Ga0395901_0000608 | Ga0395901_0000608_21588_22190 | 186 |
| 290 | 3300038443 | Ga0395901_0005869 | Ga0395901_0005869_5826_6428 | 186 |
| 291 | 3300039450 | Ga0436363_0498253 | Ga0436363_0498253_6828_7535 | 186 |
| 292 | 3300044706 | Ga0466964_0004587 | Ga0466964_0004587_3408_4010 | 186 |
| 293 | 3300045976 | Ga0466967_0005405 | Ga0466967_0005405_229_831 | 186 |
| 294 | 3300046683 | Ga0495658_0253694 | Ga0495658_0253694_337_1041 | 186 |
| 295 | 3300048912 | Ga0496109_0858826 | Ga0496109_0858826_16_726 | 186 |
| 296 | 3300049583 | Ga0501067_0007685 | Ga0501067_0007685_1831_2406 | 186 |
| 297 | 3300049585 | Ga0501069_0135705 | Ga0501069_0135705_641_1216 | 186 |
| 298 | 3300049587 | Ga0501071_0552800 | Ga0501071_0552800_96_671 | 186 |
| 299 | 3300049588 | Ga0501072_0176075 | Ga0501072_0176075_212_787 | 186 |
| 300 | 3300049591 | Ga0501075_0177394 | Ga0501075_0177394_507_1082 | 186 |
| 301 | 3300049592 | Ga0501076_0201287 | Ga0501076_0201287_670_1245 | 186 |
| 302 | 3300049741 | Ga0501079_0090710 | Ga0501079_0090710_937_1512 | 186 |
| 303 | 3300049743 | Ga0501081_0405089 | Ga0501081_0405089_146_721 | 186 |
| 304 | 3300049822 | Ga0501035_0123252 | Ga0501035_0123252_1274_1966 | 186 |
| 305 | 3300049824 | Ga0501045_0363386 | Ga0501045_0363386_474_1049 | 186 |
| 306 | 3300050492 | nmdc:mga0yw44_36915_c1 | nmdc:mga0yw44_36915_c1_1225_1929 | 186 |
| 307 | 3300050507 | nmdc:mga05p37_788941_c1 | nmdc:mga05p37_788941_c1_224_859 | 186 |
| 308 | 3300050511 | nmdc:mga08y16_374461_c1 | nmdc:mga08y16_374461_c1_116_688 | 186 |
| 309 | 3300053096 | Ga0500641_0008546 | Ga0500641_0008546_255_959 | 186 |
| 310 | 3300061734 | Ga0530510_0330134 | Ga0530510_0330134_250_825 | 186 |
| 311 | 3300005340 | Ga0070689_100359837 | Ga0070689_1003598372 | 187 |
| 312 | 3300005366 | Ga0070659_100097880 | Ga0070659_1000978804 | 187 |
| 313 | 3300005435 | Ga0070714_100388700 | Ga0070714_1003887001 | 187 |
| 314 | 3300005436 | Ga0070713_100005685 | Ga0070713_1000056854 | 187 |
| 315 | 3300005436 | Ga0070713_100193708 | Ga0070713_1001937083 | 187 |
| 316 | 3300005471 | Ga0070698_100323539 | Ga0070698_1003235393 | 187 |
| 317 | 3300005539 | Ga0068853_100031768 | Ga0068853_1000317682 | 187 |
| 318 | 3300005547 | Ga0070693_100037693 | Ga0070693_1000376937 | 187 |
| 319 | 3300005549 | Ga0070704_100407482 | Ga0070704_1004074822 | 187 |
| 320 | 3300005563 | Ga0068855_100056659 | Ga0068855_1000566599 | 187 |
| 321 | 3300005563 | Ga0068855_100375706 | Ga0068855_1003757062 | 187 |
| 322 | 3300005563 | Ga0068855_101123421 | Ga0068855_1011234211 | 187 |
| 323 | 3300005616 | Ga0068852_100428745 | Ga0068852_1004287452 | 187 |
| 324 | 3300005617 | Ga0068859_100130549 | Ga0068859_1001305491 | 187 |
| 325 | 3300005618 | Ga0068864_100116524 | Ga0068864_1001165245 | 187 |
| 326 | 3300005719 | Ga0068861_100334365 | Ga0068861_1003343653 | 187 |
| 327 | 3300005719 | Ga0068861_100336057 | Ga0068861_1003360572 | 187 |
| 328 | 3300005834 | Ga0068851_10031533 | Ga0068851_100315336 | 187 |
| 329 | 3300005937 | Ga0081455_10006416 | Ga0081455_1000641613 | 187 |
| 330 | 3300005981 | Ga0081538_10026960 | Ga0081538_100269605 | 187 |
| 331 | 3300006195 | Ga0075366_10007118 | Ga0075366_100071189 | 187 |
| 332 | 3300006237 | Ga0097621_100204046 | Ga0097621_1002040463 | 187 |
| 333 | 3300006358 | Ga0068871_100092374 | Ga0068871_1000923744 | 187 |
| 334 | 3300006358 | Ga0068871_100111438 | Ga0068871_1001114382 | 187 |
| 335 | 3300006358 | Ga0068871_100340751 | Ga0068871_1003407511 | 187 |
| 336 | 3300006844 | Ga0075428_100236127 | Ga0075428_1002361274 | 187 |
| 337 | 3300006847 | Ga0075431_100075040 | Ga0075431_1000750402 | 187 |
| 338 | 3300006871 | Ga0075434_100239451 | Ga0075434_1002394514 | 187 |
| 339 | 3300006914 | Ga0075436_100018705 | Ga0075436_1000187055 | 187 |
| 340 | 3300006931 | Ga0097620_100130553 | Ga0097620_1001305536 | 187 |
| 341 | 3300006931 | Ga0097620_100253646 | Ga0097620_1002536463 | 187 |
| 342 | 3300007076 | Ga0075435_100120900 | Ga0075435_1001209002 | 187 |
| 343 | 3300009093 | Ga0105240_10152833 | Ga0105240_101528334 | 187 |
| 344 | 3300009093 | Ga0105240_10252783 | Ga0105240_102527833 | 187 |
| 345 | 3300009094 | Ga0111539_10021781 | Ga0111539_100217818 | 187 |
| 346 | 3300009551 | Ga0105238_10087095 | Ga0105238_100870953 | 187 |
| 347 | 3300013104 | Ga0157370_10090984 | Ga0157370_100909843 | 187 |
| 348 | 3300013105 | Ga0157369_10006334 | Ga0157369_1000633414 | 187 |
| 349 | 3300013296 | Ga0157374_10054005 | Ga0157374_100540056 | 187 |
| 350 | 3300013297 | Ga0157378_10124450 | Ga0157378_101244503 | 187 |
| 351 | 3300013307 | Ga0157372_10202803 | Ga0157372_102028034 | 187 |
| 352 | 3300014325 | Ga0163163_10377128 | Ga0163163_103771282 | 187 |
| 353 | 3300025321 | Ga0207656_10019865 | Ga0207656_100198652 | 187 |
| 354 | 3300025893 | Ga0207682_10055309 | Ga0207682_100553093 | 187 |
| 355 | 3300025913 | Ga0207695_10045231 | Ga0207695_100452319 | 187 |
| 356 | 3300025913 | Ga0207695_10725986 | Ga0207695_107259862 | 187 |
| 357 | 3300025916 | Ga0207663_10050037 | Ga0207663_100500376 | 187 |
| 358 | 3300025918 | Ga0207662_10050088 | Ga0207662_100500881 | 187 |
| 359 | 3300025920 | Ga0207649_10101163 | Ga0207649_101011633 | 187 |
| 360 | 3300025924 | Ga0207694_10007098 | Ga0207694_1000709813 | 187 |
| 361 | 3300025927 | Ga0207687_10194600 | Ga0207687_101946003 | 187 |
| 362 | 3300025928 | Ga0207700_10003066 | Ga0207700_100030662 | 187 |
| 363 | 3300025928 | Ga0207700_10445848 | Ga0207700_104458482 | 187 |
| 364 | 3300025942 | Ga0207689_10181155 | Ga0207689_101811553 | 187 |
| 365 | 3300025944 | Ga0207661_10260052 | Ga0207661_102600522 | 187 |
| 366 | 3300025949 | Ga0207667_10019150 | Ga0207667_100191509 | 187 |
| 367 | 3300025949 | Ga0207667_10223167 | Ga0207667_102231673 | 187 |
| 368 | 3300025960 | Ga0207651_10251978 | Ga0207651_102519783 | 187 |
| 369 | 3300026041 | Ga0207639_10323530 | Ga0207639_103235303 | 187 |
| 370 | 3300026078 | Ga0207702_10140039 | Ga0207702_101400394 | 187 |
