F466479
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 585 | 342 | 528 | 406 |
Family's Representative Sequence
| Representative Sequence | 3300046454|Ga0495592_0050946|Ga0495592_0050946_418_1842 |
| Length | 474 |
| Sequence | MVVRAGWRRWRPVGNIEADARDEHDVVHPTRPHDSLREHRACAEPAPGGMKPYEAASCHRAALRSTNGTPMPDIAKIIASFNAGRDPERLAMKYKAMRSSPFVFLRGTCHLFYERLPREKVLDDAPPVWICGDMHLENFGSYKADNRLIYFDNNDFDEACLAPALYELVRLLTSVLVGAADLKLSRAQALALCHTAVDAYGAALAVGKSRWIEAETAVGMVRDLFDALASRTRAAHLERRTVLKGKTRVLKVDGKKALPVTDEQRAAVTQFMQRFAASEPNPDFYRILDVARRIAGTGSLGVDRYVILVEGKGSPDGNYLIDLKEALPSSLTPHLHTPQPQWQTEAQRVVEVQRRNQAVSQAFLHAVDFNRRSYVLRSLQPSEDRVALSDWNGKLPRLEAVINSMAELSAWAHLRSGGRQKSSIADELIVFGNRKDWQLPLIDLATQCATQVGDDWKVYCEAFDRGGFEAGGKG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 2 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 3 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 4 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 5 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 6 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 7 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 8 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 9 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 10 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 11 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 12 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 13 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 14 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 15 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 16 | 2738541283 | Pedobacter sp. OK701 | Isolate | Unclassified |
| 17 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 18 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 19 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 20 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 21 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 22 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 23 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 24 | 2738543023 | Pedobacter sp. OK628 | Isolate | Unclassified |
| 25 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 26 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 27 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 28 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 29 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 30 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 31 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 32 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 33 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 34 | 2848694841 | Nostoc sp. RF31YmG | Isolate | Unclassified |
| 35 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 36 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 37 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 38 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 39 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 40 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 41 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 42 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 43 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 44 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 45 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 46 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 47 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 48 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 49 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 50 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 51 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 52 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 53 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 54 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 55 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 56 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 57 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 58 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 59 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 60 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 61 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 62 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 63 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 64 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 65 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 66 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 67 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 68 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 69 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 70 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 71 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 72 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 73 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 74 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 75 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 76 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 77 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 78 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 79 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 82 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 84 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 85 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 86 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 89 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 90 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 94 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 95 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 96 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 97 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 100 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 101 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 102 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 103 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 104 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 105 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 106 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 107 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 108 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009982 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 125 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 128 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 129 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 142 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 143 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 144 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 145 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 147 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 149 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 150 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 151 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 152 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 153 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 155 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 185 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 186 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 189 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 190 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 191 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 192 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 196 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 197 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 206 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 207 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 208 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 209 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 210 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 211 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 296 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 297 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 298 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 299 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 302 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 303 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 305 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 306 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 307 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 308 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 309 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 310 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 311 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 312 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 313 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 314 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 315 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 316 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 317 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 318 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 319 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 320 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 323 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 329 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 330 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 331 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 332 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 333 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 334 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 335 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 336 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 337 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 338 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 340 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 341 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 342 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.09 |
| Metatranscriptomes | 0.17 |
| Isolates | 9.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 16.07 |
| Nodule | 1.88 |
| Rhizoplane | 5.47 |
| Rhizosphere | 61.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 15.38 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10006707 | 3300001979 | Bacteria | 4743 |
| 2 | JGI24739J22299_10000637 | 3300001989 | Bacteria | 12629 |
| 3 | JGI24737J22298_10039946 | 3300001990 | Bacteria | 1441 |
| 4 | JGI25156J39149_1000203 | 3300002705 | Bacteria | 41070 |
| 5 | JGI25156J39149_1000978 | 3300002705 | Bacteria | 13628 |
| 6 | JGI25162J39368_1000083 | 3300002737 | Bacteria | 109521 |
| 7 | JGI25162J39368_1000152 | 3300002737 | Bacteria | 75441 |
| 8 | JGI25163J39215_1001584 | 3300002771 | Bacteria | 3448 |
| 9 | JGI25150J39212_1001106 | 3300002774 | Bacteria | 8134 |
| 10 | JGI25165J46597_1000064 | 3300003214 | Bacteria | 199878 |
| 11 | rootH1_10175801 | 3300003316 | Unclassified | 1967 |
| 12 | rootH2_10022331 | 3300003320 | Unclassified | 2913 |
| 13 | rootH2_10126121 | 3300003320 | Bacteria | 3455 |
| 14 | rootL2_10002802 | 3300003322 | Bacteria | 12820 |
| 15 | rootL2_10023011 | 3300003322 | Bacteria | 4608 |
| 16 | rootL2_10026352 | 3300003322 | Bacteria | 21410 |
| 17 | rootL2_10026353 | 3300003322 | Bacteria | 8336 |
| 18 | rootL2_10103277 | 3300003322 | Bacteria | 4029 |
| 19 | rootL2_10120755 | 3300003322 | Bacteria | 3798 |
| 20 | rootL2_10192769 | 3300003322 | Unclassified | 3277 |
| 21 | rootH1_10015716 | 3300003323 | Bacteria | 9779 |
| 22 | rootH1_10074395 | 3300003323 | Bacteria | 5596 |
| 23 | JGI25160J50197_1000080 | 3300003354 | Bacteria | 100869 |
| 24 | JGI25160J50197_1000964 | 3300003354 | Bacteria | 15026 |
| 25 | Ga0055538_1000031 | 3300003751 | Bacteria | 199878 |
| 26 | Ga0055539_1000041 | 3300003752 | Bacteria | 199878 |
| 27 | Ga0055533_1000051 | 3300003756 | Bacteria | 199878 |
| 28 | Ga0055525_1000061 | 3300003759 | Bacteria | 199878 |
| 29 | Ga0055535_1000338 | 3300003761 | Bacteria | 46755 |
| 30 | Ga0055542_1000103 | 3300003762 | Bacteria | 114989 |
| 31 | Ga0055529_1000076 | 3300003763 | Bacteria | 156104 |
| 32 | Ga0055526_1000259 | 3300003771 | Bacteria | 44717 |
| 33 | Ga0055537_1000106 | 3300003773 | Bacteria | 62947 |
| 34 | Ga0055524_1004631 | 3300003775 | Bacteria | 6311 |
| 35 | Ga0055536_1004894 | 3300003781 | Bacteria | 6685 |
| 36 | Ga0055536_1006116 | 3300003781 | Bacteria | 5695 |
| 37 | Ga0055534_1000355 | 3300003784 | Bacteria | 29272 |
| 38 | Ga0055528_1000011 | 3300003790 | Bacteria | 218512 |
| 39 | Ga0055530_10000237 | 3300003791 | Bacteria | 49495 |
| 40 | Ga0055530_10010353 | 3300003791 | Bacteria | 3456 |
| 41 | Ga0055540_1000436 | 3300003792 | Bacteria | 33152 |
| 42 | Ga0055531_10000447 | 3300003794 | Bacteria | 38464 |
| 43 | Ga0055541_1000028 | 3300003841 | Bacteria | 199878 |
| 44 | Ga0065165_1000211 | 3300005262 | Bacteria | 101389 |
| 45 | Ga0065704_10127031 | 3300005289 | Unclassified | 1677 |
| 46 | Ga0070670_100002808 | 3300005331 | Bacteria | 14404 |
| 47 | Ga0070666_10008348 | 3300005335 | Bacteria | 6425 |
| 48 | Ga0070666_10047779 | 3300005335 | Bacteria | 2874 |
| 49 | Ga0070660_100135872 | 3300005339 | Bacteria | 1970 |
| 50 | Ga0070661_100102163 | 3300005344 | Bacteria | 2134 |
| 51 | Ga0070661_100130917 | 3300005344 | Bacteria | 1884 |
| 52 | Ga0070659_100057036 | 3300005366 | Bacteria | 3079 |
| 53 | Ga0070667_100068884 | 3300005367 | Bacteria | 3011 |
| 54 | Ga0070662_100010365 | 3300005457 | Bacteria | 6111 |
| 55 | Ga0070662_100030750 | 3300005457 | Bacteria | 3761 |
| 56 | Ga0068867_100079914 | 3300005459 | Bacteria | 2462 |
| 57 | Ga0070707_100000015 | 3300005468 | Bacteria | 144611 |
| 58 | Ga0070679_100230383 | 3300005530 | Bacteria | 1812 |
| 59 | Ga0068853_100002802 | 3300005539 | Bacteria | 13190 |
| 60 | Ga0068853_100011400 | 3300005539 | Bacteria | 7220 |
| 61 | Ga0068853_100184792 | 3300005539 | Bacteria | 1891 |
| 62 | Ga0070665_100001686 | 3300005548 | Bacteria | 25467 |
| 63 | Ga0070665_100160850 | 3300005548 | Bacteria | 2248 |
| 64 | Ga0070664_100033377 | 3300005564 | Bacteria | 4311 |
| 65 | Ga0068857_100162089 | 3300005577 | Bacteria | 2029 |
| 66 | Ga0068854_100002447 | 3300005578 | Bacteria | 11487 |
| 67 | Ga0068852_100030106 | 3300005616 | Bacteria | 4465 |
| 68 | Ga0068852_100313484 | 3300005616 | Bacteria | 1522 |
| 69 | Ga0068858_100000825 | 3300005842 | Bacteria | 32311 |
| 70 | Ga0081540_1033130 | 3300005983 | Bacteria | 2810 |
| 71 | Ga0075368_10048407 | 3300006042 | Bacteria | 1685 |
| 72 | Ga0075370_10002667 | 3300006353 | Bacteria | 8340 |
| 73 | Ga0075428_100050916 | 3300006844 | Bacteria | 4541 |
| 74 | Ga0075433_10072710 | 3300006852 | Bacteria | 3024 |
| 75 | Ga0075433_10075279 | 3300006852 | Bacteria | 2970 |
| 76 | Ga0105251_10000278 | 3300009011 | Bacteria | 51440 |
| 77 | Ga0105244_10002309 | 3300009036 | Bacteria | 14495 |
| 78 | Ga0105240_10000551 | 3300009093 | Bacteria | 69267 |
| 79 | Ga0105240_10002995 | 3300009093 | Bacteria | 26581 |
| 80 | Ga0105240_10038859 | 3300009093 | Bacteria | 6101 |
| 81 | Ga0105240_10221984 | 3300009093 | Bacteria | 2201 |
| 82 | Ga0111539_10019163 | 3300009094 | Bacteria | 8452 |
| 83 | Ga0114129_10005656 | 3300009147 | Bacteria | 17691 |
| 84 | Ga0105243_10003224 | 3300009148 | Bacteria | 13329 |
| 85 | Ga0105241_10019938 | 3300009174 | Bacteria | 4950 |
| 86 | Ga0105237_10001115 | 3300009545 | Bacteria | 35967 |
| 87 | Ga0105237_10020124 | 3300009545 | Bacteria | 6888 |
| 88 | Ga0105237_10024972 | 3300009545 | Bacteria | 6113 |
| 89 | Ga0105237_10251413 | 3300009545 | Bacteria | 1770 |
| 90 | Ga0105238_10042933 | 3300009551 | Bacteria | 4576 |
| 91 | Ga0105238_10086241 | 3300009551 | Bacteria | 3127 |
| 92 | Ga0105238_10236971 | 3300009551 | Bacteria | 1802 |
| 93 | Ga0105249_10030868 | 3300009553 | Bacteria | 4845 |
| 94 | Ga0105249_10222707 | 3300009553 | Unclassified | 1857 |
| 95 | Ga0105147_100484 | 3300009982 | Bacteria | 3264 |
| 96 | Ga0105239_10001815 | 3300010375 | Bacteria | 27993 |
| 97 | Ga0105239_10002015 | 3300010375 | Bacteria | 26351 |
| 98 | Ga0105239_10018814 | 3300010375 | Bacteria | 7631 |
| 99 | Ga0105239_10037131 | 3300010375 | Bacteria | 5343 |
| 100 | Ga0157369_10062297 | 3300013105 | Unclassified | 4020 |
| 101 | Ga0157369_10074148 | 3300013105 | Bacteria | 3650 |
| 102 | Ga0157369_10207906 | 3300013105 | Bacteria | 2052 |
| 103 | Ga0157374_10002224 | 3300013296 | Bacteria | 16357 |
| 104 | Ga0157372_10018637 | 3300013307 | Bacteria | 7466 |
| 105 | Ga0157372_10051846 | 3300013307 | Bacteria | 4567 |
| 106 | Ga0157372_10075063 | 3300013307 | Bacteria | 3814 |
| 107 | Ga0157372_10564412 | 3300013307 | Bacteria | 1327 |
| 108 | Ga0182008_10001746 | 3300014497 | Bacteria | 14279 |
| 109 | Ga0182008_10002997 | 3300014497 | Bacteria | 10397 |
| 110 | Ga0182006_1005866 | 3300015261 | Bacteria | 5780 |
| 111 | Ga0182006_1007883 | 3300015261 | Bacteria | 4846 |
| 112 | Ga0182006_1013506 | 3300015261 | Bacteria | 3542 |
| 113 | Ga0182007_10000313 | 3300015262 | Bacteria | 30902 |
| 114 | Ga0182007_10000432 | 3300015262 | Bacteria | 25560 |
| 115 | Ga0182007_10003291 | 3300015262 | Bacteria | 7668 |
| 116 | Ga0182007_10023437 | 3300015262 | Bacteria | 2170 |
| 117 | Ga0182005_1003406 | 3300015265 | Bacteria | 5405 |
| 118 | Ga0183361_10002 | 3300016635 | Bacteria | 907642 |
| 119 | Ga0213872_10000001 | 3300021361 | Bacteria | 662532 |
| 120 | Ga0213872_10000040 | 3300021361 | Bacteria | 122419 |
| 121 | Ga0213872_10000139 | 3300021361 | Bacteria | 65459 |
| 122 | Ga0213872_10000744 | 3300021361 | Bacteria | 24091 |
| 123 | Ga0213872_10001832 | 3300021361 | Bacteria | 13186 |
| 124 | Ga0213872_10002839 | 3300021361 | Bacteria | 9904 |
| 125 | Ga0213872_10004883 | 3300021361 | Bacteria | 6987 |
| 126 | Ga0213872_10024022 | 3300021361 | Bacteria | 2803 |
| 127 | Ga0213872_10043563 | 3300021361 | Bacteria | 2044 |
| 128 | Ga0209760_102590 | 3300025207 | Bacteria | 1674 |
| 129 | Ga0209784_100039 | 3300025224 | Bacteria | 232021 |
| 130 | Ga0209566_100023 | 3300025225 | Bacteria | 396571 |
| 131 | Ga0209674_100040 | 3300025226 | Bacteria | 396571 |
| 132 | Ga0209672_100869 | 3300025228 | Bacteria | 13849 |
| 133 | Ga0209672_106428 | 3300025228 | Bacteria | 1911 |
| 134 | Ga0209147_102071 | 3300025229 | Bacteria | 5676 |
| 135 | Ga0209563_100072 | 3300025230 | Bacteria | 232021 |
| 136 | Ga0209437_100097 | 3300025233 | Bacteria | 232021 |
| 137 | Ga0209258_100133 | 3300025242 | Bacteria | 174846 |
| 138 | Ga0207425_1000877 | 3300025245 | Bacteria | 14687 |
| 139 | Ga0207425_1001817 | 3300025245 | Bacteria | 8267 |
| 140 | Ga0209677_100041 | 3300025253 | Bacteria | 232021 |
| 141 | Ga0209148_1000188 | 3300025254 | Bacteria | 117310 |
| 142 | Ga0209759_1000010 | 3300025256 | Bacteria | 430463 |
| 143 | Ga0209759_1001343 | 3300025256 | Bacteria | 14348 |
| 144 | Ga0209129_1000245 | 3300025258 | Bacteria | 56975 |
| 145 | Ga0209233_1000122 | 3300025261 | Bacteria | 232021 |
| 146 | Ga0209565_1000003 | 3300025263 | Bacteria | 1099648 |
| 147 | Ga0209565_1000165 | 3300025263 | Bacteria | 86871 |
| 148 | Ga0209455_1000073 | 3300025272 | Bacteria | 291417 |
| 149 | Ga0209673_1000003 | 3300025273 | Bacteria | 980859 |
| 150 | Ga0209673_1000454 | 3300025273 | Bacteria | 69331 |
| 151 | Ga0209130_1000427 | 3300025284 | Bacteria | 45224 |
| 152 | Ga0209675_1000003 | 3300025291 | Bacteria | 1003982 |
| 153 | Ga0209675_1000321 | 3300025291 | Bacteria | 43024 |
| 154 | Ga0209675_1006477 | 3300025291 | Bacteria | 4685 |
| 155 | Ga0209676_1000111 | 3300025292 | Bacteria | 213411 |
| 156 | Ga0209676_1000880 | 3300025292 | Bacteria | 38456 |
| 157 | Ga0209025_1000615 | 3300025294 | Bacteria | 64022 |
| 158 | Ga0209025_1001104 | 3300025294 | Bacteria | 38839 |
| 159 | Ga0209025_1004533 | 3300025294 | Bacteria | 11984 |
| 160 | Ga0209564_1000070 | 3300025295 | Bacteria | 303126 |
| 161 | Ga0209564_1000249 | 3300025295 | Bacteria | 115584 |
| 162 | Ga0209564_1000352 | 3300025295 | Bacteria | 85941 |
| 163 | Ga0209564_1004633 | 3300025295 | Bacteria | 8273 |
| 164 | Ga0209758_1000297 | 3300025297 | Bacteria | 97664 |
| 165 | Ga0209758_1000343 | 3300025297 | Bacteria | 85198 |
| 166 | Ga0209758_1014472 | 3300025297 | Bacteria | 4190 |
| 167 | Ga0209050_1000111 | 3300025298 | Bacteria | 213411 |
| 168 | Ga0209050_1001354 | 3300025298 | Bacteria | 26840 |
| 169 | Ga0209256_1000029 | 3300025299 | Bacteria | 415922 |
| 170 | Ga0209256_1000047 | 3300025299 | Bacteria | 314709 |
| 171 | Ga0209256_1000238 | 3300025299 | Bacteria | 97664 |
| 172 | Ga0207426_1000021 | 3300025302 | Bacteria | 556343 |
| 173 | Ga0207426_1000089 | 3300025302 | Bacteria | 281224 |
| 174 | Ga0207426_1000194 | 3300025302 | Bacteria | 150009 |
| 175 | Ga0207426_1000294 | 3300025302 | Bacteria | 98700 |
| 176 | Ga0209051_1000340 | 3300025303 | Bacteria | 70080 |
| 177 | Ga0209051_1000669 | 3300025303 | Bacteria | 38479 |
| 178 | Ga0209257_1000149 | 3300025304 | Bacteria | 192835 |
| 179 | Ga0209257_1000344 | 3300025304 | Bacteria | 96578 |
| 180 | Ga0209257_1005188 | 3300025304 | Bacteria | 9372 |
| 181 | Ga0207656_10002283 | 3300025321 | Bacteria | 6432 |
| 182 | Ga0207655_1003116 | 3300025728 | Bacteria | 12574 |
| 183 | Ga0207713_1000190 | 3300025735 | Bacteria | 86070 |
| 184 | Ga0207680_10006967 | 3300025903 | Bacteria | 5482 |
| 185 | Ga0207680_10028575 | 3300025903 | Bacteria | 3121 |
| 186 | Ga0207680_10084315 | 3300025903 | Bacteria | 2005 |
| 187 | Ga0207647_10001230 | 3300025904 | Bacteria | 19719 |
| 188 | Ga0207647_10010390 | 3300025904 | Bacteria | 6575 |
| 189 | Ga0207647_10015594 | 3300025904 | Bacteria | 5204 |
| 190 | Ga0207654_10032284 | 3300025911 | Bacteria | 2892 |
| 191 | Ga0207695_10000016 | 3300025913 | Bacteria | 771991 |
| 192 | Ga0207695_10000758 | 3300025913 | Bacteria | 62084 |
| 193 | Ga0207695_10019213 | 3300025913 | Bacteria | 7869 |
| 194 | Ga0207695_10033988 | 3300025913 | Bacteria | 5552 |
| 195 | Ga0207671_10017877 | 3300025914 | Bacteria | 5453 |
| 196 | Ga0207671_10034970 | 3300025914 | Bacteria | 3731 |
| 197 | Ga0207671_10049687 | 3300025914 | Bacteria | 3105 |
| 198 | Ga0207649_10036869 | 3300025920 | Bacteria | 2949 |
| 199 | Ga0207646_10000025 | 3300025922 | Bacteria | 248680 |
| 200 | Ga0207694_10001284 | 3300025924 | Bacteria | 21647 |
| 201 | Ga0207706_10005691 | 3300025933 | Bacteria | 11609 |
| 202 | Ga0207706_10013523 | 3300025933 | Bacteria | 7418 |
| 203 | Ga0207709_10001115 | 3300025935 | Bacteria | 19678 |
| 204 | Ga0207679_10038927 | 3300025945 | Bacteria | 3393 |
| 205 | Ga0207667_10168766 | 3300025949 | Bacteria | 2249 |
| 206 | Ga0207712_10000731 | 3300025961 | Bacteria | 24976 |
| 207 | Ga0207640_10175919 | 3300025981 | Bacteria | 1600 |
| 208 | Ga0207658_10035689 | 3300025986 | Bacteria | 3562 |
| 209 | Ga0207703_10000503 | 3300026035 | Bacteria | 40482 |
| 210 | Ga0207639_10001076 | 3300026041 | Bacteria | 18520 |
| 211 | Ga0207639_10032862 | 3300026041 | Bacteria | 3823 |
| 212 | Ga0207639_10106608 | 3300026041 | Bacteria | 2275 |
| 213 | Ga0207678_10002350 | 3300026067 | Bacteria | 17162 |
| 214 | Ga0207702_10119631 | 3300026078 | Bacteria | 2355 |
| 215 | Ga0207674_10024646 | 3300026116 | Bacteria | 6425 |
| 216 | Ga0207683_10230902 | 3300026121 | Bacteria | 1687 |
| 217 | Ga0207698_10267279 | 3300026142 | Bacteria | 1574 |
| 218 | Ga0268266_10000006 | 3300028379 | Bacteria | 1410021 |
| 219 | Ga0265334_10001873 | 3300028573 | Bacteria | 9987 |
| 220 | Ga0265334_10038951 | 3300028573 | Bacteria | 1867 |
| 221 | Ga0307517_10004553 | 3300028786 | Bacteria | 21271 |
| 222 | Ga0307517_10062588 | 3300028786 | Bacteria | 3496 |
| 223 | Ga0307515_10000006 | 3300028794 | Bacteria | 725810 |
| 224 | Ga0307515_10003072 | 3300028794 | Bacteria | 35359 |
| 225 | Ga0307515_10003775 | 3300028794 | Bacteria | 31740 |
| 226 | Ga0307515_10060273 | 3300028794 | Bacteria | 5417 |
| 227 | Ga0265338_10000092 | 3300028800 | Bacteria | 168538 |
| 228 | Ga0265328_10003427 | 3300031239 | Bacteria | 7005 |
| 229 | Ga0265331_10001700 | 3300031250 | Bacteria | 15866 |
| 230 | Ga0265327_10000199 | 3300031251 | Bacteria | 125838 |
| 231 | Ga0265327_10000217 | 3300031251 | Bacteria | 117085 |
| 232 | Ga0265327_10002047 | 3300031251 | Bacteria | 22684 |
| 233 | Ga0265327_10002400 | 3300031251 | Bacteria | 19882 |
| 234 | Ga0265327_10013587 | 3300031251 | Bacteria | 5400 |
| 235 | Ga0265316_10137959 | 3300031344 | Bacteria | 1834 |
| 236 | Ga0307513_10197277 | 3300031456 | Bacteria | 1858 |
| 237 | Ga0307509_10000018 | 3300031507 | Bacteria | 258998 |
| 238 | Ga0307408_100004702 | 3300031548 | Bacteria | 9222 |
| 239 | Ga0307508_10000357 | 3300031616 | Bacteria | 55613 |
| 240 | Ga0307508_10008282 | 3300031616 | Bacteria | 9624 |
| 241 | Ga0307514_10006151 | 3300031649 | Bacteria | 10532 |
| 242 | Ga0265314_10074454 | 3300031711 | Bacteria | 2262 |
| 243 | Ga0265314_10106053 | 3300031711 | Bacteria | 1796 |
| 244 | Ga0307516_10210867 | 3300031730 | Bacteria | 1657 |
| 245 | Ga0307412_10000002 | 3300031911 | Bacteria | 743446 |
| 246 | Ga0373932_0003554 | 3300035112 | Bacteria | 3736 |
| 247 | Ga0373931_0047018 | 3300035691 | Bacteria | 2283 |
| 248 | Ga0373937_0107146 | 3300036401 | Bacteria | 2598 |
| 249 | Ga0395900_0000585 | 3300037418 | Bacteria | 50049 |
| 250 | Ga0395905_0000003 | 3300037471 | Bacteria | 1347396 |
| 251 | Ga0395905_0000004 | 3300037471 | Bacteria | 674991 |
| 252 | Ga0436361_0106476 | 3300039447 | Bacteria | 19218 |
| 253 | Ga0436361_0404657 | 3300039447 | Bacteria | 144351 |
| 254 | Ga0436361_0431677 | 3300039447 | Bacteria | 31322 |
| 255 | Ga0436361_0632398 | 3300039447 | Bacteria | 1680 |
| 256 | Ga0436361_0734234 | 3300039447 | Bacteria | 30887 |
| 257 | Ga0436361_0837010 | 3300039447 | Bacteria | 7329 |
| 258 | Ga0436361_0953601 | 3300039447 | Bacteria | 68101 |
| 259 | Ga0436361_1021320 | 3300039447 | Bacteria | 6546 |
| 260 | Ga0451577_0030468 | 3300042876 | Bacteria | 4875 |
| 261 | Ga0451577_0158103 | 3300042876 | Bacteria | 2040 |
| 262 | Ga0453684_0011915 | 3300044712 | Bacteria | 14477 |
| 263 | Ga0453684_0046108 | 3300044712 | Bacteria | 5803 |
| 264 | Ga0453684_0446073 | 3300044712 | Bacteria | 1441 |
| 265 | Ga0466968_0015258 | 3300044735 | Bacteria | 3043 |
| 266 | Ga0466957_0000181 | 3300044842 | Bacteria | 28481 |
| 267 | Ga0451576_0001296 | 3300045051 | Bacteria | 43303 |
| 268 | Ga0451576_0200431 | 3300045051 | Bacteria | 2085 |
| 269 | Ga0451576_0309321 | 3300045051 | Bacteria | 1653 |
| 270 | Ga0495617_037283 | 3300046452 | Unclassified | 1629 |
| 271 | Ga0495627_019615 | 3300046453 | Unclassified | 2264 |
| 272 | Ga0495592_0012215 | 3300046454 | Bacteria | 6517 |
| 273 | Ga0495592_0050946 | 3300046454 | Bacteria | 3075 |
| 274 | Ga0495603_0000664 | 3300046455 | Bacteria | 19449 |
| 275 | Ga0495603_0007069 | 3300046455 | Bacteria | 6733 |
| 276 | Ga0495591_002573 | 3300046458 | Bacteria | 9975 |
| 277 | Ga0495629_0000031 | 3300046459 | Bacteria | 124543 |
| 278 | Ga0495629_0002543 | 3300046459 | Bacteria | 13987 |
| 279 | Ga0495629_0007083 | 3300046459 | Bacteria | 8263 |
| 280 | Ga0495638_0053773 | 3300046460 | Bacteria | 2505 |
| 281 | Ga0495641_0005699 | 3300046461 | Bacteria | 8292 |
| 282 | Ga0495651_0002782 | 3300046462 | Bacteria | 13570 |
| 283 | Ga0495651_0076834 | 3300046462 | Bacteria | 2528 |
| 284 | Ga0495653_0000258 | 3300046463 | Bacteria | 42640 |
| 285 | Ga0495653_0000389 | 3300046463 | Bacteria | 35173 |
| 286 | Ga0495653_0000968 | 3300046463 | Bacteria | 22029 |
| 287 | Ga0495653_0047127 | 3300046463 | Bacteria | 3335 |
| 288 | Ga0495650_0002679 | 3300046471 | Bacteria | 13854 |
| 289 | Ga0495580_0000021 | 3300046472 | Bacteria | 90091 |
| 290 | Ga0495580_0000076 | 3300046472 | Bacteria | 61810 |
| 291 | Ga0495580_0002282 | 3300046472 | Bacteria | 16733 |
| 292 | Ga0495580_0036545 | 3300046472 | Bacteria | 3525 |
| 293 | Ga0495580_0045898 | 3300046472 | Bacteria | 3102 |
| 294 | Ga0495580_0113504 | 3300046472 | Bacteria | 1882 |
| 295 | Ga0495582_0000782 | 3300046473 | Bacteria | 17621 |
| 296 | Ga0495605_0001421 | 3300046474 | Bacteria | 15693 |
| 297 | Ga0495605_0024007 | 3300046474 | Bacteria | 3196 |
| 298 | Ga0495639_0013282 | 3300046475 | Bacteria | 3554 |
| 299 | Ga0495662_0044404 | 3300046476 | Bacteria | 2146 |
| 300 | Ga0495664_0002445 | 3300046477 | Bacteria | 9991 |
| 301 | Ga0495585_0017898 | 3300046492 | Bacteria | 4089 |
| 302 | Ga0495596_0009489 | 3300046500 | Bacteria | 4279 |
| 303 | Ga0495596_0052628 | 3300046500 | Bacteria | 1594 |
| 304 | Ga0495607_0015768 | 3300046501 | Bacteria | 4890 |
| 305 | Ga0495583_0000014 | 3300046506 | Bacteria | 320136 |
| 306 | Ga0495583_0002195 | 3300046506 | Bacteria | 17339 |
| 307 | Ga0495583_0004445 | 3300046506 | Bacteria | 10028 |
| 308 | Ga0495608_0005115 | 3300046511 | Bacteria | 9372 |
| 309 | Ga0495608_0012300 | 3300046511 | Bacteria | 5945 |
| 310 | Ga0495608_0027059 | 3300046511 | Bacteria | 3904 |
| 311 | Ga0495610_0002532 | 3300046512 | Bacteria | 15252 |
| 312 | Ga0495610_0003281 | 3300046512 | Bacteria | 12746 |
| 313 | Ga0495616_0000350 | 3300046513 | Bacteria | 36334 |
| 314 | Ga0495616_0016292 | 3300046513 | Bacteria | 4117 |
| 315 | Ga0495618_0010899 | 3300046514 | Bacteria | 5505 |
| 316 | Ga0495620_0005682 | 3300046515 | Bacteria | 6943 |
| 317 | Ga0495620_0078404 | 3300046515 | Bacteria | 1339 |
| 318 | Ga0495628_0001230 | 3300046516 | Bacteria | 23436 |
| 319 | Ga0495628_0001786 | 3300046516 | Bacteria | 19559 |
| 320 | Ga0495628_0003210 | 3300046516 | Bacteria | 14659 |
| 321 | Ga0495628_0003625 | 3300046516 | Bacteria | 13799 |
| 322 | Ga0495628_0062998 | 3300046516 | Bacteria | 2906 |
| 323 | Ga0495628_0102381 | 3300046516 | Bacteria | 2209 |
| 324 | Ga0495630_0001412 | 3300046517 | Bacteria | 16602 |
| 325 | Ga0495630_0004733 | 3300046517 | Bacteria | 9547 |
| 326 | Ga0495631_0000182 | 3300046518 | Bacteria | 42891 |
| 327 | Ga0495643_0000051 | 3300046522 | Bacteria | 207804 |
| 328 | Ga0495644_0001629 | 3300046523 | Bacteria | 9146 |
| 329 | Ga0495648_0004257 | 3300046524 | Bacteria | 12278 |
| 330 | Ga0495648_0018651 | 3300046524 | Bacteria | 4901 |
| 331 | Ga0495648_0030635 | 3300046524 | Bacteria | 3553 |
| 332 | Ga0495648_0054026 | 3300046524 | Bacteria | 2429 |
| 333 | Ga0495648_0067362 | 3300046524 | Bacteria | 2094 |
| 334 | Ga0495648_0084369 | 3300046524 | Bacteria | 1797 |
| 335 | Ga0495666_0000060 | 3300046526 | Bacteria | 41912 |
| 336 | Ga0495666_0002840 | 3300046526 | Bacteria | 8667 |
| 337 | Ga0495666_0029423 | 3300046526 | Bacteria | 2702 |
| 338 | Ga0495666_0040869 | 3300046526 | Bacteria | 2248 |
| 339 | Ga0495652_0001838 | 3300046529 | Bacteria | 22545 |
| 340 | Ga0495652_0016504 | 3300046529 | Bacteria | 6605 |
| 341 | Ga0495652_0038138 | 3300046529 | Bacteria | 4164 |
| 342 | Ga0495652_0156017 | 3300046529 | Bacteria | 1777 |
| 343 | Ga0495665_0001624 | 3300046531 | Bacteria | 12037 |
| 344 | Ga0495640_0009140 | 3300046533 | Bacteria | 7737 |
| 345 | Ga0495640_0012832 | 3300046533 | Bacteria | 6392 |
| 346 | Ga0495586_0002855 | 3300046535 | Bacteria | 9333 |
| 347 | Ga0495587_0002127 | 3300046536 | Bacteria | 13241 |
| 348 | Ga0495587_0010656 | 3300046536 | Bacteria | 5839 |
| 349 | Ga0495609_0001951 | 3300046538 | Bacteria | 13109 |
| 350 | Ga0495609_0036797 | 3300046538 | Bacteria | 2209 |
| 351 | Ga0495621_0022001 | 3300046539 | Bacteria | 2108 |
| 352 | Ga0495597_0002758 | 3300046542 | Bacteria | 10818 |
| 353 | Ga0495645_0000671 | 3300046543 | Bacteria | 23558 |
| 354 | Ga0495645_0046744 | 3300046543 | Bacteria | 3154 |
| 355 | Ga0495645_0056436 | 3300046543 | Bacteria | 2851 |
| 356 | Ga0495645_0211967 | 3300046543 | Bacteria | 1307 |
| 357 | Ga0495622_0001070 | 3300046557 | Bacteria | 14421 |
| 358 | Ga0495633_0000123 | 3300046558 | Bacteria | 104682 |
| 359 | Ga0495656_0018478 | 3300046615 | Bacteria | 2677 |
| 360 | Ga0495668_0041225 | 3300046616 | Bacteria | 2573 |
| 361 | Ga0495634_0002070 | 3300046642 | Bacteria | 16973 |
| 362 | Ga0495634_0168142 | 3300046642 | Bacteria | 1379 |
| 363 | Ga0495611_0001934 | 3300046648 | Bacteria | 9845 |
| 364 | Ga0495625_0006109 | 3300046660 | Bacteria | 10791 |
| 365 | Ga0495625_0009265 | 3300046660 | Bacteria | 8260 |
| 366 | Ga0495625_0057147 | 3300046660 | Bacteria | 2775 |
| 367 | Ga0495625_0071832 | 3300046660 | Bacteria | 2428 |
| 368 | Ga0495625_0073987 | 3300046660 | Bacteria | 2387 |
| 369 | Ga0495625_0161344 | 3300046660 | Bacteria | 1502 |
| 370 | Ga0495635_0002052 | 3300046663 | Bacteria | 13648 |
| 371 | Ga0495635_0002302 | 3300046663 | Bacteria | 12987 |
| 372 | Ga0495635_0006292 | 3300046663 | Bacteria | 8271 |
| 373 | Ga0495635_0159437 | 3300046663 | Bacteria | 1535 |
| 374 | Ga0495659_0002131 | 3300046664 | Bacteria | 6452 |
| 375 | Ga0495661_0001386 | 3300046665 | Bacteria | 20365 |
| 376 | Ga0495661_0002010 | 3300046665 | Bacteria | 16034 |
| 377 | Ga0495657_0022156 | 3300046675 | Bacteria | 4555 |
| 378 | Ga0495657_0082010 | 3300046675 | Bacteria | 2085 |
| 379 | Ga0495599_0006398 | 3300046678 | Bacteria | 7103 |
| 380 | Ga0495599_0012315 | 3300046678 | Bacteria | 5268 |
| 381 | Ga0495599_0065516 | 3300046678 | Bacteria | 2269 |
| 382 | Ga0495623_0003661 | 3300046679 | Bacteria | 10156 |
| 383 | Ga0495623_0012713 | 3300046679 | Bacteria | 5449 |
| 384 | Ga0495623_0018755 | 3300046679 | Bacteria | 4467 |
| 385 | Ga0495646_0000327 | 3300046680 | Bacteria | 24455 |
| 386 | Ga0495646_0000922 | 3300046680 | Bacteria | 16703 |
| 387 | Ga0495646_0003965 | 3300046680 | Bacteria | 9258 |
| 388 | Ga0495658_0001174 | 3300046683 | Bacteria | 13812 |
| 389 | Ga0495613_0000484 | 3300046689 | Bacteria | 33725 |
| 390 | Ga0495613_0010858 | 3300046689 | Bacteria | 6757 |
| 391 | Ga0495624_0006440 | 3300046690 | Bacteria | 8331 |
| 392 | Ga0495624_0006600 | 3300046690 | Bacteria | 8214 |
| 393 | Ga0495624_0016215 | 3300046690 | Bacteria | 5016 |
| 394 | Ga0495624_0016853 | 3300046690 | Bacteria | 4916 |
| 395 | Ga0495624_0028769 | 3300046690 | Bacteria | 3628 |
| 396 | Ga0495624_0148963 | 3300046690 | Bacteria | 1432 |
| 397 | Ga0495670_0030233 | 3300046691 | Bacteria | 2690 |
| 398 | Ga0495671_0055284 | 3300046692 | Bacteria | 1966 |
| 399 | Ga0495671_0090597 | 3300046692 | Bacteria | 1497 |
| 400 | Ga0495649_0010756 | 3300046694 | Bacteria | 5391 |
| 401 | Ga0495649_0061822 | 3300046694 | Bacteria | 2013 |
| 402 | Ga0495649_0067734 | 3300046694 | Bacteria | 1915 |
| 403 | Ga0495589_0030159 | 3300046794 | Bacteria | 2732 |
| 404 | Ga0495600_0000903 | 3300046809 | Bacteria | 15902 |
| 405 | Ga0495600_0008523 | 3300046809 | Bacteria | 6303 |
| 406 | Ga0495581_0000109 | 3300047315 | Bacteria | 34524 |
| 407 | Ga0495604_0007596 | 3300047317 | Bacteria | 8582 |
| 408 | Ga0495604_0034859 | 3300047317 | Bacteria | 3977 |
| 409 | Ga0495636_0008752 | 3300047318 | Bacteria | 3990 |
| 410 | Ga0495674_0008626 | 3300047319 | Bacteria | 9694 |
| 411 | Ga0495674_0014957 | 3300047319 | Bacteria | 7264 |
| 412 | Ga0495674_0024938 | 3300047319 | Bacteria | 5488 |
| 413 | Ga0495674_0035881 | 3300047319 | Bacteria | 4469 |
| 414 | Ga0495674_0149020 | 3300047319 | Bacteria | 1962 |
| 415 | Ga0495672_0000030 | 3300047320 | Bacteria | 305021 |
| 416 | Ga0495672_0010466 | 3300047320 | Bacteria | 6605 |
| 417 | Ga0495676_0000589 | 3300047321 | Bacteria | 30003 |
| 418 | Ga0495676_0023154 | 3300047321 | Bacteria | 5394 |
| 419 | Ga0495676_0033937 | 3300047321 | Bacteria | 4288 |
| 420 | Ga0495680_0010735 | 3300047322 | Bacteria | 8162 |
| 421 | Ga0495683_0002068 | 3300047323 | Bacteria | 12436 |
| 422 | Ga0495683_0024408 | 3300047323 | Bacteria | 3102 |
| 423 | Ga0495687_001381 | 3300047443 | Bacteria | 22447 |
| 424 | Ga0495675_0001280 | 3300047444 | Bacteria | 15253 |
| 425 | Ga0495675_0015162 | 3300047444 | Bacteria | 4872 |
| 426 | Ga0495677_0001585 | 3300047445 | Bacteria | 9169 |
| 427 | Ga0495679_000006 | 3300047446 | Bacteria | 449956 |
| 428 | Ga0495679_000464 | 3300047446 | Bacteria | 29754 |
| 429 | Ga0495679_001198 | 3300047446 | Bacteria | 15417 |
| 430 | Ga0495685_000071 | 3300047447 | Bacteria | 38265 |
| 431 | Ga0495673_0000012 | 3300047469 | Bacteria | 656908 |
| 432 | Ga0495673_0004686 | 3300047469 | Bacteria | 8491 |
| 433 | Ga0495684_0015787 | 3300047471 | Bacteria | 5812 |
| 434 | Ga0495684_0028956 | 3300047471 | Bacteria | 4250 |
| 435 | Ga0495686_0000625 | 3300047472 | Bacteria | 48634 |
| 436 | Ga0495593_0006168 | 3300047673 | Bacteria | 7051 |
| 437 | Ga0495593_0006631 | 3300047673 | Bacteria | 6774 |
| 438 | Ga0495593_0023304 | 3300047673 | Bacteria | 3442 |
| 439 | Ga0495602_0015557 | 3300048088 | Bacteria | 7671 |
| 440 | Ga0495602_0063208 | 3300048088 | Bacteria | 3208 |
| 441 | Ga0495614_0007239 | 3300048089 | Bacteria | 4944 |
| 442 | Ga0495614_0010109 | 3300048089 | Bacteria | 4164 |
| 443 | Ga0495626_0014982 | 3300048091 | Bacteria | 3978 |
| 444 | Ga0495626_0016445 | 3300048091 | Bacteria | 3756 |
| 445 | Ga0495626_0019656 | 3300048091 | Bacteria | 3376 |
| 446 | Ga0496100_0000624 | 3300048903 | Bacteria | 16781 |
| 447 | Ga0496100_0002907 | 3300048903 | Bacteria | 8795 |
| 448 | Ga0496101_0004067 | 3300048904 | Bacteria | 9144 |
| 449 | Ga0496101_0004895 | 3300048904 | Bacteria | 8502 |
| 450 | Ga0496101_0009712 | 3300048904 | Bacteria | 6333 |
| 451 | Ga0496102_0000161 | 3300048905 | Bacteria | 90439 |
| 452 | Ga0496102_0012843 | 3300048905 | Bacteria | 7249 |
| 453 | Ga0496103_0000247 | 3300048906 | Bacteria | 52403 |
| 454 | Ga0496103_0014464 | 3300048906 | Bacteria | 4685 |
| 455 | Ga0496103_0018811 | 3300048906 | Bacteria | 4147 |
| 456 | Ga0496104_0038880 | 3300048907 | Bacteria | 4453 |
| 457 | Ga0496104_0231076 | 3300048907 | Bacteria | 1761 |
| 458 | Ga0496105_0011662 | 3300048908 | Bacteria | 6954 |
| 459 | Ga0496105_0026962 | 3300048908 | Bacteria | 4690 |
| 460 | Ga0496105_0148038 | 3300048908 | Bacteria | 1931 |
| 461 | Ga0496106_0011528 | 3300048909 | Bacteria | 6536 |
| 462 | Ga0496107_0067556 | 3300048910 | Bacteria | 2594 |
| 463 | Ga0496108_0026680 | 3300048911 | Bacteria | 4767 |
| 464 | Ga0496108_0062085 | 3300048911 | Bacteria | 3146 |
| 465 | Ga0496109_0052167 | 3300048912 | Bacteria | 3727 |
| 466 | Ga0496110_0009042 | 3300048913 | Bacteria | 8039 |
| 467 | Ga0496110_0025448 | 3300048913 | Bacteria | 5057 |
| 468 | Ga0496111_0020486 | 3300048914 | Bacteria | 4604 |
| 469 | Ga0496112_0054005 | 3300048915 | Bacteria | 3947 |
| 470 | Ga0496112_0280846 | 3300048915 | Bacteria | 1612 |
| 471 | Ga0496113_0000639 | 3300048916 | Bacteria | 17622 |
| 472 | Ga0496113_0262034 | 3300048916 | Bacteria | 1381 |
| 473 | Ga0496114_0073966 | 3300048917 | Bacteria | 2868 |
| 474 | Ga0496116_0013171 | 3300048919 | Bacteria | 6691 |
| 475 | Ga0496116_0019139 | 3300048919 | Bacteria | 5251 |
| 476 | Ga0496117_0000722 | 3300048920 | Bacteria | 52144 |
| 477 | Ga0496117_0004180 | 3300048920 | Bacteria | 16143 |
| 478 | Ga0496117_0018633 | 3300048920 | Bacteria | 5739 |
| 479 | Ga0496117_0019390 | 3300048920 | Bacteria | 5587 |
| 480 | Ga0496118_0000441 | 3300048921 | Bacteria | 68784 |
| 481 | Ga0496118_0001077 | 3300048921 | Bacteria | 42600 |
| 482 | Ga0496118_0003693 | 3300048921 | Bacteria | 18967 |
| 483 | Ga0496118_0005177 | 3300048921 | Bacteria | 14937 |
| 484 | Ga0496118_0017580 | 3300048921 | Bacteria | 6500 |
| 485 | Ga0496118_0027917 | 3300048921 | Bacteria | 4766 |
| 486 | Ga0496118_0031770 | 3300048921 | Bacteria | 4367 |
| 487 | Ga0496119_0021540 | 3300048922 | Bacteria | 4654 |
| 488 | Ga0496121_0001960 | 3300048924 | Bacteria | 32769 |
| 489 | Ga0496121_0008923 | 3300048924 | Bacteria | 11638 |
| 490 | Ga0496121_0009766 | 3300048924 | Bacteria | 10973 |
| 491 | Ga0496121_0032981 | 3300048924 | Bacteria | 4696 |
| 492 | Ga0496121_0035896 | 3300048924 | Bacteria | 4429 |
| 493 | Ga0496122_0011093 | 3300048925 | Bacteria | 9187 |
| 494 | Ga0496122_0094161 | 3300048925 | Bacteria | 2029 |
| 495 | Ga0496123_0020940 | 3300048926 | Bacteria | 5097 |
| 496 | Ga0496123_0047154 | 3300048926 | Bacteria | 2915 |
| 497 | Ga0496123_0069849 | 3300048926 | Bacteria | 2202 |
| 498 | Ga0496124_0065827 | 3300048927 | Bacteria | 3020 |
| 499 | Ga0496125_0020286 | 3300048928 | Bacteria | 6240 |
| 500 | Ga0496125_0032846 | 3300048928 | Bacteria | 4603 |
| 501 | Ga0496126_0000102 | 3300048929 | Bacteria | 201540 |
| 502 | Ga0496126_0005701 | 3300048929 | Bacteria | 14110 |
| 503 | Ga0496126_0027379 | 3300048929 | Bacteria | 5445 |
| 504 | Ga0495678_000040 | 3300049459 | Bacteria | 190664 |
| 505 | Ga0495678_005736 | 3300049459 | Bacteria | 6747 |
| 506 | Ga0495678_010880 | 3300049459 | Bacteria | 4388 |
| 507 | Ga0495682_0002519 | 3300049460 | Bacteria | 8650 |
| 508 | Ga0495682_0014965 | 3300049460 | Bacteria | 2940 |
| 509 | nmdc:mga0k408_105400_c1 | 3300050493 | Bacteria | 1664 |
| 510 | nmdc:mga07m45_31431_c1 | 3300050496 | Bacteria | 2943 |
| 511 | nmdc:mga05p37_1576_c1 | 3300050507 | Bacteria | 19968 |
| 512 | nmdc:mga06r32_156666_c1 | 3300050510 | Bacteria | 2259 |
| 513 | nmdc:mga0a205_274606_c1 | 3300050515 | Bacteria | 1562 |
| 514 | nmdc:mga0a205_45791_c1 | 3300050515 | Bacteria | 4219 |
| 515 | Ga0495601_0003095 | 3300053077 | Bacteria | 9496 |
| 516 | Ga0495601_0037438 | 3300053077 | Bacteria | 3033 |
| 517 | Ga0500650_0004587 | 3300053098 | Bacteria | 5017 |
| 518 | Ga0500562_000058 | 3300053108 | Bacteria | 54762 |
| 519 | Ga0500594_0003130 | 3300053118 | Bacteria | 3615 |
| 520 | Ga0500595_001767 | 3300053119 | Bacteria | 11248 |
| 521 | Ga0500626_017939 | 3300053128 | Bacteria | 3116 |
| 522 | Ga0500658_0000101 | 3300053134 | Bacteria | 39385 |
| 523 | Ga0500559_0001638 | 3300053136 | Bacteria | 12403 |
| 524 | Ga0500568_0000111 | 3300053139 | Bacteria | 75413 |
| 525 | Ga0500616_0015054 | 3300053153 | Bacteria | 4431 |
| 526 | Ga0500616_0049272 | 3300053153 | Bacteria | 2230 |
| 527 | Ga0500624_000138 | 3300053157 | Bacteria | 30876 |
| 528 | Ga0587085_005812 | 3300059506 | Unclassified | 1472 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300003323 | rootH1_10015716 | rootH1_100157163 | 321 |
| 2 | 3300047447 | Ga0495685_000071 | Ga0495685_000071_16571_17683 | 369 |
| 3 | 3300013105 | Ga0157369_10207906 | Ga0157369_102079061 | 375 |
| 4 | 3300046690 | Ga0495624_0028769 | Ga0495624_0028769_1970_3184 | 375 |
| 5 | 3300048929 | Ga0496126_0000102 | Ga0496126_0000102_71269_72483 | 375 |
| 6 | 3300005468 | Ga0070707_100000015 | Ga0070707_10000001562 | 376 |
| 7 | 3300046516 | Ga0495628_0102381 | Ga0495628_0102381_243_1457 | 379 |
| 8 | 3300046526 | Ga0495666_0029423 | Ga0495666_0029423_805_2019 | 379 |
| 9 | 3300046678 | Ga0495599_0065516 | Ga0495599_0065516_547_1761 | 379 |
| 10 | 3300047317 | Ga0495604_0034859 | Ga0495604_0034859_335_1549 | 379 |
| 11 | 3300037418 | Ga0395900_0000585 | Ga0395900_0000585_21834_23042 | 380 |
| 12 | 3300046472 | Ga0495580_0113504 | Ga0495580_0113504_577_1791 | 380 |
| 13 | 3300046524 | Ga0495648_0067362 | Ga0495648_0067362_454_1668 | 380 |
| 14 | 3300013105 | Ga0157369_10074148 | Ga0157369_100741482 | 383 |
| 15 | 3300013307 | Ga0157372_10075063 | Ga0157372_100750633 | 384 |
| 16 | 3300013296 | Ga0157374_10002224 | Ga0157374_100022242 | 388 |
| 17 | 3300006852 | Ga0075433_10075279 | Ga0075433_100752792 | 389 |
| 18 | 3300050515 | nmdc:mga0a205_274606_c1 | nmdc:mga0a205_274606_c1_144_1352 | 389 |
| 19 | 3300003320 | rootH2_10126121 | rootH2_101261212 | 390 |
| 20 | 3300003322 | rootL2_10192769 | rootL2_101927693 | 390 |
| 21 | 3300021361 | Ga0213872_10000139 | Ga0213872_100001394 | 390 |
| 22 | 3300039447 | Ga0436361_0734234 | Ga0436361_0734234_18595_19794 | 390 |
| 23 | 3300039447 | Ga0436361_0632398 | Ga0436361_0632398_344_1546 | 391 |
| 24 | 3300047472 | Ga0495686_0000625 | Ga0495686_0000625_44617_45810 | 391 |
| 25 | 3300005289 | Ga0065704_10127031 | Ga0065704_101270312 | 392 |
| 26 | 3300005983 | Ga0081540_1033130 | Ga0081540_10331302 | 392 |
| 27 | 3300009553 | Ga0105249_10222707 | Ga0105249_102227072 | 392 |
| 28 | 3300044712 | Ga0453684_0046108 | Ga0453684_0046108_3859_5043 | 392 |
| 29 | iso_pu_bacteria | 2848694841 | 2848701926 | 392 |
| 30 | 3300031250 | Ga0265331_10001700 | Ga0265331_100017008 | 393 |
| 31 | 3300031251 | Ga0265327_10002400 | Ga0265327_1000240013 | 393 |
| 32 | 3300003354 | JGI25160J50197_1000964 | JGI25160J50197_10009643 | 394 |
| 33 | 3300006852 | Ga0075433_10072710 | Ga0075433_100727104 | 394 |
| 34 | 3300025302 | Ga0207426_1000089 | Ga0207426_1000089122 | 394 |
| 35 | 3300028573 | Ga0265334_10001873 | Ga0265334_100018738 | 394 |
| 36 | 3300050515 | nmdc:mga0a205_45791_c1 | nmdc:mga0a205_45791_c1_2445_3632 | 394 |
| 37 | 3300031251 | Ga0265327_10000217 | Ga0265327_1000021723 | 395 |
| 38 | 3300042876 | Ga0451577_0030468 | Ga0451577_0030468_2376_3575 | 395 |
| 39 | 3300059506 | Ga0587085_005812 | Ga0587085_005812_120_1319 | 395 |
| 40 | 3300031251 | Ga0265327_10000199 | Ga0265327_1000019951 | 396 |
| 41 | 3300044712 | Ga0453684_0446073 | Ga0453684_0446073_165_1364 | 396 |
| 42 | 3300045051 | Ga0451576_0001296 | Ga0451576_0001296_248_1447 | 396 |
| 43 | 3300053153 | Ga0500616_0049272 | Ga0500616_0049272_460_1659 | 396 |
| 44 | iso_pu_bacteria | 2508501125 | 2509127065 | 396 |
| 45 | iso_pu_bacteria | 2513020051 | 2513230220 | 396 |
| 46 | iso_pu_bacteria | 2513237151 | 2513961097 | 396 |
| 47 | iso_pu_bacteria | 2643221672 | 2644397560 | 396 |
| 48 | iso_pu_bacteria | 2738541296 | 2738822084 | 396 |
| 49 | iso_pu_bacteria | 2738541298 | 2738834566 | 396 |
| 50 | iso_pu_bacteria | 2738541306 | 2738875770 | 396 |
| 51 | iso_pu_bacteria | 2738541307 | 2738882940 | 396 |
| 52 | iso_pu_bacteria | 2738543002 | 2739187722 | 396 |
| 53 | iso_pu_bacteria | 2738543008 | 2739222368 | 396 |
| 54 | iso_pu_bacteria | 2738543023 | 2739304266 | 396 |
| 55 | iso_pu_bacteria | 2818991436 | 2819541124 | 396 |
| 56 | iso_pu_bacteria | 2945934425 | 2945938465 | 396 |
| 57 | iso_pu_bacteria | 641736151 | 642423596 | 396 |
| 58 | iso_pu_bacteria | 8055266321 | 8055268708 | 396 |
| 59 | 3300002774 | JGI25150J39212_1001106 | JGI25150J39212_10011063 | 397 |
| 60 | 3300006844 | Ga0075428_100050916 | Ga0075428_1000509161 | 397 |
| 61 | 3300009094 | Ga0111539_10019163 | Ga0111539_100191635 | 397 |
| 62 | 3300025258 | Ga0209129_1000245 | Ga0209129_10002454 | 397 |
| 63 | 3300025263 | Ga0209565_1000165 | Ga0209565_100016537 | 397 |
| 64 | 3300025291 | Ga0209675_1000321 | Ga0209675_100032137 | 397 |
| 65 | 3300025294 | Ga0209025_1000615 | Ga0209025_10006154 | 397 |
| 66 | 3300025295 | Ga0209564_1000352 | Ga0209564_100035237 | 397 |
| 67 | 3300025297 | Ga0209758_1000297 | Ga0209758_100029737 | 397 |
| 68 | 3300025299 | Ga0209256_1000238 | Ga0209256_100023837 | 397 |
| 69 | 3300025302 | Ga0207426_1000294 | Ga0207426_100029437 | 397 |
| 70 | 3300025304 | Ga0209257_1005188 | Ga0209257_10051886 | 397 |
| 71 | 3300050510 | nmdc:mga06r32_156666_c1 | nmdc:mga06r32_156666_c1_887_2095 | 397 |
| 72 | iso_pu_bacteria | 2738541277 | 2738723308 | 397 |
| 73 | iso_pu_bacteria | 2738541283 | 2738756346 | 397 |
| 74 | iso_pu_bacteria | 2738543019 | 2739284039 | 397 |
| 75 | iso_pu_bacteria | 2928084124 | 2928088078 | 397 |
| 76 | 3300003320 | rootH2_10022331 | rootH2_100223312 | 398 |
| 77 | 3300003323 | rootH1_10074395 | rootH1_100743955 | 398 |
| 78 | 3300009147 | Ga0114129_10005656 | Ga0114129_100056569 | 398 |
| 79 | 3300009545 | Ga0105237_10024972 | Ga0105237_100249724 | 398 |
| 80 | 3300013307 | Ga0157372_10564412 | Ga0157372_105644121 | 398 |
| 81 | 3300021361 | Ga0213872_10001832 | Ga0213872_100018325 | 398 |
| 82 | 3300021361 | Ga0213872_10004883 | Ga0213872_100048835 | 398 |
| 83 | 3300025914 | Ga0207671_10049687 | Ga0207671_100496872 | 398 |
| 84 | 3300028573 | Ga0265334_10038951 | Ga0265334_100389512 | 398 |
| 85 | 3300028786 | Ga0307517_10004553 | Ga0307517_1000455320 | 398 |
| 86 | 3300028786 | Ga0307517_10062588 | Ga0307517_100625882 | 398 |
| 87 | 3300031616 | Ga0307508_10008282 | Ga0307508_100082827 | 398 |
| 88 | 3300031711 | Ga0265314_10106053 | Ga0265314_101060531 | 398 |
| 89 | 3300031730 | Ga0307516_10210867 | Ga0307516_102108672 | 398 |
| 90 | 3300037471 | Ga0395905_0000003 | Ga0395905_0000003_957210_958439 | 398 |
| 91 | 3300039447 | Ga0436361_0837010 | Ga0436361_0837010_1318_2514 | 398 |
| 92 | 3300044712 | Ga0453684_0011915 | Ga0453684_0011915_7667_8890 | 398 |
| 93 | 3300046660 | Ga0495625_0073987 | Ga0495625_0073987_681_1907 | 398 |
| 94 | 3300046660 | Ga0495625_0161344 | Ga0495625_0161344_208_1434 | 398 |
| 95 | 3300050493 | nmdc:mga0k408_105400_c1 | nmdc:mga0k408_105400_c1_58_1263 | 398 |
| 96 | 3300050507 | nmdc:mga05p37_1576_c1 | nmdc:mga05p37_1576_c1_10133_11332 | 398 |
| 97 | 3300053098 | Ga0500650_0004587 | Ga0500650_0004587_1268_2494 | 398 |
| 98 | iso_pu_bacteria | 2512047030 | 2512352265 | 398 |
| 99 | iso_pu_bacteria | 2513237166 | 2514046678 | 398 |
| 100 | iso_pu_bacteria | 2515154122 | 2515684528 | 398 |
| 101 | iso_pu_bacteria | 2562617112 | 2563060375 | 398 |
| 102 | iso_pu_bacteria | 2600255067 | 2600814374 | 398 |
| 103 | iso_pu_bacteria | 2711768613 | 2713475549 | 398 |
| 104 | iso_pu_bacteria | 2791355137 | 2792837322 | 398 |
| 105 | iso_pu_bacteria | 2818991450 | 2819620500 | 398 |
| 106 | iso_pu_bacteria | 2842324504 | 2842332791 | 398 |
| 107 | iso_pu_bacteria | 2842348783 | 2842356997 | 398 |
| 108 | iso_pu_bacteria | 2842454564 | 2842460776 | 398 |
| 109 | iso_pu_bacteria | 2885270888 | 2885279362 | 398 |
| 110 | iso_pu_bacteria | 2900634093 | 2900640410 | 398 |
| 111 | iso_pu_bacteria | 2902682994 | 2902684759 | 398 |
| 112 | iso_pu_bacteria | 2921643360 | 2921645858 | 398 |
| 113 | iso_pu_bacteria | 2928108538 | 2928108898 | 398 |
| 114 | iso_pu_bacteria | 2928135762 | 2928136122 | 398 |
| 115 | iso_pu_bacteria | 2928503688 | 2928504097 | 398 |
| 116 | iso_pu_bacteria | 642555112 | 642595842 | 398 |
| 117 | iso_pu_bacteria | 642555113 | 642616952 | 398 |
| 118 | 3300003316 | rootH1_10175801 | rootH1_101758012 | 399 |
| 119 | 3300003322 | rootL2_10120755 | rootL2_101207553 | 399 |
| 120 | 3300028794 | Ga0307515_10000006 | Ga0307515_10000006633 | 399 |
| 121 | 3300028794 | Ga0307515_10003072 | Ga0307515_1000307227 | 399 |
| 122 | 3300031456 | Ga0307513_10197277 | Ga0307513_101972772 | 399 |
| 123 | 3300042876 | Ga0451577_0158103 | Ga0451577_0158103_416_1642 | 399 |
| 124 | 3300045051 | Ga0451576_0200431 | Ga0451576_0200431_787_1986 | 399 |
| 125 | 3300045051 | Ga0451576_0309321 | Ga0451576_0309321_406_1632 | 399 |
| 126 | 3300046453 | Ga0495627_019615 | Ga0495627_019615_71_1279 | 399 |
| 127 | 3300046558 | Ga0495633_0000123 | Ga0495633_0000123_63150_64358 | 399 |
| 128 | 3300047321 | Ga0495676_0033937 | Ga0495676_0033937_1121_2320 | 399 |
| 129 | 3300047471 | Ga0495684_0028956 | Ga0495684_0028956_2979_4190 | 399 |
| 130 | 3300053108 | Ga0500562_000058 | Ga0500562_000058_834_2051 | 399 |
| 131 | iso_pu_bacteria | 2599185214 | 2599625316 | 399 |
| 132 | iso_pu_bacteria | 2599185226 | 2599673232 | 399 |
| 133 | iso_pu_bacteria | 2599185227 | 2599682902 | 399 |
| 134 | iso_pu_bacteria | 2599185229 | 2599694840 | 399 |
| 135 | iso_pu_bacteria | 2831265667 | 2831267483 | 399 |
| 136 | iso_pu_bacteria | 2885198086 | 2885198217 | 399 |
| 137 | iso_pu_bacteria | 2885211737 | 2885212403 | 399 |
| 138 | 3300002705 | JGI25156J39149_1000203 | JGI25156J39149_100020328 | 400 |
| 139 | 3300002737 | JGI25162J39368_1000083 | JGI25162J39368_100008397 | 400 |
| 140 | 3300002737 | JGI25162J39368_1000152 | JGI25162J39368_100015224 | 400 |
| 141 | 3300002771 | JGI25163J39215_1001584 | JGI25163J39215_10015842 | 400 |
| 142 | 3300003214 | JGI25165J46597_1000064 | JGI25165J46597_100006497 | 400 |
| 143 | 3300003322 | rootL2_10103277 | rootL2_101032772 | 400 |
| 144 | 3300003751 | Ga0055538_1000031 | Ga0055538_100003189 | 400 |
| 145 | 3300003752 | Ga0055539_1000041 | Ga0055539_100004189 | 400 |
| 146 | 3300003756 | Ga0055533_1000051 | Ga0055533_100005197 | 400 |
| 147 | 3300003759 | Ga0055525_1000061 | Ga0055525_100006190 | 400 |
| 148 | 3300003781 | Ga0055536_1004894 | Ga0055536_10048946 | 400 |
| 149 | 3300003791 | Ga0055530_10010353 | Ga0055530_100103532 | 400 |
| 150 | 3300003792 | Ga0055540_1000436 | Ga0055540_10004363 | 400 |
| 151 | 3300003794 | Ga0055531_10000447 | Ga0055531_1000044728 | 400 |
| 152 | 3300003841 | Ga0055541_1000028 | Ga0055541_100002890 | 400 |
| 153 | 3300005344 | Ga0070661_100130917 | Ga0070661_1001309172 | 400 |
| 154 | 3300005457 | Ga0070662_100030750 | Ga0070662_1000307502 | 400 |
| 155 | 3300005539 | Ga0068853_100011400 | Ga0068853_1000114009 | 400 |
| 156 | 3300005548 | Ga0070665_100160850 | Ga0070665_1001608502 | 400 |
| 157 | 3300005564 | Ga0070664_100033377 | Ga0070664_1000333775 | 400 |
| 158 | 3300006042 | Ga0075368_10048407 | Ga0075368_100484072 | 400 |
| 159 | 3300006353 | Ga0075370_10002667 | Ga0075370_100026678 | 400 |
| 160 | 3300009036 | Ga0105244_10002309 | Ga0105244_1000230911 | 400 |
| 161 | 3300009093 | Ga0105240_10002995 | Ga0105240_100029953 | 400 |
| 162 | 3300009148 | Ga0105243_10003224 | Ga0105243_100032243 | 400 |
| 163 | 3300009545 | Ga0105237_10001115 | Ga0105237_1000111535 | 400 |
| 164 | 3300009551 | Ga0105238_10042933 | Ga0105238_100429336 | 400 |
| 165 | 3300009551 | Ga0105238_10236971 | Ga0105238_102369711 | 400 |
| 166 | 3300010375 | Ga0105239_10001815 | Ga0105239_1000181528 | 400 |
| 167 | 3300014497 | Ga0182008_10001746 | Ga0182008_1000174612 | 400 |
| 168 | 3300015261 | Ga0182006_1005866 | Ga0182006_10058663 | 400 |
| 169 | 3300015261 | Ga0182006_1007883 | Ga0182006_10078832 | 400 |
| 170 | 3300015262 | Ga0182007_10000432 | Ga0182007_1000043212 | 400 |
| 171 | 3300015262 | Ga0182007_10023437 | Ga0182007_100234372 | 400 |
| 172 | 3300015265 | Ga0182005_1003406 | Ga0182005_10034063 | 400 |
| 173 | 3300025207 | Ga0209760_102590 | Ga0209760_1025902 | 400 |
| 174 | 3300025224 | Ga0209784_100039 | Ga0209784_100039127 | 400 |
| 175 | 3300025225 | Ga0209566_100023 | Ga0209566_100023127 | 400 |
| 176 | 3300025226 | Ga0209674_100040 | Ga0209674_100040127 | 400 |
| 177 | 3300025228 | Ga0209672_106428 | Ga0209672_1064282 | 400 |
| 178 | 3300025230 | Ga0209563_100072 | Ga0209563_100072127 | 400 |
| 179 | 3300025233 | Ga0209437_100097 | Ga0209437_100097127 | 400 |
| 180 | 3300025253 | Ga0209677_100041 | Ga0209677_100041127 | 400 |
| 181 | 3300025256 | Ga0209759_1000010 | Ga0209759_1000010241 | 400 |
| 182 | 3300025261 | Ga0209233_1000122 | Ga0209233_1000122127 | 400 |
| 183 | 3300025292 | Ga0209676_1000880 | Ga0209676_100088028 | 400 |
| 184 | 3300025298 | Ga0209050_1001354 | Ga0209050_100135418 | 400 |
| 185 | 3300025303 | Ga0209051_1000669 | Ga0209051_100066928 | 400 |
| 186 | 3300025304 | Ga0209257_1000149 | Ga0209257_1000149165 | 400 |
| 187 | 3300025728 | Ga0207655_1003116 | Ga0207655_10031169 | 400 |
| 188 | 3300025903 | Ga0207680_10006967 | Ga0207680_100069675 | 400 |
| 189 | 3300025904 | Ga0207647_10010390 | Ga0207647_100103902 | 400 |
| 190 | 3300025913 | Ga0207695_10019213 | Ga0207695_1001921310 | 400 |
| 191 | 3300025914 | Ga0207671_10017877 | Ga0207671_100178773 | 400 |
| 192 | 3300025920 | Ga0207649_10036869 | Ga0207649_100368695 | 400 |
| 193 | 3300025933 | Ga0207706_10005691 | Ga0207706_100056916 | 400 |
| 194 | 3300025935 | Ga0207709_10001115 | Ga0207709_1000111510 | 400 |
| 195 | 3300025945 | Ga0207679_10038927 | Ga0207679_100389272 | 400 |
| 196 | 3300025981 | Ga0207640_10175919 | Ga0207640_101759192 | 400 |
| 197 | 3300026121 | Ga0207683_10230902 | Ga0207683_102309022 | 400 |
| 198 | 3300031251 | Ga0265327_10013587 | Ga0265327_100135877 | 400 |
| 199 | 3300031911 | Ga0307412_10000002 | Ga0307412_10000002458 | 400 |
| 200 | 3300035112 | Ga0373932_0003554 | Ga0373932_0003554_544_1767 | 400 |
| 201 | 3300035691 | Ga0373931_0047018 | Ga0373931_0047018_600_1823 | 400 |
| 202 | 3300036401 | Ga0373937_0107146 | Ga0373937_0107146_1360_2562 | 400 |
| 203 | 3300046462 | Ga0495651_0002782 | Ga0495651_0002782_8962_10164 | 400 |
| 204 | 3300046462 | Ga0495651_0076834 | Ga0495651_0076834_788_1990 | 400 |
| 205 | 3300046463 | Ga0495653_0000968 | Ga0495653_0000968_12891_14093 | 400 |
| 206 | 3300046472 | Ga0495580_0045898 | Ga0495580_0045898_534_1736 | 400 |
| 207 | 3300046511 | Ga0495608_0012300 | Ga0495608_0012300_371_1573 | 400 |
| 208 | 3300046511 | Ga0495608_0027059 | Ga0495608_0027059_718_1920 | 400 |
| 209 | 3300046512 | Ga0495610_0003281 | Ga0495610_0003281_9846_11048 | 400 |
| 210 | 3300046516 | Ga0495628_0003210 | Ga0495628_0003210_689_1891 | 400 |
| 211 | 3300046516 | Ga0495628_0003625 | Ga0495628_0003625_3916_5118 | 400 |
| 212 | 3300046516 | Ga0495628_0062998 | Ga0495628_0062998_137_1339 | 400 |
| 213 | 3300046529 | Ga0495652_0001838 | Ga0495652_0001838_17132_18334 | 400 |
| 214 | 3300046529 | Ga0495652_0016504 | Ga0495652_0016504_1984_3186 | 400 |
| 215 | 3300046543 | Ga0495645_0046744 | Ga0495645_0046744_804_2006 | 400 |
| 216 | 3300046543 | Ga0495645_0056436 | Ga0495645_0056436_830_2032 | 400 |
| 217 | 3300046543 | Ga0495645_0211967 | Ga0495645_0211967_85_1287 | 400 |
| 218 | 3300046663 | Ga0495635_0006292 | Ga0495635_0006292_4262_5464 | 400 |
| 219 | 3300046663 | Ga0495635_0159437 | Ga0495635_0159437_221_1423 | 400 |
| 220 | 3300046678 | Ga0495599_0006398 | Ga0495599_0006398_5204_6406 | 400 |
| 221 | 3300046679 | Ga0495623_0018755 | Ga0495623_0018755_2267_3469 | 400 |
| 222 | 3300046680 | Ga0495646_0000922 | Ga0495646_0000922_7473_8675 | 400 |
| 223 | 3300046680 | Ga0495646_0003965 | Ga0495646_0003965_3579_4781 | 400 |
| 224 | 3300046683 | Ga0495658_0001174 | Ga0495658_0001174_9845_11047 | 400 |
| 225 | 3300046690 | Ga0495624_0006440 | Ga0495624_0006440_5433_6635 | 400 |
| 226 | 3300046690 | Ga0495624_0016853 | Ga0495624_0016853_1393_2595 | 400 |
| 227 | 3300046694 | Ga0495649_0067734 | Ga0495649_0067734_22_1224 | 400 |
| 228 | 3300046809 | Ga0495600_0000903 | Ga0495600_0000903_1876_3078 | 400 |
| 229 | 3300047319 | Ga0495674_0149020 | Ga0495674_0149020_669_1871 | 400 |
| 230 | 3300047323 | Ga0495683_0024408 | Ga0495683_0024408_1581_2783 | 400 |
| 231 | 3300048091 | Ga0495626_0014982 | Ga0495626_0014982_1737_2939 | 400 |
| 232 | 3300048911 | Ga0496108_0062085 | Ga0496108_0062085_522_1730 | 400 |
| 233 | 3300048912 | Ga0496109_0052167 | Ga0496109_0052167_1272_2480 | 400 |
| 234 | 3300048913 | Ga0496110_0009042 | Ga0496110_0009042_5658_6866 | 400 |
| 235 | 3300048914 | Ga0496111_0020486 | Ga0496111_0020486_1177_2385 | 400 |
| 236 | 3300048919 | Ga0496116_0019139 | Ga0496116_0019139_2153_3355 | 400 |
| 237 | 3300048921 | Ga0496118_0003693 | Ga0496118_0003693_16399_17601 | 400 |
| 238 | 3300048921 | Ga0496118_0031770 | Ga0496118_0031770_236_1438 | 400 |
| 239 | 3300048925 | Ga0496122_0011093 | Ga0496122_0011093_2536_3759 | 400 |
| 240 | 3300048926 | Ga0496123_0020940 | Ga0496123_0020940_632_1855 | 400 |
| 241 | 3300048928 | Ga0496125_0020286 | Ga0496125_0020286_3196_4398 | 400 |
| 242 | 3300050496 | nmdc:mga07m45_31431_c1 | nmdc:mga07m45_31431_c1_1163_2365 | 400 |
| 243 | 3300053077 | Ga0495601_0003095 | Ga0495601_0003095_3614_4816 | 400 |
| 244 | 3300053077 | Ga0495601_0037438 | Ga0495601_0037438_128_1330 | 400 |
| 245 | 3300053119 | Ga0500595_001767 | Ga0500595_001767_836_2038 | 400 |
| 246 | iso_pu_bacteria | 2818991446 | 2819602168 | 400 |
| 247 | iso_pu_bacteria | 2899924645 | 2899928765 | 400 |
| 248 | iso_pu_bacteria | 2904541872 | 2904549984 | 400 |
| 249 | iso_pu_bacteria | 2928037797 | 2928043299 | 400 |
| 250 | iso_pu_bacteria | 2928044640 | 2928051176 | 400 |
| 251 | iso_pu_bacteria | 2928051484 | 2928058768 | 400 |
| 252 | iso_pu_bacteria | 2928064002 | 2928066159 | 400 |
| 253 | iso_pu_bacteria | 2928070936 | 2928077813 | 400 |
| 254 | iso_pu_bacteria | 2929160207 | 2929164872 | 400 |
| 255 | 3300005331 | Ga0070670_100002808 | Ga0070670_10000280810 | 401 |
| 256 | 3300005335 | Ga0070666_10008348 | Ga0070666_100083485 | 401 |
| 257 | 3300005335 | Ga0070666_10047779 | Ga0070666_100477792 | 401 |
| 258 | 3300005344 | Ga0070661_100102163 | Ga0070661_1001021632 | 401 |
| 259 | 3300005367 | Ga0070667_100068884 | Ga0070667_1000688844 | 401 |
| 260 | 3300005457 | Ga0070662_100010365 | Ga0070662_1000103654 | 401 |
| 261 | 3300005459 | Ga0068867_100079914 | Ga0068867_1000799142 | 401 |
| 262 | 3300005548 | Ga0070665_100001686 | Ga0070665_1000016867 | 401 |
| 263 | 3300005578 | Ga0068854_100002447 | Ga0068854_1000024478 | 401 |
| 264 | 3300005616 | Ga0068852_100030106 | Ga0068852_1000301065 | 401 |
| 265 | 3300005616 | Ga0068852_100313484 | Ga0068852_1003134841 | 401 |
| 266 | 3300005842 | Ga0068858_100000825 | Ga0068858_10000082515 | 401 |
| 267 | 3300009093 | Ga0105240_10000551 | Ga0105240_1000055149 | 401 |
| 268 | 3300009093 | Ga0105240_10038859 | Ga0105240_100388593 | 401 |
| 269 | 3300009174 | Ga0105241_10019938 | Ga0105241_100199385 | 401 |
| 270 | 3300009545 | Ga0105237_10251413 | Ga0105237_102514132 | 401 |
| 271 | 3300009553 | Ga0105249_10030868 | Ga0105249_100308683 | 401 |
| 272 | 3300009982 | Ga0105147_100484 | Ga0105147_1004844 | 401 |
| 273 | 3300010375 | Ga0105239_10037131 | Ga0105239_100371313 | 401 |
| 274 | 3300013105 | Ga0157369_10062297 | Ga0157369_100622974 | 401 |
| 275 | 3300013307 | Ga0157372_10018637 | Ga0157372_100186378 | 401 |
| 276 | 3300014497 | Ga0182008_10002997 | Ga0182008_100029977 | 401 |
| 277 | 3300015261 | Ga0182006_1013506 | Ga0182006_10135062 | 401 |
| 278 | 3300015262 | Ga0182007_10003291 | Ga0182007_100032917 | 401 |
| 279 | 3300025903 | Ga0207680_10028575 | Ga0207680_100285754 | 401 |
| 280 | 3300025903 | Ga0207680_10084315 | Ga0207680_100843152 | 401 |
| 281 | 3300025904 | Ga0207647_10001230 | Ga0207647_100012308 | 401 |
| 282 | 3300025911 | Ga0207654_10032284 | Ga0207654_100322843 | 401 |
| 283 | 3300025913 | Ga0207695_10000016 | Ga0207695_10000016389 | 401 |
| 284 | 3300025913 | Ga0207695_10000758 | Ga0207695_100007588 | 401 |
| 285 | 3300025913 | Ga0207695_10033988 | Ga0207695_100339885 | 401 |
| 286 | 3300025914 | Ga0207671_10034970 | Ga0207671_100349702 | 401 |
| 287 | 3300025924 | Ga0207694_10001284 | Ga0207694_1000128416 | 401 |
| 288 | 3300025933 | Ga0207706_10013523 | Ga0207706_100135235 | 401 |
| 289 | 3300025961 | Ga0207712_10000731 | Ga0207712_100007313 | 401 |
| 290 | 3300025986 | Ga0207658_10035689 | Ga0207658_100356894 | 401 |
| 291 | 3300026035 | Ga0207703_10000503 | Ga0207703_1000050319 | 401 |
| 292 | 3300026041 | Ga0207639_10001076 | Ga0207639_1000107610 | 401 |
| 293 | 3300026067 | Ga0207678_10002350 | Ga0207678_1000235014 | 401 |
| 294 | 3300026078 | Ga0207702_10119631 | Ga0207702_101196313 | 401 |
| 295 | 3300026142 | Ga0207698_10267279 | Ga0207698_102672792 | 401 |
| 296 | 3300028379 | Ga0268266_10000006 | Ga0268266_10000006847 | 401 |
| 297 | 3300028794 | Ga0307515_10003775 | Ga0307515_100037756 | 401 |
| 298 | 3300028800 | Ga0265338_10000092 | Ga0265338_1000009255 | 401 |
| 299 | 3300031616 | Ga0307508_10000357 | Ga0307508_1000035751 | 401 |
| 300 | 3300031649 | Ga0307514_10006151 | Ga0307514_100061513 | 401 |
| 301 | 3300046475 | Ga0495639_0013282 | Ga0495639_0013282_763_1974 | 401 |
| 302 | 3300046513 | Ga0495616_0000350 | Ga0495616_0000350_27617_28828 | 401 |
| 303 | 3300046660 | Ga0495625_0057147 | Ga0495625_0057147_292_1500 | 401 |
| 304 | 3300046675 | Ga0495657_0082010 | Ga0495657_0082010_81_1292 | 401 |
| 305 | 3300047319 | Ga0495674_0024938 | Ga0495674_0024938_1264_2475 | 401 |
| 306 | 3300047320 | Ga0495672_0010466 | Ga0495672_0010466_5323_6531 | 401 |
| 307 | 3300048903 | Ga0496100_0002907 | Ga0496100_0002907_3291_4502 | 401 |
| 308 | 3300048904 | Ga0496101_0004067 | Ga0496101_0004067_4530_5741 | 401 |
| 309 | 3300048905 | Ga0496102_0012843 | Ga0496102_0012843_1601_2812 | 401 |
| 310 | 3300048906 | Ga0496103_0014464 | Ga0496103_0014464_2995_4206 | 401 |
| 311 | 3300048907 | Ga0496104_0038880 | Ga0496104_0038880_570_1781 | 401 |
| 312 | 3300048908 | Ga0496105_0011662 | Ga0496105_0011662_1295_2506 | 401 |
| 313 | 3300048909 | Ga0496106_0011528 | Ga0496106_0011528_1518_2729 | 401 |
| 314 | 3300048911 | Ga0496108_0026680 | Ga0496108_0026680_2435_3646 | 401 |
| 315 | 3300048913 | Ga0496110_0025448 | Ga0496110_0025448_2176_3387 | 401 |
| 316 | 3300048917 | Ga0496114_0073966 | Ga0496114_0073966_243_1454 | 401 |
| 317 | 3300048924 | Ga0496121_0032981 | Ga0496121_0032981_146_1354 | 401 |
| 318 | 3300048926 | Ga0496123_0069849 | Ga0496123_0069849_51_1259 | 401 |
| 319 | 3300053128 | Ga0500626_017939 | Ga0500626_017939_392_1600 | 401 |
| 320 | 3300053134 | Ga0500658_0000101 | Ga0500658_0000101_35283_36491 | 401 |
| 321 | 3300053136 | Ga0500559_0001638 | Ga0500559_0001638_7907_9115 | 401 |
| 322 | 3300053139 | Ga0500568_0000111 | Ga0500568_0000111_9836_11044 | 401 |
| 323 | 3300053153 | Ga0500616_0015054 | Ga0500616_0015054_2310_3518 | 401 |
| 324 | 3300053157 | Ga0500624_000138 | Ga0500624_000138_23948_25156 | 401 |
| 325 | 3300001989 | JGI24739J22299_10000637 | JGI24739J22299_1000063712 | 402 |
| 326 | 3300001990 | JGI24737J22298_10039946 | JGI24737J22298_100399461 | 402 |
| 327 | 3300002705 | JGI25156J39149_1000978 | JGI25156J39149_100097810 | 402 |
| 328 | 3300003322 | rootL2_10002802 | rootL2_100028026 | 402 |
| 329 | 3300003322 | rootL2_10023011 | rootL2_100230112 | 402 |
| 330 | 3300003354 | JGI25160J50197_1000080 | JGI25160J50197_100008034 | 402 |
| 331 | 3300005262 | Ga0065165_1000211 | Ga0065165_100021134 | 402 |
| 332 | 3300005339 | Ga0070660_100135872 | Ga0070660_1001358722 | 402 |
| 333 | 3300005366 | Ga0070659_100057036 | Ga0070659_1000570364 | 402 |
| 334 | 3300005530 | Ga0070679_100230383 | Ga0070679_1002303832 | 402 |
| 335 | 3300005539 | Ga0068853_100184792 | Ga0068853_1001847921 | 402 |
| 336 | 3300005577 | Ga0068857_100162089 | Ga0068857_1001620893 | 402 |
| 337 | 3300009011 | Ga0105251_10000278 | Ga0105251_1000027830 | 402 |
| 338 | 3300009093 | Ga0105240_10221984 | Ga0105240_102219841 | 402 |
| 339 | 3300009545 | Ga0105237_10020124 | Ga0105237_100201245 | 402 |
| 340 | 3300009551 | Ga0105238_10086241 | Ga0105238_100862413 | 402 |
| 341 | 3300010375 | Ga0105239_10002015 | Ga0105239_100020153 | 402 |
| 342 | 3300010375 | Ga0105239_10018814 | Ga0105239_100188145 | 402 |
| 343 | 3300015262 | Ga0182007_10000313 | Ga0182007_100003132 | 402 |
| 344 | 3300016635 | Ga0183361_10002 | Ga0183361_10002306 | 402 |
| 345 | 3300021361 | Ga0213872_10000040 | Ga0213872_1000004048 | 402 |
| 346 | 3300021361 | Ga0213872_10000744 | Ga0213872_1000074420 | 402 |
| 347 | 3300021361 | Ga0213872_10002839 | Ga0213872_100028392 | 402 |
| 348 | 3300021361 | Ga0213872_10024022 | Ga0213872_100240222 | 402 |
| 349 | 3300021361 | Ga0213872_10043563 | Ga0213872_100435632 | 402 |
| 350 | 3300025256 | Ga0209759_1001343 | Ga0209759_10013435 | 402 |
| 351 | 3300025295 | Ga0209564_1004633 | Ga0209564_10046337 | 402 |
| 352 | 3300025302 | Ga0207426_1000021 | Ga0207426_1000021300 | 402 |
| 353 | 3300025735 | Ga0207713_1000190 | Ga0207713_100019025 | 402 |
| 354 | 3300025904 | Ga0207647_10015594 | Ga0207647_100155942 | 402 |
| 355 | 3300025922 | Ga0207646_10000025 | Ga0207646_1000002551 | 402 |
| 356 | 3300026041 | Ga0207639_10106608 | Ga0207639_101066082 | 402 |
| 357 | 3300026116 | Ga0207674_10024646 | Ga0207674_100246465 | 402 |
| 358 | 3300028794 | Ga0307515_10060273 | Ga0307515_100602733 | 402 |
| 359 | 3300031344 | Ga0265316_10137959 | Ga0265316_101379592 | 402 |
| 360 | 3300031548 | Ga0307408_100004702 | Ga0307408_1000047026 | 402 |
| 361 | 3300037471 | Ga0395905_0000004 | Ga0395905_0000004_226077_227291 | 402 |
| 362 | 3300039447 | Ga0436361_0106476 | Ga0436361_0106476_10052_11263 | 402 |
| 363 | 3300039447 | Ga0436361_0431677 | Ga0436361_0431677_21537_22760 | 402 |
| 364 | 3300039447 | Ga0436361_0953601 | Ga0436361_0953601_66667_67899 | 402 |
| 365 | 3300039447 | Ga0436361_1021320 | Ga0436361_1021320_491_1729 | 402 |
| 366 | 3300044842 | Ga0466957_0000181 | Ga0466957_0000181_25163_26374 | 402 |
| 367 | 3300046454 | Ga0495592_0012215 | Ga0495592_0012215_1431_2645 | 402 |
| 368 | 3300046454 | Ga0495592_0050946 | Ga0495592_0050946_418_1842 | 402 |
| 369 | 3300046455 | Ga0495603_0000664 | Ga0495603_0000664_3428_4642 | 402 |
| 370 | 3300046455 | Ga0495603_0007069 | Ga0495603_0007069_3530_4744 | 402 |
| 371 | 3300046458 | Ga0495591_002573 | Ga0495591_002573_3140_4564 | 402 |
| 372 | 3300046459 | Ga0495629_0000031 | Ga0495629_0000031_73731_74945 | 402 |
| 373 | 3300046459 | Ga0495629_0002543 | Ga0495629_0002543_1426_2640 | 402 |
| 374 | 3300046459 | Ga0495629_0007083 | Ga0495629_0007083_234_1658 | 402 |
| 375 | 3300046461 | Ga0495641_0005699 | Ga0495641_0005699_3336_4550 | 402 |
| 376 | 3300046463 | Ga0495653_0000258 | Ga0495653_0000258_14869_16083 | 402 |
| 377 | 3300046463 | Ga0495653_0000389 | Ga0495653_0000389_1347_2561 | 402 |
| 378 | 3300046463 | Ga0495653_0047127 | Ga0495653_0047127_1263_2477 | 402 |
| 379 | 3300046471 | Ga0495650_0002679 | Ga0495650_0002679_4872_6101 | 402 |
| 380 | 3300046472 | Ga0495580_0000021 | Ga0495580_0000021_2918_4132 | 402 |
| 381 | 3300046472 | Ga0495580_0000076 | Ga0495580_0000076_49712_50926 | 402 |
| 382 | 3300046472 | Ga0495580_0002282 | Ga0495580_0002282_4508_5737 | 402 |
| 383 | 3300046472 | Ga0495580_0036545 | Ga0495580_0036545_903_2117 | 402 |
| 384 | 3300046473 | Ga0495582_0000782 | Ga0495582_0000782_12325_13539 | 402 |
| 385 | 3300046474 | Ga0495605_0001421 | Ga0495605_0001421_5683_6912 | 402 |
| 386 | 3300046476 | Ga0495662_0044404 | Ga0495662_0044404_248_1462 | 402 |
| 387 | 3300046477 | Ga0495664_0002445 | Ga0495664_0002445_7358_8572 | 402 |
| 388 | 3300046500 | Ga0495596_0009489 | Ga0495596_0009489_1300_2724 | 402 |
| 389 | 3300046500 | Ga0495596_0052628 | Ga0495596_0052628_246_1475 | 402 |
| 390 | 3300046506 | Ga0495583_0002195 | Ga0495583_0002195_2319_3533 | 402 |
| 391 | 3300046506 | Ga0495583_0004445 | Ga0495583_0004445_2944_4158 | 402 |
| 392 | 3300046511 | Ga0495608_0005115 | Ga0495608_0005115_2610_4034 | 402 |
| 393 | 3300046514 | Ga0495618_0010899 | Ga0495618_0010899_1780_2994 | 402 |
| 394 | 3300046515 | Ga0495620_0005682 | Ga0495620_0005682_1529_2758 | 402 |
| 395 | 3300046516 | Ga0495628_0001230 | Ga0495628_0001230_17029_18243 | 402 |
| 396 | 3300046516 | Ga0495628_0001786 | Ga0495628_0001786_9560_10774 | 402 |
| 397 | 3300046517 | Ga0495630_0001412 | Ga0495630_0001412_10804_12018 | 402 |
| 398 | 3300046517 | Ga0495630_0004733 | Ga0495630_0004733_2973_4397 | 402 |
| 399 | 3300046524 | Ga0495648_0004257 | Ga0495648_0004257_2421_3635 | 402 |
| 400 | 3300046524 | Ga0495648_0018651 | Ga0495648_0018651_1395_2819 | 402 |
| 401 | 3300046524 | Ga0495648_0084369 | Ga0495648_0084369_37_1266 | 402 |
| 402 | 3300046526 | Ga0495666_0000060 | Ga0495666_0000060_25583_26797 | 402 |
| 403 | 3300046526 | Ga0495666_0002840 | Ga0495666_0002840_4453_5877 | 402 |
| 404 | 3300046526 | Ga0495666_0040869 | Ga0495666_0040869_185_1399 | 402 |
| 405 | 3300046529 | Ga0495652_0038138 | Ga0495652_0038138_961_2175 | 402 |
| 406 | 3300046529 | Ga0495652_0156017 | Ga0495652_0156017_146_1360 | 402 |
| 407 | 3300046531 | Ga0495665_0001624 | Ga0495665_0001624_4262_5476 | 402 |
| 408 | 3300046533 | Ga0495640_0009140 | Ga0495640_0009140_190_1404 | 402 |
| 409 | 3300046533 | Ga0495640_0012832 | Ga0495640_0012832_4687_6111 | 402 |
| 410 | 3300046535 | Ga0495586_0002855 | Ga0495586_0002855_4417_5631 | 402 |
| 411 | 3300046536 | Ga0495587_0002127 | Ga0495587_0002127_10315_11739 | 402 |
| 412 | 3300046536 | Ga0495587_0010656 | Ga0495587_0010656_2029_3243 | 402 |
| 413 | 3300046543 | Ga0495645_0000671 | Ga0495645_0000671_18065_19279 | 402 |
| 414 | 3300046557 | Ga0495622_0001070 | Ga0495622_0001070_2404_3618 | 402 |
| 415 | 3300046642 | Ga0495634_0002070 | Ga0495634_0002070_12058_13272 | 402 |
| 416 | 3300046642 | Ga0495634_0168142 | Ga0495634_0168142_148_1362 | 402 |
| 417 | 3300046660 | Ga0495625_0009265 | Ga0495625_0009265_3483_4694 | 402 |
| 418 | 3300046660 | Ga0495625_0071832 | Ga0495625_0071832_447_1676 | 402 |
| 419 | 3300046663 | Ga0495635_0002052 | Ga0495635_0002052_7671_8885 | 402 |
| 420 | 3300046663 | Ga0495635_0002302 | Ga0495635_0002302_1512_2936 | 402 |
| 421 | 3300046665 | Ga0495661_0001386 | Ga0495661_0001386_11560_12984 | 402 |
| 422 | 3300046665 | Ga0495661_0002010 | Ga0495661_0002010_5261_6475 | 402 |
| 423 | 3300046675 | Ga0495657_0022156 | Ga0495657_0022156_2751_4175 | 402 |
| 424 | 3300046678 | Ga0495599_0012315 | Ga0495599_0012315_2101_3315 | 402 |
| 425 | 3300046679 | Ga0495623_0003661 | Ga0495623_0003661_3595_5019 | 402 |
| 426 | 3300046679 | Ga0495623_0012713 | Ga0495623_0012713_4146_5360 | 402 |
| 427 | 3300046680 | Ga0495646_0000327 | Ga0495646_0000327_8735_9949 | 402 |
| 428 | 3300046689 | Ga0495613_0000484 | Ga0495613_0000484_28809_30023 | 402 |
| 429 | 3300046689 | Ga0495613_0010858 | Ga0495613_0010858_152_1576 | 402 |
| 430 | 3300046690 | Ga0495624_0006600 | Ga0495624_0006600_1642_2856 | 402 |
| 431 | 3300046690 | Ga0495624_0016215 | Ga0495624_0016215_961_2175 | 402 |
| 432 | 3300046690 | Ga0495624_0148963 | Ga0495624_0148963_145_1359 | 402 |
| 433 | 3300046692 | Ga0495671_0090597 | Ga0495671_0090597_173_1387 | 402 |
| 434 | 3300046694 | Ga0495649_0061822 | Ga0495649_0061822_748_1977 | 402 |
| 435 | 3300046794 | Ga0495589_0030159 | Ga0495589_0030159_1473_2687 | 402 |
| 436 | 3300046809 | Ga0495600_0008523 | Ga0495600_0008523_4345_5769 | 402 |
| 437 | 3300047315 | Ga0495581_0000109 | Ga0495581_0000109_32616_33830 | 402 |
| 438 | 3300047317 | Ga0495604_0007596 | Ga0495604_0007596_4987_6201 | 402 |
| 439 | 3300047319 | Ga0495674_0008626 | Ga0495674_0008626_7853_9277 | 402 |
| 440 | 3300047319 | Ga0495674_0014957 | Ga0495674_0014957_2909_4126 | 402 |
| 441 | 3300047319 | Ga0495674_0035881 | Ga0495674_0035881_2423_3637 | 402 |
| 442 | 3300047321 | Ga0495676_0000589 | Ga0495676_0000589_20848_22062 | 402 |
| 443 | 3300047321 | Ga0495676_0023154 | Ga0495676_0023154_1022_2446 | 402 |
| 444 | 3300047322 | Ga0495680_0010735 | Ga0495680_0010735_4554_5768 | 402 |
| 445 | 3300047323 | Ga0495683_0002068 | Ga0495683_0002068_5877_7301 | 402 |
| 446 | 3300047444 | Ga0495675_0001280 | Ga0495675_0001280_4691_6115 | 402 |
| 447 | 3300047444 | Ga0495675_0015162 | Ga0495675_0015162_1610_2824 | 402 |
| 448 | 3300047446 | Ga0495679_000006 | Ga0495679_000006_148914_150143 | 402 |
| 449 | 3300047446 | Ga0495679_000464 | Ga0495679_000464_6753_7967 | 402 |
| 450 | 3300047446 | Ga0495679_001198 | Ga0495679_001198_3599_5023 | 402 |
| 451 | 3300047469 | Ga0495673_0004686 | Ga0495673_0004686_3374_4798 | 402 |
| 452 | 3300047471 | Ga0495684_0015787 | Ga0495684_0015787_1524_2738 | 402 |
| 453 | 3300047673 | Ga0495593_0006168 | Ga0495593_0006168_1916_3130 | 402 |
| 454 | 3300047673 | Ga0495593_0006631 | Ga0495593_0006631_4601_5815 | 402 |
| 455 | 3300047673 | Ga0495593_0023304 | Ga0495593_0023304_1414_2838 | 402 |
| 456 | 3300048088 | Ga0495602_0015557 | Ga0495602_0015557_1980_3194 | 402 |
| 457 | 3300048088 | Ga0495602_0063208 | Ga0495602_0063208_961_2175 | 402 |
| 458 | 3300048089 | Ga0495614_0007239 | Ga0495614_0007239_1064_2278 | 402 |
| 459 | 3300048089 | Ga0495614_0010109 | Ga0495614_0010109_961_2175 | 402 |
| 460 | 3300048091 | Ga0495626_0016445 | Ga0495626_0016445_2423_3652 | 402 |
| 461 | 3300048091 | Ga0495626_0019656 | Ga0495626_0019656_65_1279 | 402 |
| 462 | 3300048903 | Ga0496100_0000624 | Ga0496100_0000624_9281_10495 | 402 |
| 463 | 3300048904 | Ga0496101_0004895 | Ga0496101_0004895_1023_2237 | 402 |
| 464 | 3300048904 | Ga0496101_0009712 | Ga0496101_0009712_420_1634 | 402 |
| 465 | 3300048905 | Ga0496102_0000161 | Ga0496102_0000161_62118_63332 | 402 |
| 466 | 3300048906 | Ga0496103_0000247 | Ga0496103_0000247_22108_23322 | 402 |
| 467 | 3300048906 | Ga0496103_0018811 | Ga0496103_0018811_2721_3950 | 402 |
| 468 | 3300048907 | Ga0496104_0231076 | Ga0496104_0231076_257_1471 | 402 |
| 469 | 3300048908 | Ga0496105_0026962 | Ga0496105_0026962_924_2138 | 402 |
| 470 | 3300048908 | Ga0496105_0148038 | Ga0496105_0148038_146_1390 | 402 |
| 471 | 3300048910 | Ga0496107_0067556 | Ga0496107_0067556_66_1280 | 402 |
| 472 | 3300048915 | Ga0496112_0054005 | Ga0496112_0054005_262_1476 | 402 |
| 473 | 3300048915 | Ga0496112_0280846 | Ga0496112_0280846_77_1291 | 402 |
| 474 | 3300048916 | Ga0496113_0000639 | Ga0496113_0000639_4992_6206 | 402 |
| 475 | 3300048916 | Ga0496113_0262034 | Ga0496113_0262034_55_1269 | 402 |
| 476 | 3300048919 | Ga0496116_0013171 | Ga0496116_0013171_3346_4560 | 402 |
| 477 | 3300048920 | Ga0496117_0000722 | Ga0496117_0000722_27285_28499 | 402 |
| 478 | 3300048920 | Ga0496117_0004180 | Ga0496117_0004180_8957_10186 | 402 |
| 479 | 3300048921 | Ga0496118_0000441 | Ga0496118_0000441_40474_41688 | 402 |
| 480 | 3300048921 | Ga0496118_0001077 | Ga0496118_0001077_27807_29036 | 402 |
| 481 | 3300048921 | Ga0496118_0005177 | Ga0496118_0005177_3092_4306 | 402 |
| 482 | 3300048921 | Ga0496118_0027917 | Ga0496118_0027917_2559_3788 | 402 |
| 483 | 3300048922 | Ga0496119_0021540 | Ga0496119_0021540_2056_3270 | 402 |
| 484 | 3300048924 | Ga0496121_0001960 | Ga0496121_0001960_6266_7480 | 402 |
| 485 | 3300048924 | Ga0496121_0008923 | Ga0496121_0008923_6299_7513 | 402 |
| 486 | 3300048924 | Ga0496121_0009766 | Ga0496121_0009766_2648_3862 | 402 |
| 487 | 3300048925 | Ga0496122_0094161 | Ga0496122_0094161_606_1820 | 402 |
| 488 | 3300048929 | Ga0496126_0005701 | Ga0496126_0005701_6723_7937 | 402 |
| 489 | 3300049459 | Ga0495678_005736 | Ga0495678_005736_5403_6632 | 402 |
| 490 | 3300049460 | Ga0495682_0014965 | Ga0495682_0014965_662_2086 | 402 |
| 491 | iso_pu_bacteria | 2751185846 | 2753570103 | 402 |
| 492 | 3300003322 | rootL2_10026352 | rootL2_100263523 | 403 |
| 493 | 3300003322 | rootL2_10026353 | rootL2_100263533 | 403 |
| 494 | 3300003763 | Ga0055529_1000076 | Ga0055529_100007616 | 403 |
| 495 | 3300003771 | Ga0055526_1000259 | Ga0055526_100025918 | 403 |
| 496 | 3300003773 | Ga0055537_1000106 | Ga0055537_100010643 | 403 |
| 497 | 3300003775 | Ga0055524_1004631 | Ga0055524_10046314 | 403 |
| 498 | 3300003784 | Ga0055534_1000355 | Ga0055534_10003554 | 403 |
| 499 | 3300003790 | Ga0055528_1000011 | Ga0055528_1000011183 | 403 |
| 500 | 3300021361 | Ga0213872_10000001 | Ga0213872_10000001139 | 403 |
| 501 | 3300025245 | Ga0207425_1001817 | Ga0207425_10018172 | 403 |
| 502 | 3300025263 | Ga0209565_1000003 | Ga0209565_1000003858 | 403 |
| 503 | 3300025272 | Ga0209455_1000073 | Ga0209455_100007317 | 403 |
| 504 | 3300025273 | Ga0209673_1000003 | Ga0209673_1000003744 | 403 |
| 505 | 3300025273 | Ga0209673_1000454 | Ga0209673_100045427 | 403 |
| 506 | 3300025291 | Ga0209675_1000003 | Ga0209675_1000003180 | 403 |
| 507 | 3300025291 | Ga0209675_1006477 | Ga0209675_10064775 | 403 |
| 508 | 3300025294 | Ga0209025_1001104 | Ga0209025_100110429 | 403 |
| 509 | 3300025294 | Ga0209025_1004533 | Ga0209025_10045334 | 403 |
| 510 | 3300025295 | Ga0209564_1000070 | Ga0209564_1000070187 | 403 |
| 511 | 3300025295 | Ga0209564_1000249 | Ga0209564_100024914 | 403 |
| 512 | 3300025297 | Ga0209758_1000343 | Ga0209758_100034329 | 403 |
| 513 | 3300025299 | Ga0209256_1000029 | Ga0209256_1000029245 | 403 |
| 514 | 3300025299 | Ga0209256_1000047 | Ga0209256_1000047199 | 403 |
| 515 | 3300025302 | Ga0207426_1000194 | Ga0207426_100019478 | 403 |
| 516 | 3300025949 | Ga0207667_10168766 | Ga0207667_101687662 | 403 |
| 517 | 3300031507 | Ga0307509_10000018 | Ga0307509_10000018188 | 403 |
| 518 | 3300031711 | Ga0265314_10074454 | Ga0265314_100744543 | 403 |
| 519 | 3300039447 | Ga0436361_0404657 | Ga0436361_0404657_79155_80387 | 403 |
| 520 | 3300044735 | Ga0466968_0015258 | Ga0466968_0015258_1104_2363 | 403 |
| 521 | 3300046452 | Ga0495617_037283 | Ga0495617_037283_253_1494 | 403 |
| 522 | 3300046474 | Ga0495605_0024007 | Ga0495605_0024007_1622_2863 | 403 |
| 523 | 3300046492 | Ga0495585_0017898 | Ga0495585_0017898_1296_2537 | 403 |
| 524 | 3300046501 | Ga0495607_0015768 | Ga0495607_0015768_3164_4405 | 403 |
| 525 | 3300046506 | Ga0495583_0000014 | Ga0495583_0000014_3608_4849 | 403 |
| 526 | 3300046512 | Ga0495610_0002532 | Ga0495610_0002532_2076_3317 | 403 |
| 527 | 3300046513 | Ga0495616_0016292 | Ga0495616_0016292_459_1700 | 403 |
| 528 | 3300046522 | Ga0495643_0000051 | Ga0495643_0000051_13068_14309 | 403 |
| 529 | 3300046523 | Ga0495644_0001629 | Ga0495644_0001629_6574_7815 | 403 |
| 530 | 3300046524 | Ga0495648_0030635 | Ga0495648_0030635_1277_2518 | 403 |
| 531 | 3300046524 | Ga0495648_0054026 | Ga0495648_0054026_853_2094 | 403 |
| 532 | 3300046538 | Ga0495609_0001951 | Ga0495609_0001951_4430_5671 | 403 |
| 533 | 3300046538 | Ga0495609_0036797 | Ga0495609_0036797_260_1501 | 403 |
| 534 | 3300046542 | Ga0495597_0002758 | Ga0495597_0002758_8652_9899 | 403 |
| 535 | 3300046615 | Ga0495656_0018478 | Ga0495656_0018478_434_1675 | 403 |
| 536 | 3300046648 | Ga0495611_0001934 | Ga0495611_0001934_7605_8846 | 403 |
| 537 | 3300046660 | Ga0495625_0006109 | Ga0495625_0006109_7246_8487 | 403 |
| 538 | 3300046664 | Ga0495659_0002131 | Ga0495659_0002131_3958_5199 | 403 |
| 539 | 3300046691 | Ga0495670_0030233 | Ga0495670_0030233_886_2127 | 403 |
| 540 | 3300046692 | Ga0495671_0055284 | Ga0495671_0055284_337_1578 | 403 |
| 541 | 3300046694 | Ga0495649_0010756 | Ga0495649_0010756_3002_4276 | 403 |
| 542 | 3300047318 | Ga0495636_0008752 | Ga0495636_0008752_1065_2306 | 403 |
| 543 | 3300047320 | Ga0495672_0000030 | Ga0495672_0000030_109005_110246 | 403 |
| 544 | 3300047443 | Ga0495687_001381 | Ga0495687_001381_15284_16525 | 403 |
| 545 | 3300047445 | Ga0495677_0001585 | Ga0495677_0001585_1421_2662 | 403 |
| 546 | 3300047469 | Ga0495673_0000012 | Ga0495673_0000012_501112_502341 | 403 |
| 547 | 3300048920 | Ga0496117_0019390 | Ga0496117_0019390_1334_2563 | 403 |
| 548 | 3300048924 | Ga0496121_0035896 | Ga0496121_0035896_347_1576 | 403 |
| 549 | 3300048926 | Ga0496123_0047154 | Ga0496123_0047154_1352_2590 | 403 |
| 550 | 3300048929 | Ga0496126_0027379 | Ga0496126_0027379_1457_2704 | 403 |
| 551 | 3300049459 | Ga0495678_000040 | Ga0495678_000040_12708_13949 | 403 |
| 552 | 3300049459 | Ga0495678_010880 | Ga0495678_010880_2071_3312 | 403 |
| 553 | 3300049460 | Ga0495682_0002519 | Ga0495682_0002519_6679_7920 | 403 |
| 554 | 3300001979 | JGI24740J21852_10006707 | JGI24740J21852_100067073 | 404 |
| 555 | 3300003761 | Ga0055535_1000338 | Ga0055535_100033815 | 404 |
| 556 | 3300003762 | Ga0055542_1000103 | Ga0055542_100010349 | 404 |
| 557 | 3300003781 | Ga0055536_1006116 | Ga0055536_10061164 | 404 |
| 558 | 3300003791 | Ga0055530_10000237 | Ga0055530_1000023731 | 404 |
| 559 | 3300005539 | Ga0068853_100002802 | Ga0068853_1000028027 | 404 |
| 560 | 3300013307 | Ga0157372_10051846 | Ga0157372_100518462 | 404 |
| 561 | 3300025228 | Ga0209672_100869 | Ga0209672_1008699 | 404 |
| 562 | 3300025229 | Ga0209147_102071 | Ga0209147_1020715 | 404 |
| 563 | 3300025242 | Ga0209258_100133 | Ga0209258_100133112 | 404 |
| 564 | 3300025245 | Ga0207425_1000877 | Ga0207425_100087710 | 404 |
| 565 | 3300025254 | Ga0209148_1000188 | Ga0209148_100018850 | 404 |
| 566 | 3300025284 | Ga0209130_1000427 | Ga0209130_100042710 | 404 |
| 567 | 3300025292 | Ga0209676_1000111 | Ga0209676_1000111133 | 404 |
| 568 | 3300025297 | Ga0209758_1014472 | Ga0209758_10144723 | 404 |
| 569 | 3300025298 | Ga0209050_1000111 | Ga0209050_100011158 | 404 |
| 570 | 3300025303 | Ga0209051_1000340 | Ga0209051_100034012 | 404 |
| 571 | 3300025304 | Ga0209257_1000344 | Ga0209257_100034493 | 404 |
| 572 | 3300025321 | Ga0207656_10002283 | Ga0207656_100022835 | 404 |
| 573 | 3300026041 | Ga0207639_10032862 | Ga0207639_100328623 | 404 |
| 574 | 3300031239 | Ga0265328_10003427 | Ga0265328_100034274 | 404 |
| 575 | 3300031251 | Ga0265327_10002047 | Ga0265327_100020472 | 404 |
| 576 | 3300046460 | Ga0495638_0053773 | Ga0495638_0053773_693_1919 | 404 |
| 577 | 3300046515 | Ga0495620_0078404 | Ga0495620_0078404_46_1272 | 404 |
| 578 | 3300046518 | Ga0495631_0000182 | Ga0495631_0000182_30556_31782 | 404 |
| 579 | 3300046539 | Ga0495621_0022001 | Ga0495621_0022001_63_1289 | 404 |
| 580 | 3300046616 | Ga0495668_0041225 | Ga0495668_0041225_551_1777 | 404 |
| 581 | 3300048920 | Ga0496117_0018633 | Ga0496117_0018633_3670_4884 | 404 |
| 582 | 3300048921 | Ga0496118_0017580 | Ga0496118_0017580_5028_6329 | 404 |
| 583 | 3300048927 | Ga0496124_0065827 | Ga0496124_0065827_80_1294 | 404 |
| 584 | 3300048928 | Ga0496125_0032846 | Ga0496125_0032846_2051_3265 | 404 |
| 585 | 3300053118 | Ga0500594_0003130 | Ga0500594_0003130_1067_2293 | 404 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3qqu-assembly3.cif.gz_C | cocrystal structure of unphosphorylated igf with pyrimidine 8 | 0.4986 | 233 | 311 |
| 3v5q-assembly1.cif.gz_A | discovery of a selective trk inhibitor with efficacy in rodent cancer tumor models | 0.485 | 234 | 311 |
| 1rjb-assembly1.cif.gz_A | crystal structure of flt3 | 0.4837 | 232 | 310 |
| 3zzw-assembly1.cif.gz_A | crystal structure of the kinase domain of ror2 | 0.4606 | 233 | 309 |
| 5kmn-assembly1.cif.gz_A | trka jm-kinase with 1-(2-methyl-4-phenyl-pyrimidin-5-yl)-3-[[2-(trifluoromethyl)phenyl]methyl]urea | 0.4577 | 232 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A1D6IUE8_307_406_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.5481 | 232 | 310 | 3.30.200.20 |
| 4gl6A01 | Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Domain of unknown function (DUF5037), N-terminal subdomain | 0.5283 | 198 | 265 | 3.10.450.570 |
| af_A0A0R0HYU4_121_262_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.5151 | 209 | 351 | 3.30.200.20 |
| af_A0A0R0HYU4_121_262_3.30.200.20 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.4898 | 209 | 351 | 3.30.200.20 |
| 3zzwA01 | Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 | 0.4897 | 233 | 310 | 3.30.200.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0Q7HRP9-F1-model_v4 | DUF2252 domain-containing protein | 0.9903 | 1 | 401 |
|
| AF-A0A0Q7HRP9-F1-model_v4 | DUF2252 domain-containing protein | 0.9878 | 1 | 401 |
|
| AF-A0A127QI64-F1-model_v4 | DUF2252 domain-containing protein | 0.9876 | 1 | 402 |
|
| AF-A0A840FZC8-F1-model_v4 | Uncharacterized protein (DUF2252 family) | 0.9861 | 1 | 303 |
|
| AF-A0A127QI64-F1-model_v4 | DUF2252 domain-containing protein | 0.9851 | 1 | 402 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar