F466503

General Info

Members Datasets Scaffolds Average Seq Length
585 296 585 198

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_650826_c1|nmdc:mga05p37_650826_c1_155_937
Length 232
Sequence MEASARAQVPPRLKERYEQEIAPSLQKRFGYKSAMEIPRLEKITLNMGVGDAKQDSNVLDAASEQLATIAGQAPNVRRARKSIAAFKLRDGMPVGVTVTLRRARMWEFFDRLTAIAIPRIRDFRGLNARSFDGRGNYSMGVREQIIFPEIDYDAIDQVRGLDVTITTSAKTDEEAYILLRELGMPFSPEGAPGFEQLKEENPEAYEAPVREEDEGGEGDDAAPAEDGDRGQA

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
62 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
69 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
79 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
86 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
87 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
100 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
101 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
164 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
165 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
166 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
167 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
170 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
171 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
172 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
173 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
174 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
179 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
192 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
200 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
201 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
204 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
205 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
206 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
207 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
214 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
215 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
222 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
228 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
229 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
249 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
250 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
263 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
264 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
265 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
266 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
267 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
268 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
269 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
275 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
276 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
279 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
285 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
286 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
289 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
294 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
295 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
296 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 5.13
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 0.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10009512 3300003203 Bacteria 4350
2 JGI25407J50210_10011363 3300003373 Bacteria 2275
3 Ga0065715_10147379 3300005293 Bacteria 1771
4 Ga0070658_10253392 3300005327 Bacteria 1493
5 Ga0070676_10037090 3300005328 Bacteria 2810
6 Ga0070683_100314250 3300005329 Bacteria 1491
7 Ga0070670_100002726 3300005331 Bacteria 14597
8 Ga0070670_100702187 3300005331 Bacteria 910
9 Ga0070677_10004529 3300005333 Bacteria 4536
10 Ga0068869_100165469 3300005334 Bacteria 1725
11 Ga0070666_10020483 3300005335 Bacteria 4275
12 Ga0070666_10042517 3300005335 Bacteria 3041
13 Ga0068868_100464117 3300005338 Bacteria 1103
14 Ga0070689_100018801 3300005340 Bacteria 5099
15 Ga0070689_100359837 3300005340 Bacteria 1222
16 Ga0070661_100114078 3300005344 Bacteria 2020
17 Ga0070668_100012868 3300005347 Bacteria 6228
18 Ga0070669_100102281 3300005353 Bacteria 2163
19 Ga0070675_100031032 3300005354 Bacteria 4318
20 Ga0070674_100014259 3300005356 Bacteria 4938
21 Ga0070674_100219712 3300005356 Bacteria 1477
22 Ga0070673_100066457 3300005364 Bacteria 2880
23 Ga0070673_100161776 3300005364 Bacteria 1904
24 Ga0070688_100062951 3300005365 Bacteria 2350
25 Ga0070688_100245927 3300005365 Bacteria 1272
26 Ga0070659_100097880 3300005366 Bacteria 2358
27 Ga0070667_100001611 3300005367 Bacteria 20202
28 Ga0070667_100048136 3300005367 Bacteria 3588
29 Ga0070667_100097551 3300005367 Bacteria 2535
30 Ga0070709_10015515 3300005434 Bacteria 4337
31 Ga0070714_100009500 3300005435 Bacteria 7649
32 Ga0070714_100039749 3300005435 Bacteria 3961
33 Ga0070714_100388700 3300005435 Bacteria 1316
34 Ga0070713_100001795 3300005436 Bacteria 13831
35 Ga0070713_100005685 3300005436 Bacteria 8558
36 Ga0070713_100163538 3300005436 Bacteria 1988
37 Ga0070713_100193708 3300005436 Bacteria 1833
38 Ga0070711_100380163 3300005439 Bacteria 1142
39 Ga0070700_100016206 3300005441 Bacteria 4243
40 Ga0070700_100088583 3300005441 Bacteria 2014
41 Ga0070694_100919813 3300005444 Bacteria 723
42 Ga0070708_100044414 3300005445 Bacteria 3907
43 Ga0070708_100270554 3300005445 Bacteria 1598
44 Ga0070678_100005141 3300005456 Bacteria 7516
45 Ga0070678_100006691 3300005456 Bacteria 6787
46 Ga0070678_100021374 3300005456 Bacteria 4266
47 Ga0070662_100031910 3300005457 Bacteria 3700
48 Ga0070681_10007099 3300005458 Bacteria 10907
49 Ga0070681_10010917 3300005458 Bacteria 8982
50 Ga0068867_100522388 3300005459 Bacteria 1024
51 Ga0070685_10036875 3300005466 Bacteria 2766
52 Ga0070685_10119525 3300005466 Bacteria 1634
53 Ga0070706_100004600 3300005467 Bacteria 13242
54 Ga0070707_100064367 3300005468 Bacteria 3521
55 Ga0070698_100129739 3300005471 Bacteria 2477
56 Ga0070698_100323539 3300005471 Bacteria 1473
57 Ga0070699_100057447 3300005518 Bacteria 3371
58 Ga0070699_100068029 3300005518 Bacteria 3093
59 Ga0070699_100146878 3300005518 Bacteria 2084
60 Ga0070699_100266738 3300005518 Bacteria 1532
61 Ga0070699_100866728 3300005518 Bacteria 827
62 Ga0070679_100085474 3300005530 Bacteria 3142
63 Ga0070684_100632454 3300005535 Bacteria 996
64 Ga0070697_100169968 3300005536 Bacteria 1844
65 Ga0068853_100031768 3300005539 Bacteria 4468
66 Ga0070672_100005015 3300005543 Bacteria 8727
67 Ga0070686_100067971 3300005544 Bacteria 2323
68 Ga0070693_100037693 3300005547 Bacteria 2697
69 Ga0070665_100009861 3300005548 Bacteria 9655
70 Ga0070665_100022127 3300005548 Bacteria 6394
71 Ga0070665_100243577 3300005548 Bacteria 1798
72 Ga0070704_100407482 3300005549 Bacteria 1162
73 Ga0068855_100056659 3300005563 Bacteria 4598
74 Ga0068855_100375706 3300005563 Bacteria 1561
75 Ga0068855_101123421 3300005563 Bacteria 820
76 Ga0068857_100012217 3300005577 Bacteria 7470
77 Ga0068854_100729252 3300005578 Bacteria 858
78 Ga0070702_100012107 3300005615 Bacteria 4310
79 Ga0068852_100428745 3300005616 Bacteria 1305
80 Ga0068859_100046188 3300005617 Bacteria 4374
81 Ga0068859_100130549 3300005617 Bacteria 2584
82 Ga0068859_100647831 3300005617 Bacteria 1148
83 Ga0068864_100116524 3300005618 Bacteria 2384
84 Ga0068864_100898083 3300005618 Bacteria 875
85 Ga0068861_100208882 3300005719 Bacteria 1643
86 Ga0068861_100230782 3300005719 Bacteria 1569
87 Ga0068861_100334365 3300005719 Bacteria 1323
88 Ga0068861_100336057 3300005719 Bacteria 1321
89 Ga0068861_100985067 3300005719 Bacteria 804
90 Ga0068851_10031533 3300005834 Bacteria 2633
91 Ga0068851_10176404 3300005834 Bacteria 1182
92 Ga0068870_10209898 3300005840 Bacteria 1185
93 Ga0068863_100514679 3300005841 Bacteria 1179
94 Ga0068858_100447954 3300005842 Bacteria 1244
95 Ga0068858_100744003 3300005842 Bacteria 955
96 Ga0068860_100071954 3300005843 Bacteria 3285
97 Ga0068860_100170761 3300005843 Bacteria 2100
98 Ga0068862_100001247 3300005844 Bacteria 23931
99 Ga0081455_10006416 3300005937 Bacteria 12613
100 Ga0081455_10011092 3300005937 Bacteria 9072
101 Ga0081455_10017464 3300005937 Bacteria 6876
102 Ga0081455_10019985 3300005937 Bacteria 6322
103 Ga0081455_10093962 3300005937 Bacteria 2423
104 Ga0081455_10165120 3300005937 Bacteria 1693
105 Ga0081538_10001246 3300005981 Bacteria 26599
106 Ga0081538_10008306 3300005981 Bacteria 8839
107 Ga0081538_10022726 3300005981 Bacteria 4534
108 Ga0081538_10026960 3300005981 Bacteria 3999
109 Ga0081538_10076379 3300005981 Bacteria 1811
110 Ga0081539_10014550 3300005985 Bacteria 5808
111 Ga0070717_10062172 3300006028 Bacteria 3096
112 Ga0070717_10075652 3300006028 Bacteria 2816
113 Ga0075432_10034224 3300006058 Bacteria 1764
114 Ga0070716_100003910 3300006173 Bacteria 7076
115 Ga0070716_100272621 3300006173 Bacteria 1163
116 Ga0070712_100044366 3300006175 Bacteria 3065
117 Ga0070712_100078635 3300006175 Bacteria 2381
118 Ga0075366_10007118 3300006195 Bacteria 6159
119 Ga0075366_10016904 3300006195 Bacteria 4193
120 Ga0097621_100180965 3300006237 Bacteria 1821
121 Ga0097621_100204046 3300006237 Bacteria 1717
122 Ga0068871_100066382 3300006358 Bacteria 2957
123 Ga0068871_100092374 3300006358 Bacteria 2524
124 Ga0068871_100111438 3300006358 Bacteria 2302
125 Ga0068871_100340751 3300006358 Bacteria 1324
126 Ga0075428_100132743 3300006844 Bacteria 2708
127 Ga0075428_100236127 3300006844 Bacteria 1973
128 Ga0075430_100049708 3300006846 Bacteria 3539
129 Ga0075431_100075040 3300006847 Bacteria 3489
130 Ga0075431_100348704 3300006847 Bacteria 1489
131 Ga0075434_100036821 3300006871 Bacteria 4840
132 Ga0075434_100239451 3300006871 Bacteria 1835
133 Ga0075434_100279007 3300006871 Bacteria 1690
134 Ga0075434_100716553 3300006871 Bacteria 1018
135 Ga0068865_100285339 3300006881 Bacteria 1316
136 Ga0075436_100000862 3300006914 Bacteria 20155
137 Ga0075436_100018705 3300006914 Bacteria 4743
138 Ga0097620_100046188 3300006931 Bacteria 4374
139 Ga0097620_100130553 3300006931 Bacteria 2584
140 Ga0097620_100253646 3300006931 Bacteria 1850
141 Ga0097620_100647835 3300006931 Bacteria 1148
142 Ga0075435_100120900 3300007076 Bacteria 2185
143 Ga0105240_10152833 3300009093 Bacteria 2747
144 Ga0105240_10252783 3300009093 Bacteria 2037
145 Ga0111539_10019077 3300009094 Bacteria 8474
146 Ga0111539_10021781 3300009094 Bacteria 7879
147 Ga0111539_10342356 3300009094 Bacteria 1741
148 Ga0111539_10404617 3300009094 Bacteria 1590
149 Ga0111539_10690104 3300009094 Bacteria 1189
150 Ga0105245_10040665 3300009098 Bacteria 4143
151 Ga0105243_10035000 3300009148 Bacteria 3892
152 Ga0105243_10245165 3300009148 Bacteria 1596
153 Ga0105242_10009166 3300009176 Bacteria 7598
154 Ga0105242_10046503 3300009176 Bacteria 3521
155 Ga0105242_10716019 3300009176 Bacteria 981
156 Ga0105248_10118027 3300009177 Bacteria 2992
157 Ga0105248_10123110 3300009177 Bacteria 2926
158 Ga0105248_10627912 3300009177 Bacteria 1212
159 Ga0105238_10087095 3300009551 Bacteria 3110
160 Ga0105249_10003640 3300009553 Bacteria 13325
161 Ga0105249_10363778 3300009553 Bacteria 1469
162 Ga0099796_10005277 3300010159 Bacteria 3211
163 Ga0105239_10270107 3300010375 Bacteria 1913
164 Ga0105246_10260205 3300011119 Bacteria 1382
165 Ga0157370_10090984 3300013104 Bacteria 2865
166 Ga0157369_10006334 3300013105 Bacteria 13736
167 Ga0157374_10054005 3300013296 Bacteria 3747
168 Ga0157374_10138530 3300013296 Bacteria 2361
169 Ga0157374_10610582 3300013296 Bacteria 1101
170 Ga0157378_10043237 3300013297 Bacteria 4000
171 Ga0157378_10059479 3300013297 Bacteria 3409
172 Ga0157378_10096241 3300013297 Bacteria 2698
173 Ga0157378_10124450 3300013297 Bacteria 2381
174 Ga0157378_10153148 3300013297 Bacteria 2149
175 Ga0157378_10694815 3300013297 Bacteria 1036
176 Ga0163162_10086874 3300013306 Bacteria 3205
177 Ga0163162_10278343 3300013306 Bacteria 1805
178 Ga0163162_10446724 3300013306 Bacteria 1425
179 Ga0157372_10202803 3300013307 Bacteria 2298
180 Ga0157375_10173624 3300013308 Bacteria 2304
181 Ga0157375_11155259 3300013308 Bacteria 907
182 Ga0157375_11753018 3300013308 Bacteria 736
183 Ga0163163_10278391 3300014325 Bacteria 1724
184 Ga0163163_10377128 3300014325 Bacteria 1476
185 Ga0157380_10026469 3300014326 Bacteria 4403
186 Ga0157377_10014255 3300014745 Bacteria 4041
187 Ga0157377_10172095 3300014745 Bacteria 1355
188 Ga0157379_10035775 3300014968 Bacteria 4428
189 Ga0157379_10079870 3300014968 Bacteria 2930
190 Ga0157376_10501861 3300014969 Bacteria 1193
191 Ga0163161_10045011 3300017792 Bacteria 3181
192 Ga0207697_10001157 3300025315 Bacteria 14504
193 Ga0207656_10001578 3300025321 Bacteria 7582
194 Ga0207656_10019865 3300025321 Bacteria 2662
195 Ga0207682_10006357 3300025893 Bacteria 4766
196 Ga0207682_10055309 3300025893 Bacteria 1650
197 Ga0207692_10395199 3300025898 Bacteria 861
198 Ga0207688_10002803 3300025901 Bacteria 9458
199 Ga0207688_10040537 3300025901 Bacteria 2588
200 Ga0207680_10054402 3300025903 Bacteria 2407
201 Ga0207680_10067863 3300025903 Bacteria 2198
202 Ga0207680_10118155 3300025903 Bacteria 1730
203 Ga0207647_10089936 3300025904 Bacteria 1832
204 Ga0207699_10069854 3300025906 Bacteria 2143
205 Ga0207645_10004332 3300025907 Bacteria 10510
206 Ga0207645_10250537 3300025907 Bacteria 1171
207 Ga0207643_10001343 3300025908 Bacteria 14235
208 Ga0207705_10172434 3300025909 Bacteria 1629
209 Ga0207705_10230349 3300025909 Bacteria 1409
210 Ga0207684_10011106 3300025910 Bacteria 7885
211 Ga0207654_10015846 3300025911 Bacteria 3918
212 Ga0207707_10005674 3300025912 Bacteria 10922
213 Ga0207707_10015921 3300025912 Bacteria 6559
214 Ga0207707_10192474 3300025912 Bacteria 1779
215 Ga0207695_10045231 3300025913 Bacteria 4675
216 Ga0207695_10725986 3300025913 Bacteria 874
217 Ga0207693_10043512 3300025915 Bacteria 3533
218 Ga0207693_10096919 3300025915 Bacteria 2313
219 Ga0207693_10304066 3300025915 Bacteria 1249
220 Ga0207693_10509639 3300025915 Bacteria 939
221 Ga0207663_10045973 3300025916 Bacteria 2688
222 Ga0207663_10050037 3300025916 Bacteria 2595
223 Ga0207662_10050088 3300025918 Bacteria 2480
224 Ga0207662_10073771 3300025918 Bacteria 2070
225 Ga0207657_10109580 3300025919 Bacteria 2282
226 Ga0207649_10101163 3300025920 Bacteria 1908
227 Ga0207652_10155677 3300025921 Bacteria 2047
228 Ga0207652_10258193 3300025921 Bacteria 1572
229 Ga0207652_10287808 3300025921 Bacteria 1483
230 Ga0207646_10027133 3300025922 Bacteria 5222
231 Ga0207646_10363419 3300025922 Bacteria 1307
232 Ga0207694_10007098 3300025924 Bacteria 8511
233 Ga0207659_10001704 3300025926 Bacteria 13045
234 Ga0207687_10165671 3300025927 Bacteria 1700
235 Ga0207687_10194600 3300025927 Bacteria 1581
236 Ga0207700_10000001 3300025928 Bacteria 1122509
237 Ga0207700_10003066 3300025928 Bacteria 9646
238 Ga0207700_10445848 3300025928 Bacteria 1140
239 Ga0207664_10007010 3300025929 Bacteria 7803
240 Ga0207664_10110540 3300025929 Bacteria 2285
241 Ga0207664_10426798 3300025929 Bacteria 1181
242 Ga0207644_10136885 3300025931 Bacteria 1881
243 Ga0207706_10006693 3300025933 Bacteria 10657
244 Ga0207686_10018577 3300025934 Bacteria 3939
245 Ga0207686_10237938 3300025934 Bacteria 1323
246 Ga0207670_10146182 3300025936 Bacteria 1748
247 Ga0207669_10065481 3300025937 Bacteria 2254
248 Ga0207669_10077737 3300025937 Bacteria 2112
249 Ga0207704_10108464 3300025938 Bacteria 1870
250 Ga0207704_10270843 3300025938 Bacteria 1286
251 Ga0207704_10370622 3300025938 Bacteria 1121
252 Ga0207665_10088164 3300025939 Bacteria 2146
253 Ga0207665_10088305 3300025939 Bacteria 2145
254 Ga0207691_10008862 3300025940 Bacteria 9656
255 Ga0207691_10010153 3300025940 Bacteria 9035
256 Ga0207691_10035592 3300025940 Bacteria 4620
257 Ga0207711_10084852 3300025941 Bacteria 2773
258 Ga0207711_10091045 3300025941 Bacteria 2682
259 Ga0207711_10122120 3300025941 Bacteria 2327
260 Ga0207689_10008334 3300025942 Bacteria 9029
261 Ga0207689_10046684 3300025942 Bacteria 3579
262 Ga0207689_10181155 3300025942 Bacteria 1737
263 Ga0207661_10260052 3300025944 Bacteria 1546
264 Ga0207661_10426537 3300025944 Bacteria 1205
265 Ga0207679_10513844 3300025945 Bacteria 1070
266 Ga0207667_10019150 3300025949 Bacteria 7654
267 Ga0207667_10223167 3300025949 Bacteria 1931
268 Ga0207651_10184977 3300025960 Bacteria 1656
269 Ga0207651_10251978 3300025960 Bacteria 1445
270 Ga0207651_10367236 3300025960 Bacteria 1216
271 Ga0207712_10003459 3300025961 Bacteria 9970
272 Ga0207712_10104420 3300025961 Bacteria 2113
273 Ga0207668_10002563 3300025972 Bacteria 10620
274 Ga0207668_10073886 3300025972 Bacteria 2445
275 Ga0207668_10122678 3300025972 Bacteria 1970
276 Ga0207640_10618427 3300025981 Bacteria 919
277 Ga0207658_10000840 3300025986 Bacteria 25652
278 Ga0207658_10030611 3300025986 Bacteria 3813
279 Ga0207703_10586810 3300026035 Bacteria 1053
280 Ga0207639_10323530 3300026041 Bacteria 1370
281 Ga0207708_10005800 3300026075 Bacteria 9127
282 Ga0207702_10140039 3300026078 Bacteria 2188
283 Ga0207641_10078861 3300026088 Bacteria 2853
284 Ga0207648_10008905 3300026089 Bacteria 9661
285 Ga0207676_10018878 3300026095 Bacteria 5020
286 Ga0207676_10527716 3300026095 Bacteria 1125
287 Ga0207676_10759764 3300026095 Bacteria 943
288 Ga0207674_10022377 3300026116 Bacteria 6788
289 Ga0207674_10058297 3300026116 Bacteria 3912
290 Ga0207675_100006269 3300026118 Bacteria 11287
291 Ga0207675_100125589 3300026118 Bacteria 2430
292 Ga0207683_10007403 3300026121 Bacteria 9411
293 Ga0207683_10008690 3300026121 Bacteria 8684
294 Ga0207698_10025800 3300026142 Bacteria 4147
295 Ga0207698_10214366 3300026142 Bacteria 1735
296 Ga0207698_10767346 3300026142 Bacteria 964
297 Ga0207428_10007467 3300027907 Bacteria 9965
298 Ga0207428_10145127 3300027907 Bacteria 1809
299 Ga0207428_10236826 3300027907 Bacteria 1365
300 Ga0268266_10001628 3300028379 Bacteria 26120
301 Ga0268266_10006169 3300028379 Bacteria 11019
302 Ga0268266_10380414 3300028379 Bacteria 1331
303 Ga0268265_10000667 3300028380 Bacteria 34047
304 Ga0268265_10247238 3300028380 Bacteria 1577
305 Ga0268264_10431947 3300028381 Bacteria 1272
306 Ga0265337_1037670 3300028556 Bacteria 1406
307 Ga0265319_1000030 3300028563 Bacteria 129742
308 Ga0265319_1001800 3300028563 Bacteria 12257
309 Ga0265334_10015907 3300028573 Bacteria 3119
310 Ga0265318_10002940 3300028577 Bacteria 8845
311 Ga0265318_10004027 3300028577 Bacteria 7219
312 Ga0265318_10030930 3300028577 Bacteria 2079
313 Ga0265322_10015941 3300028654 Bacteria 2169
314 Ga0265338_10000156 3300028800 Bacteria 125065
315 Ga0265338_10006510 3300028800 Bacteria 14847
316 Ga0265338_10017394 3300028800 Bacteria 7751
317 Ga0265338_10154817 3300028800 Bacteria 1777
318 Ga0265324_10039877 3300029957 Bacteria 1628
319 Ga0265332_10002675 3300031238 Bacteria 8936
320 Ga0265328_10035883 3300031239 Bacteria 1833
321 Ga0265320_10033040 3300031240 Bacteria 2644
322 Ga0265320_10046676 3300031240 Bacteria 2121
323 Ga0265325_10024792 3300031241 Bacteria 3259
324 Ga0265325_10074450 3300031241 Bacteria 1698
325 Ga0265329_10005644 3300031242 Bacteria 5034
326 Ga0265329_10023036 3300031242 Bacteria 2078
327 Ga0265340_10018011 3300031247 Bacteria 3651
328 Ga0265339_10118988 3300031249 Bacteria 1359
329 Ga0265331_10004043 3300031250 Bacteria 9240
330 Ga0265331_10044959 3300031250 Bacteria 2133
331 Ga0265327_10001971 3300031251 Bacteria 23393
332 Ga0265327_10006243 3300031251 Bacteria 9601
333 Ga0265327_10060671 3300031251 Bacteria 1932
334 Ga0265327_10210607 3300031251 Bacteria 877
335 Ga0265316_10009161 3300031344 Bacteria 9121
336 Ga0265316_10029265 3300031344 Bacteria 4531
337 Ga0265313_10055372 3300031595 Bacteria 1879
338 Ga0265314_10000765 3300031711 Bacteria 38412
339 Ga0265314_10006724 3300031711 Bacteria 10096
340 Ga0265342_10011897 3300031712 Bacteria 5920
341 Ga0265342_10065682 3300031712 Bacteria 2125
342 Ga0265342_10074519 3300031712 Bacteria 1972
343 Ga0307405_10005729 3300031731 Bacteria 6033
344 Ga0307405_10039831 3300031731 Bacteria 2843
345 Ga0307406_10125836 3300031901 Bacteria 1790
346 Ga0307406_10351973 3300031901 Bacteria 1151
347 Ga0307407_10926402 3300031903 Bacteria 670
348 Ga0307409_100077068 3300031995 Bacteria 2676
349 Ga0307416_100279359 3300032002 Bacteria 1645
350 Ga0307414_10277386 3300032004 Bacteria 1407
351 Ga0307415_100036284 3300032126 Bacteria 3228
352 Ga0316586_1026237 3300033527 Bacteria 983
353 Ga0373951_0151774 3300035091 Bacteria 650
354 Ga0373943_0110785 3300035170 Bacteria 1448
355 Ga0373931_0079776 3300035691 Bacteria 1804
356 Ga0373935_0450985 3300035692 Bacteria 929
357 Ga0373935_0479284 3300035692 Bacteria 901
358 Ga0395899_0013274 3300037312 Bacteria 6304
359 Ga0395899_0054068 3300037312 Bacteria 2972
360 Ga0395899_0182217 3300037312 Bacteria 1474
361 Ga0395900_0005930 3300037418 Bacteria 12755
362 Ga0395900_0008939 3300037418 Bacteria 10272
363 Ga0395900_0013779 3300037418 Bacteria 8252
364 Ga0395900_0026290 3300037418 Bacteria 5960
365 Ga0395900_0034072 3300037418 Bacteria 5242
366 Ga0395900_0358545 3300037418 Bacteria 1430
367 Ga0395898_0016565 3300037466 Bacteria 7535
368 Ga0395898_0025218 3300037466 Bacteria 5994
369 Ga0395898_0026248 3300037466 Bacteria 5864
370 Ga0395898_0104333 3300037466 Bacteria 2719
371 Ga0395898_0119192 3300037466 Bacteria 2528
372 Ga0395905_0000698 3300037471 Bacteria 44490
373 Ga0395905_0012695 3300037471 Bacteria 8103
374 Ga0395905_0027635 3300037471 Bacteria 5350
375 Ga0395905_0045213 3300037471 Bacteria 4130
376 Ga0395905_0048048 3300037471 Bacteria 3999
377 Ga0395905_0323818 3300037471 Bacteria 1431
378 Ga0395905_0650156 3300037471 Bacteria 956
379 Ga0395901_0000608 3300038443 Bacteria 41717
380 Ga0395901_0005869 3300038443 Bacteria 12423
381 Ga0395901_0009856 3300038443 Bacteria 9683
382 Ga0395901_0033769 3300038443 Bacteria 5283
383 Ga0395901_0072850 3300038443 Bacteria 3581
384 Ga0395901_0513691 3300038443 Bacteria 1218
385 Ga0395901_0593873 3300038443 Bacteria 1117
386 Ga0436363_0498253 3300039450 Bacteria 9613
387 Ga0439439_0040867 3300041406 Bacteria 1201
388 Ga0451853_3403525 3300041512 Bacteria 1091
389 Ga0439441_043107 3300042001 Bacteria 910
390 Ga0439432_170637 3300042006 Bacteria 635
391 Ga0450907_016895 3300042146 Bacteria 1217
392 Ga0439446_0004585 3300042156 Bacteria 3505
393 Ga0466965_0080401 3300044683 Bacteria 1647
394 Ga0466963_0432990 3300044694 Bacteria 928
395 Ga0466964_0004587 3300044706 Bacteria 5108
396 Ga0466958_0014240 3300045836 Bacteria 4541
397 Ga0466967_0005405 3300045976 Bacteria 8847
398 Ga0495629_0297317 3300046459 Bacteria 1106
399 Ga0495641_0050391 3300046461 Bacteria 1903
400 Ga0495580_0178884 3300046472 Bacteria 1465
401 Ga0495582_0069503 3300046473 Bacteria 1947
402 Ga0495582_0249321 3300046473 Bacteria 1018
403 Ga0495608_0037016 3300046511 Bacteria 3282
404 Ga0495628_0000864 3300046516 Bacteria 28036
405 Ga0495631_0108437 3300046518 Bacteria 1194
406 Ga0495663_0058419 3300046525 Bacteria 1209
407 Ga0495652_0311155 3300046529 Bacteria 1141
408 Ga0495598_0011640 3300046537 Bacteria 2139
409 Ga0495598_0020881 3300046537 Bacteria 1735
410 Ga0495621_0003232 3300046539 Bacteria 4478
411 Ga0495621_0007620 3300046539 Bacteria 3213
412 Ga0495656_0236034 3300046615 Bacteria 919
413 Ga0495625_0000109 3300046660 Bacteria 125064
414 Ga0495647_0044024 3300046681 Bacteria 1710
415 Ga0495658_0253694 3300046683 Bacteria 1107
416 Ga0495613_0179845 3300046689 Bacteria 1498
417 Ga0495589_0405885 3300046794 Bacteria 625
418 Ga0495672_0103504 3300047320 Bacteria 1540
419 Ga0495676_0082052 3300047321 Bacteria 2441
420 Ga0495680_0433016 3300047322 Bacteria 903
421 Ga0495602_0003702 3300048088 Bacteria 15861
422 Ga0496101_0020085 3300048904 Bacteria 4568
423 Ga0496102_0113199 3300048905 Bacteria 2531
424 Ga0496103_0180619 3300048906 Bacteria 1356
425 Ga0496104_0004171 3300048907 Bacteria 12543
426 Ga0496104_0036479 3300048907 Bacteria 4597
427 Ga0496104_0144557 3300048907 Bacteria 2284
428 Ga0496104_0286930 3300048907 Bacteria 1558
429 Ga0496104_0313047 3300048907 Bacteria 1483
430 Ga0496105_0073103 3300048908 Bacteria 2833
431 Ga0496106_0203026 3300048909 Bacteria 1578
432 Ga0496106_0869023 3300048909 Bacteria 713
433 Ga0496107_0085981 3300048910 Bacteria 2295
434 Ga0496108_0030984 3300048911 Bacteria 4433
435 Ga0496109_0001046 3300048912 Bacteria 22890
436 Ga0496109_0409228 3300048912 Bacteria 1282
437 Ga0496109_0478288 3300048912 Bacteria 1176
438 Ga0496109_0858826 3300048912 Bacteria 845
439 Ga0496109_0863305 3300048912 Bacteria 843
440 Ga0496110_0023971 3300048913 Bacteria 5197
441 Ga0496110_0044560 3300048913 Bacteria 3874
442 Ga0496110_0289792 3300048913 Bacteria 1491
443 Ga0496110_0807903 3300048913 Bacteria 842
444 Ga0496111_0013650 3300048914 Bacteria 5534
445 Ga0496111_0033779 3300048914 Bacteria 3649
446 Ga0496111_0116205 3300048914 Bacteria 1973
447 Ga0496112_0020180 3300048915 Bacteria 6311
448 Ga0496113_0070012 3300048916 Bacteria 2665
449 Ga0496113_0558675 3300048916 Bacteria 918
450 Ga0496114_0124403 3300048917 Bacteria 2221
451 Ga0496115_0066743 3300048918 Bacteria 2908
452 Ga0496118_0123676 3300048921 Bacteria 1680
453 Ga0496126_0128675 3300048929 Bacteria 2190
454 Ga0501031_0088981 3300049568 Bacteria 2013
455 Ga0501032_0078142 3300049569 Bacteria 2203
456 Ga0501033_0239283 3300049570 Bacteria 1288
457 Ga0501036_0030174 3300049572 Bacteria 4581
458 Ga0501036_0261058 3300049572 Bacteria 1451
459 Ga0501036_0370468 3300049572 Bacteria 1195
460 Ga0501037_0195276 3300049573 Bacteria 1432
461 Ga0501038_0064358 3300049574 Bacteria 3127
462 Ga0501039_0074777 3300049575 Bacteria 2633
463 Ga0501039_0099046 3300049575 Bacteria 2275
464 Ga0501040_0273674 3300049576 Bacteria 1206
465 Ga0501041_0165312 3300049577 Bacteria 1384
466 Ga0501041_0239829 3300049577 Bacteria 1139
467 Ga0501041_0347148 3300049577 Bacteria 937
468 Ga0501042_0035728 3300049578 Bacteria 3525
469 Ga0501042_0080578 3300049578 Bacteria 2332
470 Ga0501047_0040997 3300049581 Bacteria 4475
471 Ga0501047_0229954 3300049581 Bacteria 1708
472 Ga0501048_0045135 3300049582 Bacteria 3149
473 Ga0501048_0114451 3300049582 Bacteria 1905
474 Ga0501048_0681164 3300049582 Bacteria 738
475 Ga0501067_0007685 3300049583 Bacteria 5996
476 Ga0501069_0001064 3300049585 Bacteria 13167
477 Ga0501069_0135705 3300049585 Bacteria 1410
478 Ga0501069_0163824 3300049585 Bacteria 1281
479 Ga0501070_0001356 3300049586 Bacteria 21938
480 Ga0501070_0262614 3300049586 Bacteria 1411
481 Ga0501071_0005936 3300049587 Bacteria 7901
482 Ga0501071_0113761 3300049587 Bacteria 2001
483 Ga0501071_0225069 3300049587 Bacteria 1412
484 Ga0501071_0268774 3300049587 Bacteria 1289
485 Ga0501071_0295470 3300049587 Bacteria 1227
486 Ga0501071_0552800 3300049587 Bacteria 884
487 Ga0501071_0568526 3300049587 Bacteria 871
488 Ga0501072_0028773 3300049588 Bacteria 4338
489 Ga0501072_0131588 3300049588 Bacteria 1994
490 Ga0501072_0176075 3300049588 Bacteria 1706
491 Ga0501073_0000321 3300049589 Bacteria 32033
492 Ga0501073_0008056 3300049589 Bacteria 7819
493 Ga0501073_0234408 3300049589 Bacteria 1268
494 Ga0501074_0000097 3300049590 Bacteria 42311
495 Ga0501074_0486723 3300049590 Bacteria 874
496 Ga0501075_0024398 3300049591 Bacteria 4434
497 Ga0501075_0050657 3300049591 Bacteria 3121
498 Ga0501075_0059923 3300049591 Bacteria 2868
499 Ga0501075_0177394 3300049591 Bacteria 1626
500 Ga0501076_0044620 3300049592 Bacteria 3496
501 Ga0501076_0045816 3300049592 Bacteria 3453
502 Ga0501076_0047645 3300049592 Bacteria 3389
503 Ga0501076_0201287 3300049592 Bacteria 1626
504 Ga0501076_0243582 3300049592 Bacteria 1471
505 Ga0501076_0409028 3300049592 Bacteria 1116
506 Ga0501077_0082333 3300049593 Bacteria 2039
507 Ga0501077_0224189 3300049593 Bacteria 1195
508 Ga0501079_0009081 3300049741 Bacteria 7529
509 Ga0501079_0033610 3300049741 Bacteria 3945
510 Ga0501079_0039713 3300049741 Bacteria 3630
511 Ga0501079_0062866 3300049741 Bacteria 2863
512 Ga0501079_0090710 3300049741 Bacteria 2368
513 Ga0501079_0241649 3300049741 Bacteria 1411
514 Ga0501079_0291398 3300049741 Bacteria 1276
515 Ga0501080_0001428 3300049742 Bacteria 20060
516 Ga0501080_0011166 3300049742 Bacteria 8223
517 Ga0501080_0145010 3300049742 Bacteria 2195
518 Ga0501080_0192882 3300049742 Bacteria 1872
519 Ga0501080_0386668 3300049742 Bacteria 1260
520 Ga0501080_0733350 3300049742 Bacteria 870
521 Ga0501081_0017769 3300049743 Bacteria 4713
522 Ga0501081_0031168 3300049743 Bacteria 3613
523 Ga0501081_0222270 3300049743 Bacteria 1373
524 Ga0501081_0405089 3300049743 Bacteria 1010
525 Ga0501083_0004051 3300049744 Bacteria 10308
526 Ga0501035_0123252 3300049822 Bacteria 2264
527 Ga0501035_0157565 3300049822 Bacteria 1967
528 Ga0501035_0219973 3300049822 Bacteria 1622
529 Ga0501035_0854993 3300049822 Bacteria 723
530 Ga0501044_0217134 3300049823 Bacteria 1864
531 Ga0501044_1064687 3300049823 Bacteria 679
532 Ga0501045_0077628 3300049824 Bacteria 2447
533 Ga0501045_0236958 3300049824 Bacteria 1358
534 Ga0501045_0257870 3300049824 Bacteria 1298
535 Ga0501045_0363386 3300049824 Bacteria 1077
536 nmdc:mga03683_93487_c1 3300050489 Bacteria 1313
537 nmdc:mga00v17_5329_c1 3300050491 Bacteria 6775
538 nmdc:mga0yw44_157392_c1 3300050492 Bacteria 1485
539 nmdc:mga0yw44_3077_c1 3300050492 Bacteria 7306
540 nmdc:mga0yw44_36915_c1 3300050492 Bacteria 2882
541 nmdc:mga0k408_13809_c1 3300050493 Bacteria 4436
542 nmdc:mga0k408_1928_c1 3300050493 Bacteria 11118
543 nmdc:mga05p37_19710_c1 3300050507 Bacteria 8160
544 nmdc:mga05p37_27608_c1 3300050507 Bacteria 6913
545 nmdc:mga05p37_393889_c1 3300050507 Bacteria 1619
546 nmdc:mga05p37_650826_c1 3300050507 Bacteria 1180
547 nmdc:mga05p37_788941_c1 3300050507 Bacteria 1041
548 nmdc:mga09592_133603_c1 3300050508 Bacteria 2136
549 nmdc:mga0qj67_83118_c1 3300050509 Bacteria 2567
550 nmdc:mga06r32_198902_c1 3300050510 Bacteria 1992
551 nmdc:mga08y16_11064_c1 3300050511 Bacteria 9474
552 nmdc:mga08y16_170967_c1 3300050511 Bacteria 2257
553 nmdc:mga08y16_17581_c1 3300050511 Bacteria 7532
554 nmdc:mga08y16_374461_c1 3300050511 Bacteria 1460
555 nmdc:mga08y16_378054_c1 3300050511 Bacteria 1452
556 nmdc:mga08y16_81215_c1 3300050511 Bacteria 3380
557 nmdc:mga0n895_149141_c1 3300050512 Bacteria 2368
558 nmdc:mga0n895_158049_c1 3300050512 Bacteria 2298
559 nmdc:mga0n895_386018_c1 3300050512 Bacteria 1417
560 nmdc:mga0n895_40300_c1 3300050512 Bacteria 4537
561 nmdc:mga0n895_45630_c1 3300050512 Bacteria 4277
562 nmdc:mga0n895_512190_c1 3300050512 Bacteria 1208
563 nmdc:mga0rr50_111313_c1 3300050513 Bacteria 2167
564 nmdc:mga0rr50_1901_c1 3300050513 Bacteria 11593
565 nmdc:mga08x19_14562_c1 3300050514 Bacteria 4771
566 nmdc:mga08x19_2026_c1 3300050514 Bacteria 12425
567 nmdc:mga08x19_285719_c1 3300050514 Bacteria 1144
568 nmdc:mga0a205_146054_c1 3300050515 Bacteria 2265
569 nmdc:mga0a205_7331_c1 3300050515 Bacteria 9985
570 nmdc:mga0sz30_1133_c1 3300050516 Bacteria 9551
571 Ga0500641_0008546 3300053096 Bacteria 3658
572 Ga0501084_0021259 3300054114 Bacteria 5410
573 Ga0501084_0129594 3300054114 Bacteria 2123
574 Ga0501084_0220205 3300054114 Bacteria 1601
575 Ga0501084_0401447 3300054114 Bacteria 1158
576 Ga0501082_0070390 3300060353 Bacteria 3012
577 Ga0501082_0072001 3300060353 Bacteria 2977
578 Ga0501082_0073915 3300060353 Bacteria 2935
579 Ga0501082_0846532 3300060353 Bacteria 800
580 Ga0501082_0865579 3300060353 Bacteria 790
581 Ga0530510_0006651 3300061734 Bacteria 8063
582 Ga0530510_0018622 3300061734 Bacteria 4923
583 Ga0530510_0056671 3300061734 Bacteria 2831
584 Ga0530510_0070582 3300061734 Bacteria 2535
585 Ga0530510_0330134 3300061734 Bacteria 1144

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048909 Ga0496106_0869023 Ga0496106_0869023_13_696 157
2 3300050512 nmdc:mga0n895_158049_c1 nmdc:mga0n895_158049_c1_279_1073 174
3 3300049575 Ga0501039_0099046 Ga0501039_0099046_1638_2237 175
4 3300048909 Ga0496106_0203026 Ga0496106_0203026_465_1253 178
5 3300003373 JGI25407J50210_10011363 JGI25407J50210_100113633 179
6 3300005834 Ga0068851_10176404 Ga0068851_101764042 179
7 3300005981 Ga0081538_10008306 Ga0081538_100083066 179
8 3300009177 Ga0105248_10118027 Ga0105248_101180275 179
9 3300013297 Ga0157378_10059479 Ga0157378_100594793 179
10 3300013306 Ga0163162_10278343 Ga0163162_102783433 179
11 3300025941 Ga0207711_10122120 Ga0207711_101221203 179
12 3300041512 Ga0451853_3403525 Ga0451853_3403525_22_768 179
13 3300005444 Ga0070694_100919813 Ga0070694_1009198131 180
14 3300005518 Ga0070699_100146878 Ga0070699_1001468781 181
15 3300006058 Ga0075432_10034224 Ga0075432_100342244 181
16 3300006844 Ga0075428_100132743 Ga0075428_1001327432 181
17 3300009094 Ga0111539_10019077 Ga0111539_100190779 181
18 3300027907 Ga0207428_10007467 Ga0207428_1000746717 181
19 3300028800 Ga0265338_10154817 Ga0265338_101548173 181
20 3300046539 Ga0495621_0007620 Ga0495621_0007620_1110_1841 181
21 3300050511 nmdc:mga08y16_11064_c1 nmdc:mga08y16_11064_c1_4250_4966 181
22 3300005331 Ga0070670_100702187 Ga0070670_1007021871 182
23 3300005334 Ga0068869_100165469 Ga0068869_1001654693 182
24 3300005340 Ga0070689_100018801 Ga0070689_1000188019 182
25 3300005344 Ga0070661_100114078 Ga0070661_1001140784 182
26 3300005354 Ga0070675_100031032 Ga0070675_1000310328 182
27 3300005356 Ga0070674_100219712 Ga0070674_1002197122 182
28 3300005364 Ga0070673_100161776 Ga0070673_1001617762 182
29 3300005441 Ga0070700_100088583 Ga0070700_1000885832 182
30 3300005466 Ga0070685_10036875 Ga0070685_100368755 182
31 3300005543 Ga0070672_100005015 Ga0070672_1000050155 182
32 3300005577 Ga0068857_100012217 Ga0068857_1000122178 182
33 3300005617 Ga0068859_100647831 Ga0068859_1006478312 182
34 3300005719 Ga0068861_100230782 Ga0068861_1002307822 182
35 3300005840 Ga0068870_10209898 Ga0068870_102098981 182
36 3300006931 Ga0097620_100647835 Ga0097620_1006478351 182
37 3300013297 Ga0157378_10096241 Ga0157378_100962413 182
38 3300014745 Ga0157377_10014255 Ga0157377_100142558 182
39 3300025901 Ga0207688_10040537 Ga0207688_100405373 182
40 3300025912 Ga0207707_10192474 Ga0207707_101924743 182
41 3300025926 Ga0207659_10001704 Ga0207659_1000170414 182
42 3300025936 Ga0207670_10146182 Ga0207670_101461822 182
43 3300025940 Ga0207691_10008862 Ga0207691_1000886215 182
44 3300025942 Ga0207689_10046684 Ga0207689_100466843 182
45 3300025960 Ga0207651_10367236 Ga0207651_103672362 182
46 3300026116 Ga0207674_10022377 Ga0207674_1002237710 182
47 3300026118 Ga0207675_100125589 Ga0207675_1001255896 182
48 3300044683 Ga0466965_0080401 Ga0466965_0080401_18_608 182
49 3300044694 Ga0466963_0432990 Ga0466963_0432990_234_824 182
50 3300049569 Ga0501032_0078142 Ga0501032_0078142_119_709 182
51 3300049570 Ga0501033_0239283 Ga0501033_0239283_209_790 182
52 3300049572 Ga0501036_0370468 Ga0501036_0370468_177_767 182
53 3300049574 Ga0501038_0064358 Ga0501038_0064358_1638_2228 182
54 3300049582 Ga0501048_0114451 Ga0501048_0114451_876_1457 182
55 3300049585 Ga0501069_0163824 Ga0501069_0163824_206_787 182
56 3300049587 Ga0501071_0225069 Ga0501071_0225069_450_1040 182
57 3300049589 Ga0501073_0234408 Ga0501073_0234408_375_965 182
58 3300049593 Ga0501077_0082333 Ga0501077_0082333_807_1397 182
59 3300049742 Ga0501080_0192882 Ga0501080_0192882_1179_1760 182
60 3300049822 Ga0501035_0854993 Ga0501035_0854993_40_621 182
61 3300049824 Ga0501045_0236958 Ga0501045_0236958_700_1290 182
62 3300054114 Ga0501084_0401447 Ga0501084_0401447_119_709 182
63 3300060353 Ga0501082_0865579 Ga0501082_0865579_82_672 182
64 3300061734 Ga0530510_0018622 Ga0530510_0018622_3910_4500 182
65 3300005364 Ga0070673_100066457 Ga0070673_1000664572 183
66 3300005367 Ga0070667_100048136 Ga0070667_1000481364 183
67 3300005445 Ga0070708_100270554 Ga0070708_1002705542 183
68 3300005456 Ga0070678_100005141 Ga0070678_1000051419 183
69 3300005456 Ga0070678_100006691 Ga0070678_10000669112 183
70 3300005458 Ga0070681_10010917 Ga0070681_100109179 183
71 3300005459 Ga0068867_100522388 Ga0068867_1005223882 183
72 3300005468 Ga0070707_100064367 Ga0070707_1000643677 183
73 3300005518 Ga0070699_100866728 Ga0070699_1008667281 183
74 3300005530 Ga0070679_100085474 Ga0070679_1000854746 183
75 3300005535 Ga0070684_100632454 Ga0070684_1006324542 183
76 3300005548 Ga0070665_100009861 Ga0070665_1000098614 183
77 3300005842 Ga0068858_100744003 Ga0068858_1007440032 183
78 3300006195 Ga0075366_10016904 Ga0075366_100169047 183
79 3300006871 Ga0075434_100036821 Ga0075434_1000368212 183
80 3300006871 Ga0075434_100279007 Ga0075434_1002790073 183
81 3300006914 Ga0075436_100000862 Ga0075436_10000086217 183
82 3300009148 Ga0105243_10245165 Ga0105243_102451652 183
83 3300009176 Ga0105242_10716019 Ga0105242_107160192 183
84 3300010375 Ga0105239_10270107 Ga0105239_102701073 183
85 3300013297 Ga0157378_10153148 Ga0157378_101531484 183
86 3300013308 Ga0157375_11753018 Ga0157375_117530182 183
87 3300025912 Ga0207707_10015921 Ga0207707_100159218 183
88 3300025921 Ga0207652_10287808 Ga0207652_102878083 183
89 3300025922 Ga0207646_10027133 Ga0207646_100271339 183
90 3300025938 Ga0207704_10108464 Ga0207704_101084643 183
91 3300025938 Ga0207704_10270843 Ga0207704_102708433 183
92 3300025938 Ga0207704_10370622 Ga0207704_103706222 183
93 3300025940 Ga0207691_10035592 Ga0207691_100355921 183
94 3300025972 Ga0207668_10122678 Ga0207668_101226783 183
95 3300025986 Ga0207658_10030611 Ga0207658_100306114 183
96 3300026035 Ga0207703_10586810 Ga0207703_105868102 183
97 3300026095 Ga0207676_10527716 Ga0207676_105277162 183
98 3300026121 Ga0207683_10008690 Ga0207683_100086904 183
99 3300028379 Ga0268266_10006169 Ga0268266_100061693 183
100 3300028800 Ga0265338_10006510 Ga0265338_1000651016 183
101 3300031251 Ga0265327_10006243 Ga0265327_100062438 183
102 3300042001 Ga0439441_043107 Ga0439441_043107_165_890 183
103 3300046472 Ga0495580_0178884 Ga0495580_0178884_126_707 183
104 3300046511 Ga0495608_0037016 Ga0495608_0037016_369_1106 183
105 3300046794 Ga0495589_0405885 Ga0495589_0405885_49_612 183
106 3300048907 Ga0496104_0144557 Ga0496104_0144557_1084_1656 183
107 3300048908 Ga0496105_0073103 Ga0496105_0073103_1798_2370 183
108 3300048912 Ga0496109_0409228 Ga0496109_0409228_686_1249 183
109 3300048912 Ga0496109_0478288 Ga0496109_0478288_363_923 183
110 3300048912 Ga0496109_0863305 Ga0496109_0863305_209_781 183
111 3300048913 Ga0496110_0807903 Ga0496110_0807903_123_686 183
112 3300050493 nmdc:mga0k408_13809_c1 nmdc:mga0k408_13809_c1_2903_3619 183
113 3300050512 nmdc:mga0n895_149141_c1 nmdc:mga0n895_149141_c1_690_1457 183
114 3300050512 nmdc:mga0n895_512190_c1 nmdc:mga0n895_512190_c1_31_612 183
115 3300050514 nmdc:mga08x19_2026_c1 nmdc:mga08x19_2026_c1_7128_7895 183
116 3300050514 nmdc:mga08x19_285719_c1 nmdc:mga08x19_285719_c1_226_807 183
117 3300005293 Ga0065715_10147379 Ga0065715_101473793 184
118 3300005328 Ga0070676_10037090 Ga0070676_100370905 184
119 3300005333 Ga0070677_10004529 Ga0070677_100045298 184
120 3300005335 Ga0070666_10020483 Ga0070666_100204833 184
121 3300005338 Ga0068868_100464117 Ga0068868_1004641172 184
122 3300005353 Ga0070669_100102281 Ga0070669_1001022813 184
123 3300005356 Ga0070674_100014259 Ga0070674_1000142597 184
124 3300005365 Ga0070688_100062951 Ga0070688_1000629514 184
125 3300005365 Ga0070688_100245927 Ga0070688_1002459272 184
126 3300005367 Ga0070667_100097551 Ga0070667_1000975513 184
127 3300005441 Ga0070700_100016206 Ga0070700_1000162066 184
128 3300005456 Ga0070678_100021374 Ga0070678_1000213747 184
129 3300005457 Ga0070662_100031910 Ga0070662_1000319106 184
130 3300005466 Ga0070685_10119525 Ga0070685_101195253 184
131 3300005544 Ga0070686_100067971 Ga0070686_1000679712 184
132 3300005548 Ga0070665_100243577 Ga0070665_1002435772 184
133 3300005578 Ga0068854_100729252 Ga0068854_1007292522 184
134 3300005615 Ga0070702_100012107 Ga0070702_1000121074 184
135 3300005617 Ga0068859_100046188 Ga0068859_1000461887 184
136 3300005719 Ga0068861_100208882 Ga0068861_1002088822 184
137 3300005841 Ga0068863_100514679 Ga0068863_1005146792 184
138 3300005843 Ga0068860_100170761 Ga0068860_1001707613 184
139 3300006237 Ga0097621_100180965 Ga0097621_1001809653 184
140 3300006358 Ga0068871_100066382 Ga0068871_1000663824 184
141 3300006931 Ga0097620_100046188 Ga0097620_1000461884 184
142 3300009094 Ga0111539_10342356 Ga0111539_103423562 184
143 3300009098 Ga0105245_10040665 Ga0105245_100406657 184
144 3300009148 Ga0105243_10035000 Ga0105243_100350007 184
145 3300009176 Ga0105242_10009166 Ga0105242_1000916615 184
146 3300009177 Ga0105248_10627912 Ga0105248_106279122 184
147 3300009553 Ga0105249_10363778 Ga0105249_103637783 184
148 3300010159 Ga0099796_10005277 Ga0099796_100052774 184
149 3300011119 Ga0105246_10260205 Ga0105246_102602051 184
150 3300013296 Ga0157374_10138530 Ga0157374_101385301 184
151 3300013297 Ga0157378_10043237 Ga0157378_100432376 184
152 3300013297 Ga0157378_10694815 Ga0157378_106948152 184
153 3300013306 Ga0163162_10446724 Ga0163162_104467243 184
154 3300013308 Ga0157375_11155259 Ga0157375_111552592 184
155 3300014325 Ga0163163_10278391 Ga0163163_102783912 184
156 3300014326 Ga0157380_10026469 Ga0157380_100264694 184
157 3300014745 Ga0157377_10172095 Ga0157377_101720953 184
158 3300014968 Ga0157379_10079870 Ga0157379_100798706 184
159 3300014969 Ga0157376_10501861 Ga0157376_105018612 184
160 3300017792 Ga0163161_10045011 Ga0163161_100450113 184
161 3300025315 Ga0207697_10001157 Ga0207697_1000115713 184
162 3300025893 Ga0207682_10006357 Ga0207682_100063575 184
163 3300025901 Ga0207688_10002803 Ga0207688_100028035 184
164 3300025903 Ga0207680_10067863 Ga0207680_100678634 184
165 3300025907 Ga0207645_10004332 Ga0207645_100043329 184
166 3300025907 Ga0207645_10250537 Ga0207645_102505372 184
167 3300025908 Ga0207643_10001343 Ga0207643_1000134315 184
168 3300025918 Ga0207662_10073771 Ga0207662_100737713 184
169 3300025921 Ga0207652_10258193 Ga0207652_102581932 184
170 3300025927 Ga0207687_10165671 Ga0207687_101656713 184
171 3300025931 Ga0207644_10136885 Ga0207644_101368855 184
172 3300025933 Ga0207706_10006693 Ga0207706_100066939 184
173 3300025934 Ga0207686_10018577 Ga0207686_100185778 184
174 3300025937 Ga0207669_10065481 Ga0207669_100654815 184
175 3300025940 Ga0207691_10010153 Ga0207691_100101536 184
176 3300025941 Ga0207711_10091045 Ga0207711_100910453 184
177 3300025942 Ga0207689_10008334 Ga0207689_100083346 184
178 3300025960 Ga0207651_10184977 Ga0207651_101849773 184
179 3300025961 Ga0207712_10104420 Ga0207712_101044203 184
180 3300025972 Ga0207668_10073886 Ga0207668_100738862 184
181 3300025981 Ga0207640_10618427 Ga0207640_106184272 184
182 3300026075 Ga0207708_10005800 Ga0207708_100058006 184
183 3300026088 Ga0207641_10078861 Ga0207641_100788614 184
184 3300026089 Ga0207648_10008905 Ga0207648_100089058 184
185 3300026095 Ga0207676_10018878 Ga0207676_100188781 184
186 3300026116 Ga0207674_10058297 Ga0207674_100582976 184
187 3300026118 Ga0207675_100006269 Ga0207675_10000626915 184
188 3300026121 Ga0207683_10007403 Ga0207683_1000740315 184
189 3300028379 Ga0268266_10380414 Ga0268266_103804143 184
190 3300028380 Ga0268265_10247238 Ga0268265_102472383 184
191 3300028577 Ga0265318_10002940 Ga0265318_100029408 184
192 3300031238 Ga0265332_10002675 Ga0265332_100026756 184
193 3300031240 Ga0265320_10033040 Ga0265320_100330405 184
194 3300031242 Ga0265329_10005644 Ga0265329_100056443 184
195 3300031250 Ga0265331_10004043 Ga0265331_1000404315 184
196 3300031251 Ga0265327_10210607 Ga0265327_102106071 184
197 3300031344 Ga0265316_10029265 Ga0265316_100292658 184
198 3300031711 Ga0265314_10000765 Ga0265314_1000076528 184
199 3300031712 Ga0265342_10065682 Ga0265342_100656824 184
200 3300035091 Ga0373951_0151774 Ga0373951_0151774_31_618 184
201 3300046537 Ga0495598_0011640 Ga0495598_0011640_1455_2042 184
202 3300048907 Ga0496104_0313047 Ga0496104_0313047_578_1165 184
203 3300050508 nmdc:mga09592_133603_c1 nmdc:mga09592_133603_c1_1461_2048 184
204 3300050511 nmdc:mga08y16_81215_c1 nmdc:mga08y16_81215_c1_1753_2340 184
205 3300005719 Ga0068861_100985067 Ga0068861_1009850672 185
206 3300005937 Ga0081455_10019985 Ga0081455_100199854 185
207 3300006881 Ga0068865_100285339 Ga0068865_1002853392 185
208 3300009094 Ga0111539_10690104 Ga0111539_106901042 185
209 3300009176 Ga0105242_10046503 Ga0105242_100465033 185
210 3300009177 Ga0105248_10123110 Ga0105248_101231103 185
211 3300013306 Ga0163162_10086874 Ga0163162_100868747 185
212 3300013308 Ga0157375_10173624 Ga0157375_101736243 185
213 3300025934 Ga0207686_10237938 Ga0207686_102379383 185
214 3300025941 Ga0207711_10084852 Ga0207711_100848523 185
215 3300041406 Ga0439439_0040867 Ga0439439_0040867_411_983 185
216 3300042006 Ga0439432_170637 Ga0439432_170637_10_582 185
217 3300042156 Ga0439446_0004585 Ga0439446_0004585_920_1492 185
218 3300049572 Ga0501036_0261058 Ga0501036_0261058_418_1107 185
219 3300049575 Ga0501039_0074777 Ga0501039_0074777_1884_2573 185
220 3300049576 Ga0501040_0273674 Ga0501040_0273674_235_804 185
221 3300049577 Ga0501041_0165312 Ga0501041_0165312_690_1259 185
222 3300049577 Ga0501041_0239829 Ga0501041_0239829_455_1027 185
223 3300049581 Ga0501047_0229954 Ga0501047_0229954_291_983 185
224 3300049582 Ga0501048_0681164 Ga0501048_0681164_141_710 185
225 3300049587 Ga0501071_0005936 Ga0501071_0005936_6294_6983 185
226 3300049587 Ga0501071_0295470 Ga0501071_0295470_211_780 185
227 3300049587 Ga0501071_0568526 Ga0501071_0568526_290_850 185
228 3300049589 Ga0501073_0008056 Ga0501073_0008056_5167_5856 185
229 3300049590 Ga0501074_0486723 Ga0501074_0486723_284_853 185
230 3300049591 Ga0501075_0024398 Ga0501075_0024398_1927_2616 185
231 3300049591 Ga0501075_0059923 Ga0501075_0059923_516_1085 185
232 3300049592 Ga0501076_0044620 Ga0501076_0044620_2132_2701 185
233 3300049592 Ga0501076_0047645 Ga0501076_0047645_849_1538 185
234 3300049592 Ga0501076_0243582 Ga0501076_0243582_810_1382 185
235 3300049592 Ga0501076_0409028 Ga0501076_0409028_346_906 185
236 3300049593 Ga0501077_0224189 Ga0501077_0224189_444_1007 185
237 3300049741 Ga0501079_0039713 Ga0501079_0039713_1873_2562 185
238 3300049741 Ga0501079_0241649 Ga0501079_0241649_476_1048 185
239 3300049741 Ga0501079_0291398 Ga0501079_0291398_253_822 185
240 3300049742 Ga0501080_0001428 Ga0501080_0001428_16524_17213 185
241 3300049742 Ga0501080_0386668 Ga0501080_0386668_306_875 185
242 3300049742 Ga0501080_0733350 Ga0501080_0733350_68_634 185
243 3300049743 Ga0501081_0017769 Ga0501081_0017769_2015_2584 185
244 3300049743 Ga0501081_0031168 Ga0501081_0031168_1043_1732 185
245 3300049823 Ga0501044_0217134 Ga0501044_0217134_287_979 185
246 3300049824 Ga0501045_0077628 Ga0501045_0077628_1796_2365 185
247 3300049824 Ga0501045_0257870 Ga0501045_0257870_498_1070 185
248 3300054114 Ga0501084_0220205 Ga0501084_0220205_820_1392 185
249 3300060353 Ga0501082_0070390 Ga0501082_0070390_1942_2511 185
250 3300060353 Ga0501082_0846532 Ga0501082_0846532_113_673 185
251 3300061734 Ga0530510_0006651 Ga0530510_0006651_5065_5634 185
252 3300005327 Ga0070658_10253392 Ga0070658_102533922 186
253 3300005434 Ga0070709_10015515 Ga0070709_100155154 186
254 3300005435 Ga0070714_100009500 Ga0070714_1000095008 186
255 3300005435 Ga0070714_100039749 Ga0070714_1000397498 186
256 3300005436 Ga0070713_100001795 Ga0070713_10000179516 186
257 3300005439 Ga0070711_100380163 Ga0070711_1003801632 186
258 3300005458 Ga0070681_10007099 Ga0070681_1000709914 186
259 3300005548 Ga0070665_100022127 Ga0070665_1000221276 186
260 3300005937 Ga0081455_10165120 Ga0081455_101651203 186
261 3300006028 Ga0070717_10062172 Ga0070717_100621723 186
262 3300006173 Ga0070716_100003910 Ga0070716_10000391015 186
263 3300006173 Ga0070716_100272621 Ga0070716_1002726212 186
264 3300006175 Ga0070712_100044366 Ga0070712_1000443664 186
265 3300006871 Ga0075434_100716553 Ga0075434_1007165532 186
266 3300009094 Ga0111539_10404617 Ga0111539_104046174 186
267 3300025898 Ga0207692_10395199 Ga0207692_103951992 186
268 3300025909 Ga0207705_10172434 Ga0207705_101724343 186
269 3300025909 Ga0207705_10230349 Ga0207705_102303493 186
270 3300025911 Ga0207654_10015846 Ga0207654_100158468 186
271 3300025912 Ga0207707_10005674 Ga0207707_1000567415 186
272 3300025915 Ga0207693_10096919 Ga0207693_100969194 186
273 3300025915 Ga0207693_10304066 Ga0207693_103040662 186
274 3300025916 Ga0207663_10045973 Ga0207663_100459733 186
275 3300025919 Ga0207657_10109580 Ga0207657_101095804 186
276 3300025921 Ga0207652_10155677 Ga0207652_101556771 186
277 3300025929 Ga0207664_10007010 Ga0207664_100070109 186
278 3300025929 Ga0207664_10426798 Ga0207664_104267983 186
279 3300025939 Ga0207665_10088305 Ga0207665_100883052 186
280 3300028577 Ga0265318_10004027 Ga0265318_100040279 186
281 3300033527 Ga0316586_1026237 Ga0316586_10262371 186
282 3300035692 Ga0373935_0450985 Ga0373935_0450985_72_806 186
283 3300037312 Ga0395899_0013274 Ga0395899_0013274_865_1467 186
284 3300037418 Ga0395900_0005930 Ga0395900_0005930_522_1124 186
285 3300037418 Ga0395900_0008939 Ga0395900_0008939_9027_9629 186
286 3300037466 Ga0395898_0025218 Ga0395898_0025218_522_1124 186
287 3300037471 Ga0395905_0000698 Ga0395905_0000698_5089_5691 186
288 3300037471 Ga0395905_0012695 Ga0395905_0012695_2050_2652 186
289 3300038443 Ga0395901_0000608 Ga0395901_0000608_21588_22190 186
290 3300038443 Ga0395901_0005869 Ga0395901_0005869_5826_6428 186
291 3300039450 Ga0436363_0498253 Ga0436363_0498253_6828_7535 186
292 3300044706 Ga0466964_0004587 Ga0466964_0004587_3408_4010 186
293 3300045976 Ga0466967_0005405 Ga0466967_0005405_229_831 186
294 3300046683 Ga0495658_0253694 Ga0495658_0253694_337_1041 186
295 3300048912 Ga0496109_0858826 Ga0496109_0858826_16_726 186
296 3300049583 Ga0501067_0007685 Ga0501067_0007685_1831_2406 186
297 3300049585 Ga0501069_0135705 Ga0501069_0135705_641_1216 186
298 3300049587 Ga0501071_0552800 Ga0501071_0552800_96_671 186
299 3300049588 Ga0501072_0176075 Ga0501072_0176075_212_787 186
300 3300049591 Ga0501075_0177394 Ga0501075_0177394_507_1082 186
301 3300049592 Ga0501076_0201287 Ga0501076_0201287_670_1245 186
302 3300049741 Ga0501079_0090710 Ga0501079_0090710_937_1512 186
303 3300049743 Ga0501081_0405089 Ga0501081_0405089_146_721 186
304 3300049822 Ga0501035_0123252 Ga0501035_0123252_1274_1966 186
305 3300049824 Ga0501045_0363386 Ga0501045_0363386_474_1049 186
306 3300050492 nmdc:mga0yw44_36915_c1 nmdc:mga0yw44_36915_c1_1225_1929 186
307 3300050507 nmdc:mga05p37_788941_c1 nmdc:mga05p37_788941_c1_224_859 186
308 3300050511 nmdc:mga08y16_374461_c1 nmdc:mga08y16_374461_c1_116_688 186
309 3300053096 Ga0500641_0008546 Ga0500641_0008546_255_959 186
310 3300061734 Ga0530510_0330134 Ga0530510_0330134_250_825 186
311 3300005340 Ga0070689_100359837 Ga0070689_1003598372 187
312 3300005366 Ga0070659_100097880 Ga0070659_1000978804 187
313 3300005435 Ga0070714_100388700 Ga0070714_1003887001 187
314 3300005436 Ga0070713_100005685 Ga0070713_1000056854 187
315 3300005436 Ga0070713_100193708 Ga0070713_1001937083 187
316 3300005471 Ga0070698_100323539 Ga0070698_1003235393 187
317 3300005539 Ga0068853_100031768 Ga0068853_1000317682 187
318 3300005547 Ga0070693_100037693 Ga0070693_1000376937 187
319 3300005549 Ga0070704_100407482 Ga0070704_1004074822 187
320 3300005563 Ga0068855_100056659 Ga0068855_1000566599 187
321 3300005563 Ga0068855_100375706 Ga0068855_1003757062 187
322 3300005563 Ga0068855_101123421 Ga0068855_1011234211 187
323 3300005616 Ga0068852_100428745 Ga0068852_1004287452 187
324 3300005617 Ga0068859_100130549 Ga0068859_1001305491 187
325 3300005618 Ga0068864_100116524 Ga0068864_1001165245 187
326 3300005719 Ga0068861_100334365 Ga0068861_1003343653 187
327 3300005719 Ga0068861_100336057 Ga0068861_1003360572 187
328 3300005834 Ga0068851_10031533 Ga0068851_100315336 187
329 3300005937 Ga0081455_10006416 Ga0081455_1000641613 187
330 3300005981 Ga0081538_10026960 Ga0081538_100269605 187
331 3300006195 Ga0075366_10007118 Ga0075366_100071189 187
332 3300006237 Ga0097621_100204046 Ga0097621_1002040463 187
333 3300006358 Ga0068871_100092374 Ga0068871_1000923744 187
334 3300006358 Ga0068871_100111438 Ga0068871_1001114382 187
335 3300006358 Ga0068871_100340751 Ga0068871_1003407511 187
336 3300006844 Ga0075428_100236127 Ga0075428_1002361274 187
337 3300006847 Ga0075431_100075040 Ga0075431_1000750402 187
338 3300006871 Ga0075434_100239451 Ga0075434_1002394514 187
339 3300006914 Ga0075436_100018705 Ga0075436_1000187055 187
340 3300006931 Ga0097620_100130553 Ga0097620_1001305536 187
341 3300006931 Ga0097620_100253646 Ga0097620_1002536463 187
342 3300007076 Ga0075435_100120900 Ga0075435_1001209002 187
343 3300009093 Ga0105240_10152833 Ga0105240_101528334 187
344 3300009093 Ga0105240_10252783 Ga0105240_102527833 187
345 3300009094 Ga0111539_10021781 Ga0111539_100217818 187
346 3300009551 Ga0105238_10087095 Ga0105238_100870953 187
347 3300013104 Ga0157370_10090984 Ga0157370_100909843 187
348 3300013105 Ga0157369_10006334 Ga0157369_1000633414 187
349 3300013296 Ga0157374_10054005 Ga0157374_100540056 187
350 3300013297 Ga0157378_10124450 Ga0157378_101244503 187
351 3300013307 Ga0157372_10202803 Ga0157372_102028034 187
352 3300014325 Ga0163163_10377128 Ga0163163_103771282 187
353 3300025321 Ga0207656_10019865 Ga0207656_100198652 187
354 3300025893 Ga0207682_10055309 Ga0207682_100553093 187
355 3300025913 Ga0207695_10045231 Ga0207695_100452319 187
356 3300025913 Ga0207695_10725986 Ga0207695_107259862 187
357 3300025916 Ga0207663_10050037 Ga0207663_100500376 187
358 3300025918 Ga0207662_10050088 Ga0207662_100500881 187
359 3300025920 Ga0207649_10101163 Ga0207649_101011633 187
360 3300025924 Ga0207694_10007098 Ga0207694_1000709813 187
361 3300025927 Ga0207687_10194600 Ga0207687_101946003 187
362 3300025928 Ga0207700_10003066 Ga0207700_100030662 187
363 3300025928 Ga0207700_10445848 Ga0207700_104458482 187
364 3300025942 Ga0207689_10181155 Ga0207689_101811553 187
365 3300025944 Ga0207661_10260052 Ga0207661_102600522 187
366 3300025949 Ga0207667_10019150 Ga0207667_100191509 187
367 3300025949 Ga0207667_10223167 Ga0207667_102231673 187
368 3300025960 Ga0207651_10251978 Ga0207651_102519783 187
369 3300026041 Ga0207639_10323530 Ga0207639_103235303 187
370 3300026078 Ga0207702_10140039 Ga0207702_101400394 187
371 3300026095 Ga0207676_10759764 Ga0207676_107597642 187
372 3300026142 Ga0207698_10025800 Ga0207698_100258004 187
373 3300026142 Ga0207698_10214366 Ga0207698_102143662 187
374 3300026142 Ga0207698_10767346 Ga0207698_107673462 187
375 3300027907 Ga0207428_10236826 Ga0207428_102368262 187
376 3300028556 Ga0265337_1037670 Ga0265337_10376702 187
377 3300028563 Ga0265319_1001800 Ga0265319_100180021 187
378 3300028573 Ga0265334_10015907 Ga0265334_100159076 187
379 3300028577 Ga0265318_10030930 Ga0265318_100309301 187
380 3300028654 Ga0265322_10015941 Ga0265322_100159412 187
381 3300028800 Ga0265338_10017394 Ga0265338_100173944 187
382 3300031239 Ga0265328_10035883 Ga0265328_100358832 187
383 3300031240 Ga0265320_10046676 Ga0265320_100466764 187
384 3300031241 Ga0265325_10074450 Ga0265325_100744503 187
385 3300031242 Ga0265329_10023036 Ga0265329_100230361 187
386 3300031247 Ga0265340_10018011 Ga0265340_100180112 187
387 3300031249 Ga0265339_10118988 Ga0265339_101189883 187
388 3300031251 Ga0265327_10001971 Ga0265327_100019719 187
389 3300031251 Ga0265327_10060671 Ga0265327_100606712 187
390 3300031344 Ga0265316_10009161 Ga0265316_1000916112 187
391 3300031711 Ga0265314_10006724 Ga0265314_100067246 187
392 3300031712 Ga0265342_10011897 Ga0265342_100118973 187
393 3300031731 Ga0307405_10005729 Ga0307405_100057294 187
394 3300037312 Ga0395899_0054068 Ga0395899_0054068_367_1068 187
395 3300037312 Ga0395899_0182217 Ga0395899_0182217_53_658 187
396 3300037418 Ga0395900_0013779 Ga0395900_0013779_4139_4744 187
397 3300037418 Ga0395900_0034072 Ga0395900_0034072_648_1349 187
398 3300037466 Ga0395898_0026248 Ga0395898_0026248_1893_2498 187
399 3300037471 Ga0395905_0048048 Ga0395905_0048048_601_1302 187
400 3300037471 Ga0395905_0323818 Ga0395905_0323818_53_658 187
401 3300038443 Ga0395901_0009856 Ga0395901_0009856_3261_3866 187
402 3300038443 Ga0395901_0033769 Ga0395901_0033769_3343_4044 187
403 3300046529 Ga0495652_0311155 Ga0495652_0311155_306_878 187
404 3300046537 Ga0495598_0020881 Ga0495598_0020881_969_1697 187
405 3300046539 Ga0495621_0003232 Ga0495621_0003232_3218_3937 187
406 3300048907 Ga0496104_0004171 Ga0496104_0004171_1411_2115 187
407 3300048913 Ga0496110_0044560 Ga0496110_0044560_1870_2574 187
408 3300048914 Ga0496111_0116205 Ga0496111_0116205_859_1563 187
409 3300048916 Ga0496113_0558675 Ga0496113_0558675_72_644 187
410 3300049581 Ga0501047_0040997 Ga0501047_0040997_222_920 187
411 3300049585 Ga0501069_0001064 Ga0501069_0001064_767_1474 187
412 3300049586 Ga0501070_0001356 Ga0501070_0001356_14909_15616 187
413 3300049587 Ga0501071_0268774 Ga0501071_0268774_535_1113 187
414 3300049589 Ga0501073_0000321 Ga0501073_0000321_25118_25825 187
415 3300049590 Ga0501074_0000097 Ga0501074_0000097_35265_35972 187
416 3300049741 Ga0501079_0009081 Ga0501079_0009081_2444_3151 187
417 3300049742 Ga0501080_0011166 Ga0501080_0011166_1693_2400 187
418 3300049744 Ga0501083_0004051 Ga0501083_0004051_3262_3969 187
419 3300049822 Ga0501035_0157565 Ga0501035_0157565_821_1528 187
420 3300050489 nmdc:mga03683_93487_c1 nmdc:mga03683_93487_c1_161_862 187
421 3300050491 nmdc:mga00v17_5329_c1 nmdc:mga00v17_5329_c1_4965_5666 187
422 3300050493 nmdc:mga0k408_1928_c1 nmdc:mga0k408_1928_c1_3608_4309 187
423 3300050507 nmdc:mga05p37_27608_c1 nmdc:mga05p37_27608_c1_6169_6771 187
424 3300050510 nmdc:mga06r32_198902_c1 nmdc:mga06r32_198902_c1_167_769 187
425 3300050511 nmdc:mga08y16_17581_c1 nmdc:mga08y16_17581_c1_2943_3545 187
426 3300050512 nmdc:mga0n895_386018_c1 nmdc:mga0n895_386018_c1_238_837 187
427 3300050513 nmdc:mga0rr50_111313_c1 nmdc:mga0rr50_111313_c1_1341_2081 187
428 3300050515 nmdc:mga0a205_146054_c1 nmdc:mga0a205_146054_c1_697_1296 187
429 3300050516 nmdc:mga0sz30_1133_c1 nmdc:mga0sz30_1133_c1_3696_4397 187
430 3300054114 Ga0501084_0021259 Ga0501084_0021259_4174_4881 187
431 3300060353 Ga0501082_0072001 Ga0501082_0072001_1360_2067 187
432 3300005331 Ga0070670_100002726 Ga0070670_10000272613 188
433 3300005436 Ga0070713_100163538 Ga0070713_1001635382 188
434 3300005445 Ga0070708_100044414 Ga0070708_1000444142 188
435 3300005467 Ga0070706_100004600 Ga0070706_10000460016 188
436 3300005471 Ga0070698_100129739 Ga0070698_1001297393 188
437 3300005518 Ga0070699_100057447 Ga0070699_1000574476 188
438 3300005518 Ga0070699_100068029 Ga0070699_1000680293 188
439 3300005518 Ga0070699_100266738 Ga0070699_1002667383 188
440 3300005536 Ga0070697_100169968 Ga0070697_1001699684 188
441 3300005937 Ga0081455_10017464 Ga0081455_1001746411 188
442 3300005937 Ga0081455_10093962 Ga0081455_100939624 188
443 3300005981 Ga0081538_10001246 Ga0081538_1000124629 188
444 3300006028 Ga0070717_10075652 Ga0070717_100756527 188
445 3300006175 Ga0070712_100078635 Ga0070712_1000786354 188
446 3300025903 Ga0207680_10118155 Ga0207680_101181551 188
447 3300025906 Ga0207699_10069854 Ga0207699_100698545 188
448 3300025910 Ga0207684_10011106 Ga0207684_100111066 188
449 3300025915 Ga0207693_10043512 Ga0207693_100435126 188
450 3300025915 Ga0207693_10509639 Ga0207693_105096391 188
451 3300025922 Ga0207646_10363419 Ga0207646_103634193 188
452 3300025928 Ga0207700_10000001 Ga0207700_1000000191 188
453 3300025929 Ga0207664_10110540 Ga0207664_101105404 188
454 3300025937 Ga0207669_10077737 Ga0207669_100777372 188
455 3300025939 Ga0207665_10088164 Ga0207665_100881644 188
456 3300025945 Ga0207679_10513844 Ga0207679_105138442 188
457 3300027907 Ga0207428_10145127 Ga0207428_101451273 188
458 3300035170 Ga0373943_0110785 Ga0373943_0110785_828_1433 188
459 3300035691 Ga0373931_0079776 Ga0373931_0079776_537_1142 188
460 3300035692 Ga0373935_0479284 Ga0373935_0479284_146_751 188
461 3300037418 Ga0395900_0026290 Ga0395900_0026290_740_1351 188
462 3300037418 Ga0395900_0358545 Ga0395900_0358545_406_984 188
463 3300037466 Ga0395898_0016565 Ga0395898_0016565_645_1256 188
464 3300037466 Ga0395898_0104333 Ga0395898_0104333_318_902 188
465 3300037466 Ga0395898_0119192 Ga0395898_0119192_1034_1612 188
466 3300037471 Ga0395905_0027635 Ga0395905_0027635_1482_2093 188
467 3300037471 Ga0395905_0045213 Ga0395905_0045213_871_1455 188
468 3300037471 Ga0395905_0650156 Ga0395905_0650156_226_804 188
469 3300038443 Ga0395901_0072850 Ga0395901_0072850_77_688 188
470 3300038443 Ga0395901_0513691 Ga0395901_0513691_450_1025 188
471 3300038443 Ga0395901_0593873 Ga0395901_0593873_226_831 188
472 3300042146 Ga0450907_016895 Ga0450907_016895_34_615 188
473 3300046459 Ga0495629_0297317 Ga0495629_0297317_78_659 188
474 3300046461 Ga0495641_0050391 Ga0495641_0050391_320_925 188
475 3300046473 Ga0495582_0069503 Ga0495582_0069503_617_1222 188
476 3300046473 Ga0495582_0249321 Ga0495582_0249321_374_955 188
477 3300046516 Ga0495628_0000864 Ga0495628_0000864_17776_18600 188
478 3300046518 Ga0495631_0108437 Ga0495631_0108437_424_1029 188
479 3300046615 Ga0495656_0236034 Ga0495656_0236034_215_820 188
480 3300046681 Ga0495647_0044024 Ga0495647_0044024_989_1594 188
481 3300046689 Ga0495613_0179845 Ga0495613_0179845_294_899 188
482 3300047321 Ga0495676_0082052 Ga0495676_0082052_949_1554 188
483 3300047322 Ga0495680_0433016 Ga0495680_0433016_283_864 188
484 3300048088 Ga0495602_0003702 Ga0495602_0003702_5759_6583 188
485 3300048904 Ga0496101_0020085 Ga0496101_0020085_3801_4406 188
486 3300048905 Ga0496102_0113199 Ga0496102_0113199_608_1213 188
487 3300048906 Ga0496103_0180619 Ga0496103_0180619_424_1029 188
488 3300048907 Ga0496104_0036479 Ga0496104_0036479_3365_3967 188
489 3300048907 Ga0496104_0286930 Ga0496104_0286930_349_954 188
490 3300048910 Ga0496107_0085981 Ga0496107_0085981_575_1180 188
491 3300048911 Ga0496108_0030984 Ga0496108_0030984_3783_4388 188
492 3300048912 Ga0496109_0001046 Ga0496109_0001046_2307_2912 188
493 3300048913 Ga0496110_0023971 Ga0496110_0023971_1873_2475 188
494 3300048914 Ga0496111_0013650 Ga0496111_0013650_899_1504 188
495 3300048914 Ga0496111_0033779 Ga0496111_0033779_2443_3045 188
496 3300048915 Ga0496112_0020180 Ga0496112_0020180_1896_2501 188
497 3300048916 Ga0496113_0070012 Ga0496113_0070012_650_1255 188
498 3300048917 Ga0496114_0124403 Ga0496114_0124403_626_1231 188
499 3300048918 Ga0496115_0066743 Ga0496115_0066743_44_649 188
500 3300049568 Ga0501031_0088981 Ga0501031_0088981_862_1443 188
501 3300049572 Ga0501036_0030174 Ga0501036_0030174_3802_4383 188
502 3300049573 Ga0501037_0195276 Ga0501037_0195276_832_1413 188
503 3300049577 Ga0501041_0347148 Ga0501041_0347148_43_624 188
504 3300049578 Ga0501042_0080578 Ga0501042_0080578_721_1302 188
505 3300049582 Ga0501048_0045135 Ga0501048_0045135_1771_2352 188
506 3300049587 Ga0501071_0113761 Ga0501071_0113761_129_710 188
507 3300049588 Ga0501072_0028773 Ga0501072_0028773_1352_1933 188
508 3300049591 Ga0501075_0050657 Ga0501075_0050657_1328_1909 188
509 3300049592 Ga0501076_0045816 Ga0501076_0045816_1903_2484 188
510 3300049741 Ga0501079_0062866 Ga0501079_0062866_1788_2369 188
511 3300049742 Ga0501080_0145010 Ga0501080_0145010_1379_1960 188
512 3300049743 Ga0501081_0222270 Ga0501081_0222270_368_949 188
513 3300049822 Ga0501035_0219973 Ga0501035_0219973_409_990 188
514 3300049823 Ga0501044_1064687 Ga0501044_1064687_15_596 188
515 3300050492 nmdc:mga0yw44_3077_c1 nmdc:mga0yw44_3077_c1_5876_6481 188
516 3300050507 nmdc:mga05p37_19710_c1 nmdc:mga05p37_19710_c1_5387_5992 188
517 3300050507 nmdc:mga05p37_393889_c1 nmdc:mga05p37_393889_c1_350_976 188
518 3300050511 nmdc:mga08y16_170967_c1 nmdc:mga08y16_170967_c1_1395_2000 188
519 3300050511 nmdc:mga08y16_378054_c1 nmdc:mga08y16_378054_c1_610_1185 188
520 3300050512 nmdc:mga0n895_40300_c1 nmdc:mga0n895_40300_c1_2743_3348 188
521 3300050512 nmdc:mga0n895_45630_c1 nmdc:mga0n895_45630_c1_2616_3242 188
522 3300050513 nmdc:mga0rr50_1901_c1 nmdc:mga0rr50_1901_c1_10368_10973 188
523 3300050514 nmdc:mga08x19_14562_c1 nmdc:mga08x19_14562_c1_2387_2992 188
524 3300050515 nmdc:mga0a205_7331_c1 nmdc:mga0a205_7331_c1_4655_5260 188
525 3300054114 Ga0501084_0129594 Ga0501084_0129594_1106_1687 188
526 3300060353 Ga0501082_0073915 Ga0501082_0073915_932_1513 188
527 3300061734 Ga0530510_0056671 Ga0530510_0056671_1437_2018 188
528 3300003203 JGI25406J46586_10009512 JGI25406J46586_100095123 189
529 3300005329 Ga0070683_100314250 Ga0070683_1003142503 189
530 3300005335 Ga0070666_10042517 Ga0070666_100425172 189
531 3300005347 Ga0070668_100012868 Ga0070668_1000128689 189
532 3300005367 Ga0070667_100001611 Ga0070667_10000161117 189
533 3300005618 Ga0068864_100898083 Ga0068864_1008980831 189
534 3300005842 Ga0068858_100447954 Ga0068858_1004479542 189
535 3300005843 Ga0068860_100071954 Ga0068860_1000719544 189
536 3300005844 Ga0068862_100001247 Ga0068862_10000124717 189
537 3300005937 Ga0081455_10011092 Ga0081455_100110928 189
538 3300005981 Ga0081538_10022726 Ga0081538_100227266 189
539 3300005981 Ga0081538_10076379 Ga0081538_100763793 189
540 3300005985 Ga0081539_10014550 Ga0081539_100145505 189
541 3300006846 Ga0075430_100049708 Ga0075430_1000497086 189
542 3300006847 Ga0075431_100348704 Ga0075431_1003487042 189
543 3300009553 Ga0105249_10003640 Ga0105249_1000364016 189
544 3300013296 Ga0157374_10610582 Ga0157374_106105822 189
545 3300014968 Ga0157379_10035775 Ga0157379_100357757 189
546 3300025321 Ga0207656_10001578 Ga0207656_100015788 189
547 3300025903 Ga0207680_10054402 Ga0207680_100544024 189
548 3300025904 Ga0207647_10089936 Ga0207647_100899363 189
549 3300025944 Ga0207661_10426537 Ga0207661_104265372 189
550 3300025961 Ga0207712_10003459 Ga0207712_100034596 189
551 3300025972 Ga0207668_10002563 Ga0207668_1000256313 189
552 3300025986 Ga0207658_10000840 Ga0207658_1000084021 189
553 3300028379 Ga0268266_10001628 Ga0268266_1000162821 189
554 3300028380 Ga0268265_10000667 Ga0268265_1000066736 189
555 3300028381 Ga0268264_10431947 Ga0268264_104319473 189
556 3300028563 Ga0265319_1000030 Ga0265319_100003046 189
557 3300028800 Ga0265338_10000156 Ga0265338_1000015646 189
558 3300029957 Ga0265324_10039877 Ga0265324_100398772 189
559 3300031241 Ga0265325_10024792 Ga0265325_100247924 189
560 3300031250 Ga0265331_10044959 Ga0265331_100449594 189
561 3300031595 Ga0265313_10055372 Ga0265313_100553724 189
562 3300031712 Ga0265342_10074519 Ga0265342_100745193 189
563 3300031731 Ga0307405_10039831 Ga0307405_100398314 189
564 3300031901 Ga0307406_10125836 Ga0307406_101258363 189
565 3300031901 Ga0307406_10351973 Ga0307406_103519732 189
566 3300031903 Ga0307407_10926402 Ga0307407_109264021 189
567 3300031995 Ga0307409_100077068 Ga0307409_1000770684 189
568 3300032002 Ga0307416_100279359 Ga0307416_1002793592 189
569 3300032004 Ga0307414_10277386 Ga0307414_102773862 189
570 3300032126 Ga0307415_100036284 Ga0307415_1000362844 189
571 3300045836 Ga0466958_0014240 Ga0466958_0014240_596_1396 189
572 3300046525 Ga0495663_0058419 Ga0495663_0058419_268_1056 189
573 3300046660 Ga0495625_0000109 Ga0495625_0000109_82859_83677 189
574 3300047320 Ga0495672_0103504 Ga0495672_0103504_760_1380 189
575 3300048913 Ga0496110_0289792 Ga0496110_0289792_244_1053 189
576 3300048921 Ga0496118_0123676 Ga0496118_0123676_480_1280 189
577 3300048929 Ga0496126_0128675 Ga0496126_0128675_33_833 189
578 3300049578 Ga0501042_0035728 Ga0501042_0035728_2007_2825 189
579 3300049586 Ga0501070_0262614 Ga0501070_0262614_685_1254 189
580 3300049588 Ga0501072_0131588 Ga0501072_0131588_87_854 189
581 3300049741 Ga0501079_0033610 Ga0501079_0033610_810_1577 189
582 3300050492 nmdc:mga0yw44_157392_c1 nmdc:mga0yw44_157392_c1_412_1173 189
583 3300050507 nmdc:mga05p37_650826_c1 nmdc:mga05p37_650826_c1_155_937 189
584 3300050509 nmdc:mga0qj67_83118_c1 nmdc:mga0qj67_83118_c1_911_1732 189
585 3300061734 Ga0530510_0070582 Ga0530510_0070582_1356_2123 189

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

93

186

0.99

PF00281

Ribosomal_L5

Ribosomal protein L5

33

89

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9801 10 184
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9735 10 184
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9733 10 184
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9731 10 184
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9593 10 184
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9146 11 184 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8951 11 184 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8777 33 184 3.30.1440.10
1jj2D00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8769 33 165 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.8727 29 186 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A3N5Q500-F1-model_v4 50S ribosomal protein L5 0.9605 9 129 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-F8KQ75-F1-model_v4 50S ribosomal protein L5 0.9566 11 129 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A0N0I4K0-F1-model_v4 deleted 0.9554 10 165
AF-A0A3B9SJT6-F1-model_v4 50S ribosomal protein L5 0.952 7 123 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7X4AP54-F1-model_v4 50S ribosomal protein L5 0.9514 9 138 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
76.77 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map