| 371 | 3300026095 | Ga0207676_10759764 | Ga0207676_107597642 | 187 |
| 372 | 3300026142 | Ga0207698_10025800 | Ga0207698_100258004 | 187 |
| 373 | 3300026142 | Ga0207698_10214366 | Ga0207698_102143662 | 187 |
| 374 | 3300026142 | Ga0207698_10767346 | Ga0207698_107673462 | 187 |
| 375 | 3300027907 | Ga0207428_10236826 | Ga0207428_102368262 | 187 |
| 376 | 3300028556 | Ga0265337_1037670 | Ga0265337_10376702 | 187 |
| 377 | 3300028563 | Ga0265319_1001800 | Ga0265319_100180021 | 187 |
| 378 | 3300028573 | Ga0265334_10015907 | Ga0265334_100159076 | 187 |
| 379 | 3300028577 | Ga0265318_10030930 | Ga0265318_100309301 | 187 |
| 380 | 3300028654 | Ga0265322_10015941 | Ga0265322_100159412 | 187 |
| 381 | 3300028800 | Ga0265338_10017394 | Ga0265338_100173944 | 187 |
| 382 | 3300031239 | Ga0265328_10035883 | Ga0265328_100358832 | 187 |
| 383 | 3300031240 | Ga0265320_10046676 | Ga0265320_100466764 | 187 |
| 384 | 3300031241 | Ga0265325_10074450 | Ga0265325_100744503 | 187 |
| 385 | 3300031242 | Ga0265329_10023036 | Ga0265329_100230361 | 187 |
| 386 | 3300031247 | Ga0265340_10018011 | Ga0265340_100180112 | 187 |
| 387 | 3300031249 | Ga0265339_10118988 | Ga0265339_101189883 | 187 |
| 388 | 3300031251 | Ga0265327_10001971 | Ga0265327_100019719 | 187 |
| 389 | 3300031251 | Ga0265327_10060671 | Ga0265327_100606712 | 187 |
| 390 | 3300031344 | Ga0265316_10009161 | Ga0265316_1000916112 | 187 |
| 391 | 3300031711 | Ga0265314_10006724 | Ga0265314_100067246 | 187 |
| 392 | 3300031712 | Ga0265342_10011897 | Ga0265342_100118973 | 187 |
| 393 | 3300031731 | Ga0307405_10005729 | Ga0307405_100057294 | 187 |
| 394 | 3300037312 | Ga0395899_0054068 | Ga0395899_0054068_367_1068 | 187 |
| 395 | 3300037312 | Ga0395899_0182217 | Ga0395899_0182217_53_658 | 187 |
| 396 | 3300037418 | Ga0395900_0013779 | Ga0395900_0013779_4139_4744 | 187 |
| 397 | 3300037418 | Ga0395900_0034072 | Ga0395900_0034072_648_1349 | 187 |
| 398 | 3300037466 | Ga0395898_0026248 | Ga0395898_0026248_1893_2498 | 187 |
| 399 | 3300037471 | Ga0395905_0048048 | Ga0395905_0048048_601_1302 | 187 |
| 400 | 3300037471 | Ga0395905_0323818 | Ga0395905_0323818_53_658 | 187 |
| 401 | 3300038443 | Ga0395901_0009856 | Ga0395901_0009856_3261_3866 | 187 |
| 402 | 3300038443 | Ga0395901_0033769 | Ga0395901_0033769_3343_4044 | 187 |
| 403 | 3300046529 | Ga0495652_0311155 | Ga0495652_0311155_306_878 | 187 |
| 404 | 3300046537 | Ga0495598_0020881 | Ga0495598_0020881_969_1697 | 187 |
| 405 | 3300046539 | Ga0495621_0003232 | Ga0495621_0003232_3218_3937 | 187 |
| 406 | 3300048907 | Ga0496104_0004171 | Ga0496104_0004171_1411_2115 | 187 |
| 407 | 3300048913 | Ga0496110_0044560 | Ga0496110_0044560_1870_2574 | 187 |
| 408 | 3300048914 | Ga0496111_0116205 | Ga0496111_0116205_859_1563 | 187 |
| 409 | 3300048916 | Ga0496113_0558675 | Ga0496113_0558675_72_644 | 187 |
| 410 | 3300049581 | Ga0501047_0040997 | Ga0501047_0040997_222_920 | 187 |
| 411 | 3300049585 | Ga0501069_0001064 | Ga0501069_0001064_767_1474 | 187 |
| 412 | 3300049586 | Ga0501070_0001356 | Ga0501070_0001356_14909_15616 | 187 |
| 413 | 3300049587 | Ga0501071_0268774 | Ga0501071_0268774_535_1113 | 187 |
| 414 | 3300049589 | Ga0501073_0000321 | Ga0501073_0000321_25118_25825 | 187 |
| 415 | 3300049590 | Ga0501074_0000097 | Ga0501074_0000097_35265_35972 | 187 |
| 416 | 3300049741 | Ga0501079_0009081 | Ga0501079_0009081_2444_3151 | 187 |
| 417 | 3300049742 | Ga0501080_0011166 | Ga0501080_0011166_1693_2400 | 187 |
| 418 | 3300049744 | Ga0501083_0004051 | Ga0501083_0004051_3262_3969 | 187 |
| 419 | 3300049822 | Ga0501035_0157565 | Ga0501035_0157565_821_1528 | 187 |
| 420 | 3300050489 | nmdc:mga03683_93487_c1 | nmdc:mga03683_93487_c1_161_862 | 187 |
| 421 | 3300050491 | nmdc:mga00v17_5329_c1 | nmdc:mga00v17_5329_c1_4965_5666 | 187 |
| 422 | 3300050493 | nmdc:mga0k408_1928_c1 | nmdc:mga0k408_1928_c1_3608_4309 | 187 |
| 423 | 3300050507 | nmdc:mga05p37_27608_c1 | nmdc:mga05p37_27608_c1_6169_6771 | 187 |
| 424 | 3300050510 | nmdc:mga06r32_198902_c1 | nmdc:mga06r32_198902_c1_167_769 | 187 |
| 425 | 3300050511 | nmdc:mga08y16_17581_c1 | nmdc:mga08y16_17581_c1_2943_3545 | 187 |
| 426 | 3300050512 | nmdc:mga0n895_386018_c1 | nmdc:mga0n895_386018_c1_238_837 | 187 |
| 427 | 3300050513 | nmdc:mga0rr50_111313_c1 | nmdc:mga0rr50_111313_c1_1341_2081 | 187 |
| 428 | 3300050515 | nmdc:mga0a205_146054_c1 | nmdc:mga0a205_146054_c1_697_1296 | 187 |
| 429 | 3300050516 | nmdc:mga0sz30_1133_c1 | nmdc:mga0sz30_1133_c1_3696_4397 | 187 |
| 430 | 3300054114 | Ga0501084_0021259 | Ga0501084_0021259_4174_4881 | 187 |
| 431 | 3300060353 | Ga0501082_0072001 | Ga0501082_0072001_1360_2067 | 187 |
| 432 | 3300005331 | Ga0070670_100002726 | Ga0070670_10000272613 | 188 |
| 433 | 3300005436 | Ga0070713_100163538 | Ga0070713_1001635382 | 188 |
| 434 | 3300005445 | Ga0070708_100044414 | Ga0070708_1000444142 | 188 |
| 435 | 3300005467 | Ga0070706_100004600 | Ga0070706_10000460016 | 188 |
| 436 | 3300005471 | Ga0070698_100129739 | Ga0070698_1001297393 | 188 |
| 437 | 3300005518 | Ga0070699_100057447 | Ga0070699_1000574476 | 188 |
| 438 | 3300005518 | Ga0070699_100068029 | Ga0070699_1000680293 | 188 |
| 439 | 3300005518 | Ga0070699_100266738 | Ga0070699_1002667383 | 188 |
| 440 | 3300005536 | Ga0070697_100169968 | Ga0070697_1001699684 | 188 |
| 441 | 3300005937 | Ga0081455_10017464 | Ga0081455_1001746411 | 188 |
| 442 | 3300005937 | Ga0081455_10093962 | Ga0081455_100939624 | 188 |
| 443 | 3300005981 | Ga0081538_10001246 | Ga0081538_1000124629 | 188 |
| 444 | 3300006028 | Ga0070717_10075652 | Ga0070717_100756527 | 188 |
| 445 | 3300006175 | Ga0070712_100078635 | Ga0070712_1000786354 | 188 |
| 446 | 3300025903 | Ga0207680_10118155 | Ga0207680_101181551 | 188 |
| 447 | 3300025906 | Ga0207699_10069854 | Ga0207699_100698545 | 188 |
| 448 | 3300025910 | Ga0207684_10011106 | Ga0207684_100111066 | 188 |
| 449 | 3300025915 | Ga0207693_10043512 | Ga0207693_100435126 | 188 |
| 450 | 3300025915 | Ga0207693_10509639 | Ga0207693_105096391 | 188 |
| 451 | 3300025922 | Ga0207646_10363419 | Ga0207646_103634193 | 188 |
| 452 | 3300025928 | Ga0207700_10000001 | Ga0207700_1000000191 | 188 |
| 453 | 3300025929 | Ga0207664_10110540 | Ga0207664_101105404 | 188 |
| 454 | 3300025937 | Ga0207669_10077737 | Ga0207669_100777372 | 188 |
| 455 | 3300025939 | Ga0207665_10088164 | Ga0207665_100881644 | 188 |
| 456 | 3300025945 | Ga0207679_10513844 | Ga0207679_105138442 | 188 |
| 457 | 3300027907 | Ga0207428_10145127 | Ga0207428_101451273 | 188 |
| 458 | 3300035170 | Ga0373943_0110785 | Ga0373943_0110785_828_1433 | 188 |
| 459 | 3300035691 | Ga0373931_0079776 | Ga0373931_0079776_537_1142 | 188 |
| 460 | 3300035692 | Ga0373935_0479284 | Ga0373935_0479284_146_751 | 188 |
| 461 | 3300037418 | Ga0395900_0026290 | Ga0395900_0026290_740_1351 | 188 |
| 462 | 3300037418 | Ga0395900_0358545 | Ga0395900_0358545_406_984 | 188 |
| 463 | 3300037466 | Ga0395898_0016565 | Ga0395898_0016565_645_1256 | 188 |
| 464 | 3300037466 | Ga0395898_0104333 | Ga0395898_0104333_318_902 | 188 |
| 465 | 3300037466 | Ga0395898_0119192 | Ga0395898_0119192_1034_1612 | 188 |
| 466 | 3300037471 | Ga0395905_0027635 | Ga0395905_0027635_1482_2093 | 188 |
| 467 | 3300037471 | Ga0395905_0045213 | Ga0395905_0045213_871_1455 | 188 |
| 468 | 3300037471 | Ga0395905_0650156 | Ga0395905_0650156_226_804 | 188 |
| 469 | 3300038443 | Ga0395901_0072850 | Ga0395901_0072850_77_688 | 188 |
| 470 | 3300038443 | Ga0395901_0513691 | Ga0395901_0513691_450_1025 | 188 |
| 471 | 3300038443 | Ga0395901_0593873 | Ga0395901_0593873_226_831 | 188 |
| 472 | 3300042146 | Ga0450907_016895 | Ga0450907_016895_34_615 | 188 |
| 473 | 3300046459 | Ga0495629_0297317 | Ga0495629_0297317_78_659 | 188 |
| 474 | 3300046461 | Ga0495641_0050391 | Ga0495641_0050391_320_925 | 188 |
| 475 | 3300046473 | Ga0495582_0069503 | Ga0495582_0069503_617_1222 | 188 |
| 476 | 3300046473 | Ga0495582_0249321 | Ga0495582_0249321_374_955 | 188 |
| 477 | 3300046516 | Ga0495628_0000864 | Ga0495628_0000864_17776_18600 | 188 |
| 478 | 3300046518 | Ga0495631_0108437 | Ga0495631_0108437_424_1029 | 188 |
| 479 | 3300046615 | Ga0495656_0236034 | Ga0495656_0236034_215_820 | 188 |
| 480 | 3300046681 | Ga0495647_0044024 | Ga0495647_0044024_989_1594 | 188 |
| 481 | 3300046689 | Ga0495613_0179845 | Ga0495613_0179845_294_899 | 188 |
| 482 | 3300047321 | Ga0495676_0082052 | Ga0495676_0082052_949_1554 | 188 |
| 483 | 3300047322 | Ga0495680_0433016 | Ga0495680_0433016_283_864 | 188 |
| 484 | 3300048088 | Ga0495602_0003702 | Ga0495602_0003702_5759_6583 | 188 |
| 485 | 3300048904 | Ga0496101_0020085 | Ga0496101_0020085_3801_4406 | 188 |
| 486 | 3300048905 | Ga0496102_0113199 | Ga0496102_0113199_608_1213 | 188 |
| 487 | 3300048906 | Ga0496103_0180619 | Ga0496103_0180619_424_1029 | 188 |
| 488 | 3300048907 | Ga0496104_0036479 | Ga0496104_0036479_3365_3967 | 188 |
| 489 | 3300048907 | Ga0496104_0286930 | Ga0496104_0286930_349_954 | 188 |
| 490 | 3300048910 | Ga0496107_0085981 | Ga0496107_0085981_575_1180 | 188 |
| 491 | 3300048911 | Ga0496108_0030984 | Ga0496108_0030984_3783_4388 | 188 |
| 492 | 3300048912 | Ga0496109_0001046 | Ga0496109_0001046_2307_2912 | 188 |
| 493 | 3300048913 | Ga0496110_0023971 | Ga0496110_0023971_1873_2475 | 188 |
| 494 | 3300048914 | Ga0496111_0013650 | Ga0496111_0013650_899_1504 | 188 |
| 495 | 3300048914 | Ga0496111_0033779 | Ga0496111_0033779_2443_3045 | 188 |
| 496 | 3300048915 | Ga0496112_0020180 | Ga0496112_0020180_1896_2501 | 188 |
| 497 | 3300048916 | Ga0496113_0070012 | Ga0496113_0070012_650_1255 | 188 |
| 498 | 3300048917 | Ga0496114_0124403 | Ga0496114_0124403_626_1231 | 188 |
| 499 | 3300048918 | Ga0496115_0066743 | Ga0496115_0066743_44_649 | 188 |
| 500 | 3300049568 | Ga0501031_0088981 | Ga0501031_0088981_862_1443 | 188 |
| 501 | 3300049572 | Ga0501036_0030174 | Ga0501036_0030174_3802_4383 | 188 |
| 502 | 3300049573 | Ga0501037_0195276 | Ga0501037_0195276_832_1413 | 188 |
| 503 | 3300049577 | Ga0501041_0347148 | Ga0501041_0347148_43_624 | 188 |
| 504 | 3300049578 | Ga0501042_0080578 | Ga0501042_0080578_721_1302 | 188 |
| 505 | 3300049582 | Ga0501048_0045135 | Ga0501048_0045135_1771_2352 | 188 |
| 506 | 3300049587 | Ga0501071_0113761 | Ga0501071_0113761_129_710 | 188 |
| 507 | 3300049588 | Ga0501072_0028773 | Ga0501072_0028773_1352_1933 | 188 |
| 508 | 3300049591 | Ga0501075_0050657 | Ga0501075_0050657_1328_1909 | 188 |
| 509 | 3300049592 | Ga0501076_0045816 | Ga0501076_0045816_1903_2484 | 188 |
| 510 | 3300049741 | Ga0501079_0062866 | Ga0501079_0062866_1788_2369 | 188 |
| 511 | 3300049742 | Ga0501080_0145010 | Ga0501080_0145010_1379_1960 | 188 |
| 512 | 3300049743 | Ga0501081_0222270 | Ga0501081_0222270_368_949 | 188 |
| 513 | 3300049822 | Ga0501035_0219973 | Ga0501035_0219973_409_990 | 188 |
| 514 | 3300049823 | Ga0501044_1064687 | Ga0501044_1064687_15_596 | 188 |
| 515 | 3300050492 | nmdc:mga0yw44_3077_c1 | nmdc:mga0yw44_3077_c1_5876_6481 | 188 |
| 516 | 3300050507 | nmdc:mga05p37_19710_c1 | nmdc:mga05p37_19710_c1_5387_5992 | 188 |
| 517 | 3300050507 | nmdc:mga05p37_393889_c1 | nmdc:mga05p37_393889_c1_350_976 | 188 |
| 518 | 3300050511 | nmdc:mga08y16_170967_c1 | nmdc:mga08y16_170967_c1_1395_2000 | 188 |
| 519 | 3300050511 | nmdc:mga08y16_378054_c1 | nmdc:mga08y16_378054_c1_610_1185 | 188 |
| 520 | 3300050512 | nmdc:mga0n895_40300_c1 | nmdc:mga0n895_40300_c1_2743_3348 | 188 |
| 521 | 3300050512 | nmdc:mga0n895_45630_c1 | nmdc:mga0n895_45630_c1_2616_3242 | 188 |
| 522 | 3300050513 | nmdc:mga0rr50_1901_c1 | nmdc:mga0rr50_1901_c1_10368_10973 | 188 |
| 523 | 3300050514 | nmdc:mga08x19_14562_c1 | nmdc:mga08x19_14562_c1_2387_2992 | 188 |
| 524 | 3300050515 | nmdc:mga0a205_7331_c1 | nmdc:mga0a205_7331_c1_4655_5260 | 188 |
| 525 | 3300054114 | Ga0501084_0129594 | Ga0501084_0129594_1106_1687 | 188 |
| 526 | 3300060353 | Ga0501082_0073915 | Ga0501082_0073915_932_1513 | 188 |
| 527 | 3300061734 | Ga0530510_0056671 | Ga0530510_0056671_1437_2018 | 188 |
| 528 | 3300003203 | JGI25406J46586_10009512 | JGI25406J46586_100095123 | 189 |
| 529 | 3300005329 | Ga0070683_100314250 | Ga0070683_1003142503 | 189 |
| 530 | 3300005335 | Ga0070666_10042517 | Ga0070666_100425172 | 189 |
| 531 | 3300005347 | Ga0070668_100012868 | Ga0070668_1000128689 | 189 |
| 532 | 3300005367 | Ga0070667_100001611 | Ga0070667_10000161117 | 189 |
| 533 | 3300005618 | Ga0068864_100898083 | Ga0068864_1008980831 | 189 |
| 534 | 3300005842 | Ga0068858_100447954 | Ga0068858_1004479542 | 189 |
| 535 | 3300005843 | Ga0068860_100071954 | Ga0068860_1000719544 | 189 |
| 536 | 3300005844 | Ga0068862_100001247 | Ga0068862_10000124717 | 189 |
| 537 | 3300005937 | Ga0081455_10011092 | Ga0081455_100110928 | 189 |
| 538 | 3300005981 | Ga0081538_10022726 | Ga0081538_100227266 | 189 |
| 539 | 3300005981 | Ga0081538_10076379 | Ga0081538_100763793 | 189 |
| 540 | 3300005985 | Ga0081539_10014550 | Ga0081539_100145505 | 189 |
| 541 | 3300006846 | Ga0075430_100049708 | Ga0075430_1000497086 | 189 |
| 542 | 3300006847 | Ga0075431_100348704 | Ga0075431_1003487042 | 189 |
| 543 | 3300009553 | Ga0105249_10003640 | Ga0105249_1000364016 | 189 |
| 544 | 3300013296 | Ga0157374_10610582 | Ga0157374_106105822 | 189 |
| 545 | 3300014968 | Ga0157379_10035775 | Ga0157379_100357757 | 189 |
| 546 | 3300025321 | Ga0207656_10001578 | Ga0207656_100015788 | 189 |
| 547 | 3300025903 | Ga0207680_10054402 | Ga0207680_100544024 | 189 |
| 548 | 3300025904 | Ga0207647_10089936 | Ga0207647_100899363 | 189 |
| 549 | 3300025944 | Ga0207661_10426537 | Ga0207661_104265372 | 189 |
| 550 | 3300025961 | Ga0207712_10003459 | Ga0207712_100034596 | 189 |
| 551 | 3300025972 | Ga0207668_10002563 | Ga0207668_1000256313 | 189 |
| 552 | 3300025986 | Ga0207658_10000840 | Ga0207658_1000084021 | 189 |
| 553 | 3300028379 | Ga0268266_10001628 | Ga0268266_1000162821 | 189 |
| 554 | 3300028380 | Ga0268265_10000667 | Ga0268265_1000066736 | 189 |
| 555 | 3300028381 | Ga0268264_10431947 | Ga0268264_104319473 | 189 |
| 556 | 3300028563 | Ga0265319_1000030 | Ga0265319_100003046 | 189 |
| 557 | 3300028800 | Ga0265338_10000156 | Ga0265338_1000015646 | 189 |
| 558 | 3300029957 | Ga0265324_10039877 | Ga0265324_100398772 | 189 |
| 559 | 3300031241 | Ga0265325_10024792 | Ga0265325_100247924 | 189 |
| 560 | 3300031250 | Ga0265331_10044959 | Ga0265331_100449594 | 189 |
| 561 | 3300031595 | Ga0265313_10055372 | Ga0265313_100553724 | 189 |
| 562 | 3300031712 | Ga0265342_10074519 | Ga0265342_100745193 | 189 |
| 563 | 3300031731 | Ga0307405_10039831 | Ga0307405_100398314 | 189 |
| 564 | 3300031901 | Ga0307406_10125836 | Ga0307406_101258363 | 189 |
| 565 | 3300031901 | Ga0307406_10351973 | Ga0307406_103519732 | 189 |
| 566 | 3300031903 | Ga0307407_10926402 | Ga0307407_109264021 | 189 |
| 567 | 3300031995 | Ga0307409_100077068 | Ga0307409_1000770684 | 189 |
| 568 | 3300032002 | Ga0307416_100279359 | Ga0307416_1002793592 | 189 |
| 569 | 3300032004 | Ga0307414_10277386 | Ga0307414_102773862 | 189 |
| 570 | 3300032126 | Ga0307415_100036284 | Ga0307415_1000362844 | 189 |
| 571 | 3300045836 | Ga0466958_0014240 | Ga0466958_0014240_596_1396 | 189 |
| 572 | 3300046525 | Ga0495663_0058419 | Ga0495663_0058419_268_1056 | 189 |
| 573 | 3300046660 | Ga0495625_0000109 | Ga0495625_0000109_82859_83677 | 189 |
| 574 | 3300047320 | Ga0495672_0103504 | Ga0495672_0103504_760_1380 | 189 |
| 575 | 3300048913 | Ga0496110_0289792 | Ga0496110_0289792_244_1053 | 189 |
| 576 | 3300048921 | Ga0496118_0123676 | Ga0496118_0123676_480_1280 | 189 |
| 577 | 3300048929 | Ga0496126_0128675 | Ga0496126_0128675_33_833 | 189 |
| 578 | 3300049578 | Ga0501042_0035728 | Ga0501042_0035728_2007_2825 | 189 |
| 579 | 3300049586 | Ga0501070_0262614 | Ga0501070_0262614_685_1254 | 189 |
| 580 | 3300049588 | Ga0501072_0131588 | Ga0501072_0131588_87_854 | 189 |
| 581 | 3300049741 | Ga0501079_0033610 | Ga0501079_0033610_810_1577 | 189 |
| 582 | 3300050492 | nmdc:mga0yw44_157392_c1 | nmdc:mga0yw44_157392_c1_412_1173 | 189 |
| 583 | 3300050507 | nmdc:mga05p37_650826_c1 | nmdc:mga05p37_650826_c1_155_937 | 189 |
| 584 | 3300050509 | nmdc:mga0qj67_83118_c1 | nmdc:mga0qj67_83118_c1_911_1732 | 189 |
| 585 | 3300061734 | Ga0530510_0070582 | Ga0530510_0070582_1356_2123 | 189 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5ns3-assembly1.cif.gz_B | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9801 | 10 | 184 |
| 5ns3-assembly1.cif.gz_A | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9735 | 10 | 184 |
| 5ns4-assembly2.cif.gz_B | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9733 | 10 | 184 |
| 5ns4-assembly1.cif.gz_A | crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9731 | 10 | 184 |
| 5ns3-assembly1.cif.gz_B | crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna | 0.9593 | 10 | 184 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.9146 | 11 | 184 | 3.30.1440.10 |
| 4warF00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8951 | 11 | 184 | 3.30.1440.10 |
| af_P36519_120_288_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8777 | 33 | 184 | 3.30.1440.10 |
| 1jj2D00 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8769 | 33 | 165 | 3.30.1440.10 |
| af_A0A1D8PHY2_119_286_3.30.1440.10 | Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 | 0.8727 | 29 | 186 | 3.30.1440.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3N5Q500-F1-model_v4 | 50S ribosomal protein L5 | 0.9605 | 9 | 129 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-F8KQ75-F1-model_v4 | 50S ribosomal protein L5 | 0.9566 | 11 | 129 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A0N0I4K0-F1-model_v4 | deleted | 0.9554 | 10 | 165 |
|
| AF-A0A3B9SJT6-F1-model_v4 | 50S ribosomal protein L5 | 0.952 | 7 | 123 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A7X4AP54-F1-model_v4 | 50S ribosomal protein L5 | 0.9514 | 9 | 138 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar