F466479

General Info

Members Datasets Scaffolds Average Seq Length
585 342 528 406

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0050946|Ga0495592_0050946_418_1842
Length 474
Sequence MVVRAGWRRWRPVGNIEADARDEHDVVHPTRPHDSLREHRACAEPAPGGMKPYEAASCHRAALRSTNGTPMPDIAKIIASFNAGRDPERLAMKYKAMRSSPFVFLRGTCHLFYERLPREKVLDDAPPVWICGDMHLENFGSYKADNRLIYFDNNDFDEACLAPALYELVRLLTSVLVGAADLKLSRAQALALCHTAVDAYGAALAVGKSRWIEAETAVGMVRDLFDALASRTRAAHLERRTVLKGKTRVLKVDGKKALPVTDEQRAAVTQFMQRFAASEPNPDFYRILDVARRIAGTGSLGVDRYVILVEGKGSPDGNYLIDLKEALPSSLTPHLHTPQPQWQTEAQRVVEVQRRNQAVSQAFLHAVDFNRRSYVLRSLQPSEDRVALSDWNGKLPRLEAVINSMAELSAWAHLRSGGRQKSSIADELIVFGNRKDWQLPLIDLATQCATQVGDDWKVYCEAFDRGGFEAGGKG

Samples

Sample ID Description Type Environment
1 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
2 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
3 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
4 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
5 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
6 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
7 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
8 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
9 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
10 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
11 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
12 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
13 2643221672 Variovorax sp. Root434 Isolate Unclassified
14 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
15 2738541277 Variovorax sp. GV051 Isolate Unclassified
16 2738541283 Pedobacter sp. OK701 Isolate Unclassified
17 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
18 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
19 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
20 2738541307 Variovorax sp. GV008 Isolate Unclassified
21 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
22 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
23 2738543019 Variovorax sp. GV040 Isolate Unclassified
24 2738543023 Pedobacter sp. OK628 Isolate Unclassified
25 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
26 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
27 2818991436 Collimonas arenae 515 Isolate Unclassified
28 2818991446 Variovorax sp. 1180 Isolate Unclassified
29 2818991450 Burkholderia sp. 604 Isolate Unclassified
30 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
31 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
32 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
33 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
34 2848694841 Nostoc sp. RF31YmG Isolate Unclassified
35 2885198086 Variovorax sp. 679 Isolate Unclassified
36 2885211737 Variovorax sp. 553 Isolate Unclassified
37 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
38 2899924645 Variovorax sp. 369 Isolate Unclassified
39 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
40 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
41 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
42 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
43 2928037797 Variovorax sp. 1126 Isolate Unclassified
44 2928044640 Variovorax sp. 1128 Isolate Unclassified
45 2928051484 Variovorax sp. 1133 Isolate Unclassified
46 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
47 2928070936 Variovorax gossypii 1167 Isolate Unclassified
48 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
49 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
50 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
51 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
52 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
53 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
54 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
55 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
56 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
57 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
58 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
59 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
60 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
61 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
62 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
63 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
64 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
65 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
66 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
67 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
68 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
69 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
70 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
71 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
72 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
73 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
74 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
75 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
76 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
77 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
78 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
79 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
80 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
81 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
82 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
83 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
84 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
85 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
86 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
87 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
88 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
89 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
90 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
91 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
92 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
93 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
94 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
95 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
96 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
97 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
98 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
99 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
100 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
101 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
102 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
103 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
104 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
105 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
106 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
107 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
108 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
109 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300009982 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_189 metaG Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
125 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
126 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
127 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
137 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
138 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
139 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
142 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
143 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
144 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
145 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
148 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
149 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
186 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
189 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
190 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
191 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
192 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
196 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
197 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
198 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
207 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
210 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
215 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
218 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
219 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
220 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
221 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
225 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
226 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
227 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
228 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
237 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
238 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
239 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
240 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
241 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
242 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
243 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
244 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
245 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
246 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
247 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
248 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
249 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
250 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
251 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
252 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
253 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
254 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
255 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
256 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
257 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
258 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
259 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
260 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
261 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
262 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
265 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
266 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
269 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
273 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
274 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
278 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
279 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
280 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
281 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
282 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
283 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
284 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
285 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
286 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
287 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
288 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
289 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
290 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
291 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
292 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
293 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
294 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
295 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
296 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
297 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
298 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
299 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
302 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
303 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
304 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
305 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
306 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
307 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
308 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
309 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
310 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
311 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
312 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
313 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
314 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
315 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
316 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
319 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
320 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
321 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
322 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
323 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
326 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
329 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
330 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
331 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
332 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
333 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
334 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
335 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
336 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
337 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
338 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
340 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
341 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
342 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 90.09
Metatranscriptomes 0.17
Isolates 9.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.07
Nodule 1.88
Rhizoplane 5.47
Rhizosphere 61.2
Stem 0
Stem Tuber 0
Unclassified 15.38

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10006707 3300001979 Bacteria 4743
2 JGI24739J22299_10000637 3300001989 Bacteria 12629
3 JGI24737J22298_10039946 3300001990 Bacteria 1441
4 JGI25156J39149_1000203 3300002705 Bacteria 41070
5 JGI25156J39149_1000978 3300002705 Bacteria 13628
6 JGI25162J39368_1000083 3300002737 Bacteria 109521
7 JGI25162J39368_1000152 3300002737 Bacteria 75441
8 JGI25163J39215_1001584 3300002771 Bacteria 3448
9 JGI25150J39212_1001106 3300002774 Bacteria 8134
10 JGI25165J46597_1000064 3300003214 Bacteria 199878
11 rootH1_10175801 3300003316 Unclassified 1967
12 rootH2_10022331 3300003320 Unclassified 2913
13 rootH2_10126121 3300003320 Bacteria 3455
14 rootL2_10002802 3300003322 Bacteria 12820
15 rootL2_10023011 3300003322 Bacteria 4608
16 rootL2_10026352 3300003322 Bacteria 21410
17 rootL2_10026353 3300003322 Bacteria 8336
18 rootL2_10103277 3300003322 Bacteria 4029
19 rootL2_10120755 3300003322 Bacteria 3798
20 rootL2_10192769 3300003322 Unclassified 3277
21 rootH1_10015716 3300003323 Bacteria 9779
22 rootH1_10074395 3300003323 Bacteria 5596
23 JGI25160J50197_1000080 3300003354 Bacteria 100869
24 JGI25160J50197_1000964 3300003354 Bacteria 15026
25 Ga0055538_1000031 3300003751 Bacteria 199878
26 Ga0055539_1000041 3300003752 Bacteria 199878
27 Ga0055533_1000051 3300003756 Bacteria 199878
28 Ga0055525_1000061 3300003759 Bacteria 199878
29 Ga0055535_1000338 3300003761 Bacteria 46755
30 Ga0055542_1000103 3300003762 Bacteria 114989
31 Ga0055529_1000076 3300003763 Bacteria 156104
32 Ga0055526_1000259 3300003771 Bacteria 44717
33 Ga0055537_1000106 3300003773 Bacteria 62947
34 Ga0055524_1004631 3300003775 Bacteria 6311
35 Ga0055536_1004894 3300003781 Bacteria 6685
36 Ga0055536_1006116 3300003781 Bacteria 5695
37 Ga0055534_1000355 3300003784 Bacteria 29272
38 Ga0055528_1000011 3300003790 Bacteria 218512
39 Ga0055530_10000237 3300003791 Bacteria 49495
40 Ga0055530_10010353 3300003791 Bacteria 3456
41 Ga0055540_1000436 3300003792 Bacteria 33152
42 Ga0055531_10000447 3300003794 Bacteria 38464
43 Ga0055541_1000028 3300003841 Bacteria 199878
44 Ga0065165_1000211 3300005262 Bacteria 101389
45 Ga0065704_10127031 3300005289 Unclassified 1677
46 Ga0070670_100002808 3300005331 Bacteria 14404
47 Ga0070666_10008348 3300005335 Bacteria 6425
48 Ga0070666_10047779 3300005335 Bacteria 2874
49 Ga0070660_100135872 3300005339 Bacteria 1970
50 Ga0070661_100102163 3300005344 Bacteria 2134
51 Ga0070661_100130917 3300005344 Bacteria 1884
52 Ga0070659_100057036 3300005366 Bacteria 3079
53 Ga0070667_100068884 3300005367 Bacteria 3011
54 Ga0070662_100010365 3300005457 Bacteria 6111
55 Ga0070662_100030750 3300005457 Bacteria 3761
56 Ga0068867_100079914 3300005459 Bacteria 2462
57 Ga0070707_100000015 3300005468 Bacteria 144611
58 Ga0070679_100230383 3300005530 Bacteria 1812
59 Ga0068853_100002802 3300005539 Bacteria 13190
60 Ga0068853_100011400 3300005539 Bacteria 7220
61 Ga0068853_100184792 3300005539 Bacteria 1891
62 Ga0070665_100001686 3300005548 Bacteria 25467
63 Ga0070665_100160850 3300005548 Bacteria 2248
64 Ga0070664_100033377 3300005564 Bacteria 4311
65 Ga0068857_100162089 3300005577 Bacteria 2029
66 Ga0068854_100002447 3300005578 Bacteria 11487
67 Ga0068852_100030106 3300005616 Bacteria 4465
68 Ga0068852_100313484 3300005616 Bacteria 1522
69 Ga0068858_100000825 3300005842 Bacteria 32311
70 Ga0081540_1033130 3300005983 Bacteria 2810
71 Ga0075368_10048407 3300006042 Bacteria 1685
72 Ga0075370_10002667 3300006353 Bacteria 8340
73 Ga0075428_100050916 3300006844 Bacteria 4541
74 Ga0075433_10072710 3300006852 Bacteria 3024
75 Ga0075433_10075279 3300006852 Bacteria 2970
76 Ga0105251_10000278 3300009011 Bacteria 51440
77 Ga0105244_10002309 3300009036 Bacteria 14495
78 Ga0105240_10000551 3300009093 Bacteria 69267
79 Ga0105240_10002995 3300009093 Bacteria 26581
80 Ga0105240_10038859 3300009093 Bacteria 6101
81 Ga0105240_10221984 3300009093 Bacteria 2201
82 Ga0111539_10019163 3300009094 Bacteria 8452
83 Ga0114129_10005656 3300009147 Bacteria 17691
84 Ga0105243_10003224 3300009148 Bacteria 13329
85 Ga0105241_10019938 3300009174 Bacteria 4950
86 Ga0105237_10001115 3300009545 Bacteria 35967
87 Ga0105237_10020124 3300009545 Bacteria 6888
88 Ga0105237_10024972 3300009545 Bacteria 6113
89 Ga0105237_10251413 3300009545 Bacteria 1770
90 Ga0105238_10042933 3300009551 Bacteria 4576
91 Ga0105238_10086241 3300009551 Bacteria 3127
92 Ga0105238_10236971 3300009551 Bacteria 1802
93 Ga0105249_10030868 3300009553 Bacteria 4845
94 Ga0105249_10222707 3300009553 Unclassified 1857
95 Ga0105147_100484 3300009982 Bacteria 3264
96 Ga0105239_10001815 3300010375 Bacteria 27993
97 Ga0105239_10002015 3300010375 Bacteria 26351
98 Ga0105239_10018814 3300010375 Bacteria 7631
99 Ga0105239_10037131 3300010375 Bacteria 5343
100 Ga0157369_10062297 3300013105 Unclassified 4020
101 Ga0157369_10074148 3300013105 Bacteria 3650
102 Ga0157369_10207906 3300013105 Bacteria 2052
103 Ga0157374_10002224 3300013296 Bacteria 16357
104 Ga0157372_10018637 3300013307 Bacteria 7466
105 Ga0157372_10051846 3300013307 Bacteria 4567
106 Ga0157372_10075063 3300013307 Bacteria 3814
107 Ga0157372_10564412 3300013307 Bacteria 1327
108 Ga0182008_10001746 3300014497 Bacteria 14279
109 Ga0182008_10002997 3300014497 Bacteria 10397
110 Ga0182006_1005866 3300015261 Bacteria 5780
111 Ga0182006_1007883 3300015261 Bacteria 4846
112 Ga0182006_1013506 3300015261 Bacteria 3542
113 Ga0182007_10000313 3300015262 Bacteria 30902
114 Ga0182007_10000432 3300015262 Bacteria 25560
115 Ga0182007_10003291 3300015262 Bacteria 7668
116 Ga0182007_10023437 3300015262 Bacteria 2170
117 Ga0182005_1003406 3300015265 Bacteria 5405
118 Ga0183361_10002 3300016635 Bacteria 907642
119 Ga0213872_10000001 3300021361 Bacteria 662532
120 Ga0213872_10000040 3300021361 Bacteria 122419
121 Ga0213872_10000139 3300021361 Bacteria 65459
122 Ga0213872_10000744 3300021361 Bacteria 24091
123 Ga0213872_10001832 3300021361 Bacteria 13186
124 Ga0213872_10002839 3300021361 Bacteria 9904
125 Ga0213872_10004883 3300021361 Bacteria 6987
126 Ga0213872_10024022 3300021361 Bacteria 2803
127 Ga0213872_10043563 3300021361 Bacteria 2044
128 Ga0209760_102590 3300025207 Bacteria 1674
129 Ga0209784_100039 3300025224 Bacteria 232021
130 Ga0209566_100023 3300025225 Bacteria 396571
131 Ga0209674_100040 3300025226 Bacteria 396571
132 Ga0209672_100869 3300025228 Bacteria 13849
133 Ga0209672_106428 3300025228 Bacteria 1911
134 Ga0209147_102071 3300025229 Bacteria 5676
135 Ga0209563_100072 3300025230 Bacteria 232021
136 Ga0209437_100097 3300025233 Bacteria 232021
137 Ga0209258_100133 3300025242 Bacteria 174846
138 Ga0207425_1000877 3300025245 Bacteria 14687
139 Ga0207425_1001817 3300025245 Bacteria 8267
140 Ga0209677_100041 3300025253 Bacteria 232021
141 Ga0209148_1000188 3300025254 Bacteria 117310
142 Ga0209759_1000010 3300025256 Bacteria 430463
143 Ga0209759_1001343 3300025256 Bacteria 14348
144 Ga0209129_1000245 3300025258 Bacteria 56975
145 Ga0209233_1000122 3300025261 Bacteria 232021
146 Ga0209565_1000003 3300025263 Bacteria 1099648
147 Ga0209565_1000165 3300025263 Bacteria 86871
148 Ga0209455_1000073 3300025272 Bacteria 291417
149 Ga0209673_1000003 3300025273 Bacteria 980859
150 Ga0209673_1000454 3300025273 Bacteria 69331
151 Ga0209130_1000427 3300025284 Bacteria 45224
152 Ga0209675_1000003 3300025291 Bacteria 1003982
153 Ga0209675_1000321 3300025291 Bacteria 43024
154 Ga0209675_1006477 3300025291 Bacteria 4685
155 Ga0209676_1000111 3300025292 Bacteria 213411
156 Ga0209676_1000880 3300025292 Bacteria 38456
157 Ga0209025_1000615 3300025294 Bacteria 64022
158 Ga0209025_1001104 3300025294 Bacteria 38839
159 Ga0209025_1004533 3300025294 Bacteria 11984
160 Ga0209564_1000070 3300025295 Bacteria 303126
161 Ga0209564_1000249 3300025295 Bacteria 115584
162 Ga0209564_1000352 3300025295 Bacteria 85941
163 Ga0209564_1004633 3300025295 Bacteria 8273
164 Ga0209758_1000297 3300025297 Bacteria 97664
165 Ga0209758_1000343 3300025297 Bacteria 85198
166 Ga0209758_1014472 3300025297 Bacteria 4190
167 Ga0209050_1000111 3300025298 Bacteria 213411
168 Ga0209050_1001354 3300025298 Bacteria 26840
169 Ga0209256_1000029 3300025299 Bacteria 415922
170 Ga0209256_1000047 3300025299 Bacteria 314709
171 Ga0209256_1000238 3300025299 Bacteria 97664
172 Ga0207426_1000021 3300025302 Bacteria 556343
173 Ga0207426_1000089 3300025302 Bacteria 281224
174 Ga0207426_1000194 3300025302 Bacteria 150009
175 Ga0207426_1000294 3300025302 Bacteria 98700
176 Ga0209051_1000340 3300025303 Bacteria 70080
177 Ga0209051_1000669 3300025303 Bacteria 38479
178 Ga0209257_1000149 3300025304 Bacteria 192835
179 Ga0209257_1000344 3300025304 Bacteria 96578
180 Ga0209257_1005188 3300025304 Bacteria 9372
181 Ga0207656_10002283 3300025321 Bacteria 6432
182 Ga0207655_1003116 3300025728 Bacteria 12574
183 Ga0207713_1000190 3300025735 Bacteria 86070
184 Ga0207680_10006967 3300025903 Bacteria 5482
185 Ga0207680_10028575 3300025903 Bacteria 3121
186 Ga0207680_10084315 3300025903 Bacteria 2005
187 Ga0207647_10001230 3300025904 Bacteria 19719
188 Ga0207647_10010390 3300025904 Bacteria 6575
189 Ga0207647_10015594 3300025904 Bacteria 5204
190 Ga0207654_10032284 3300025911 Bacteria 2892
191 Ga0207695_10000016 3300025913 Bacteria 771991
192 Ga0207695_10000758 3300025913 Bacteria 62084
193 Ga0207695_10019213 3300025913 Bacteria 7869
194 Ga0207695_10033988 3300025913 Bacteria 5552
195 Ga0207671_10017877 3300025914 Bacteria 5453
196 Ga0207671_10034970 3300025914 Bacteria 3731
197 Ga0207671_10049687 3300025914 Bacteria 3105
198 Ga0207649_10036869 3300025920 Bacteria 2949
199 Ga0207646_10000025 3300025922 Bacteria 248680
200 Ga0207694_10001284 3300025924 Bacteria 21647
201 Ga0207706_10005691 3300025933 Bacteria 11609
202 Ga0207706_10013523 3300025933 Bacteria 7418
203 Ga0207709_10001115 3300025935 Bacteria 19678
204 Ga0207679_10038927 3300025945 Bacteria 3393
205 Ga0207667_10168766 3300025949 Bacteria 2249
206 Ga0207712_10000731 3300025961 Bacteria 24976
207 Ga0207640_10175919 3300025981 Bacteria 1600
208 Ga0207658_10035689 3300025986 Bacteria 3562
209 Ga0207703_10000503 3300026035 Bacteria 40482
210 Ga0207639_10001076 3300026041 Bacteria 18520
211 Ga0207639_10032862 3300026041 Bacteria 3823
212 Ga0207639_10106608 3300026041 Bacteria 2275
213 Ga0207678_10002350 3300026067 Bacteria 17162
214 Ga0207702_10119631 3300026078 Bacteria 2355
215 Ga0207674_10024646 3300026116 Bacteria 6425
216 Ga0207683_10230902 3300026121 Bacteria 1687
217 Ga0207698_10267279 3300026142 Bacteria 1574
218 Ga0268266_10000006 3300028379 Bacteria 1410021
219 Ga0265334_10001873 3300028573 Bacteria 9987
220 Ga0265334_10038951 3300028573 Bacteria 1867
221 Ga0307517_10004553 3300028786 Bacteria 21271
222 Ga0307517_10062588 3300028786 Bacteria 3496
223 Ga0307515_10000006 3300028794 Bacteria 725810
224 Ga0307515_10003072 3300028794 Bacteria 35359
225 Ga0307515_10003775 3300028794 Bacteria 31740
226 Ga0307515_10060273 3300028794 Bacteria 5417
227 Ga0265338_10000092 3300028800 Bacteria 168538
228 Ga0265328_10003427 3300031239 Bacteria 7005
229 Ga0265331_10001700 3300031250 Bacteria 15866
230 Ga0265327_10000199 3300031251 Bacteria 125838
231 Ga0265327_10000217 3300031251 Bacteria 117085
232 Ga0265327_10002047 3300031251 Bacteria 22684
233 Ga0265327_10002400 3300031251 Bacteria 19882
234 Ga0265327_10013587 3300031251 Bacteria 5400
235 Ga0265316_10137959 3300031344 Bacteria 1834
236 Ga0307513_10197277 3300031456 Bacteria 1858
237 Ga0307509_10000018 3300031507 Bacteria 258998
238 Ga0307408_100004702 3300031548 Bacteria 9222
239 Ga0307508_10000357 3300031616 Bacteria 55613
240 Ga0307508_10008282 3300031616 Bacteria 9624
241 Ga0307514_10006151 3300031649 Bacteria 10532
242 Ga0265314_10074454 3300031711 Bacteria 2262
243 Ga0265314_10106053 3300031711 Bacteria 1796
244 Ga0307516_10210867 3300031730 Bacteria 1657
245 Ga0307412_10000002 3300031911 Bacteria 743446
246 Ga0373932_0003554 3300035112 Bacteria 3736
247 Ga0373931_0047018 3300035691 Bacteria 2283
248 Ga0373937_0107146 3300036401 Bacteria 2598
249 Ga0395900_0000585 3300037418 Bacteria 50049
250 Ga0395905_0000003 3300037471 Bacteria 1347396
251 Ga0395905_0000004 3300037471 Bacteria 674991
252 Ga0436361_0106476 3300039447 Bacteria 19218
253 Ga0436361_0404657 3300039447 Bacteria 144351
254 Ga0436361_0431677 3300039447 Bacteria 31322
255 Ga0436361_0632398 3300039447 Bacteria 1680
256 Ga0436361_0734234 3300039447 Bacteria 30887
257 Ga0436361_0837010 3300039447 Bacteria 7329
258 Ga0436361_0953601 3300039447 Bacteria 68101
259 Ga0436361_1021320 3300039447 Bacteria 6546
260 Ga0451577_0030468 3300042876 Bacteria 4875
261 Ga0451577_0158103 3300042876 Bacteria 2040
262 Ga0453684_0011915 3300044712 Bacteria 14477
263 Ga0453684_0046108 3300044712 Bacteria 5803
264 Ga0453684_0446073 3300044712 Bacteria 1441
265 Ga0466968_0015258 3300044735 Bacteria 3043
266 Ga0466957_0000181 3300044842 Bacteria 28481
267 Ga0451576_0001296 3300045051 Bacteria 43303
268 Ga0451576_0200431 3300045051 Bacteria 2085
269 Ga0451576_0309321 3300045051 Bacteria 1653
270 Ga0495617_037283 3300046452 Unclassified 1629
271 Ga0495627_019615 3300046453 Unclassified 2264
272 Ga0495592_0012215 3300046454 Bacteria 6517
273 Ga0495592_0050946 3300046454 Bacteria 3075
274 Ga0495603_0000664 3300046455 Bacteria 19449
275 Ga0495603_0007069 3300046455 Bacteria 6733
276 Ga0495591_002573 3300046458 Bacteria 9975
277 Ga0495629_0000031 3300046459 Bacteria 124543
278 Ga0495629_0002543 3300046459 Bacteria 13987
279 Ga0495629_0007083 3300046459 Bacteria 8263
280 Ga0495638_0053773 3300046460 Bacteria 2505
281 Ga0495641_0005699 3300046461 Bacteria 8292
282 Ga0495651_0002782 3300046462 Bacteria 13570
283 Ga0495651_0076834 3300046462 Bacteria 2528
284 Ga0495653_0000258 3300046463 Bacteria 42640
285 Ga0495653_0000389 3300046463 Bacteria 35173
286 Ga0495653_0000968 3300046463 Bacteria 22029
287 Ga0495653_0047127 3300046463 Bacteria 3335
288 Ga0495650_0002679 3300046471 Bacteria 13854
289 Ga0495580_0000021 3300046472 Bacteria 90091
290 Ga0495580_0000076 3300046472 Bacteria 61810
291 Ga0495580_0002282 3300046472 Bacteria 16733
292 Ga0495580_0036545 3300046472 Bacteria 3525
293 Ga0495580_0045898 3300046472 Bacteria 3102
294 Ga0495580_0113504 3300046472 Bacteria 1882
295 Ga0495582_0000782 3300046473 Bacteria 17621
296 Ga0495605_0001421 3300046474 Bacteria 15693
297 Ga0495605_0024007 3300046474 Bacteria 3196
298 Ga0495639_0013282 3300046475 Bacteria 3554
299 Ga0495662_0044404 3300046476 Bacteria 2146
300 Ga0495664_0002445 3300046477 Bacteria 9991
301 Ga0495585_0017898 3300046492 Bacteria 4089
302 Ga0495596_0009489 3300046500 Bacteria 4279
303 Ga0495596_0052628 3300046500 Bacteria 1594
304 Ga0495607_0015768 3300046501 Bacteria 4890
305 Ga0495583_0000014 3300046506 Bacteria 320136
306 Ga0495583_0002195 3300046506 Bacteria 17339
307 Ga0495583_0004445 3300046506 Bacteria 10028
308 Ga0495608_0005115 3300046511 Bacteria 9372
309 Ga0495608_0012300 3300046511 Bacteria 5945
310 Ga0495608_0027059 3300046511 Bacteria 3904
311 Ga0495610_0002532 3300046512 Bacteria 15252
312 Ga0495610_0003281 3300046512 Bacteria 12746
313 Ga0495616_0000350 3300046513 Bacteria 36334
314 Ga0495616_0016292 3300046513 Bacteria 4117
315 Ga0495618_0010899 3300046514 Bacteria 5505
316 Ga0495620_0005682 3300046515 Bacteria 6943
317 Ga0495620_0078404 3300046515 Bacteria 1339
318 Ga0495628_0001230 3300046516 Bacteria 23436
319 Ga0495628_0001786 3300046516 Bacteria 19559
320 Ga0495628_0003210 3300046516 Bacteria 14659
321 Ga0495628_0003625 3300046516 Bacteria 13799
322 Ga0495628_0062998 3300046516 Bacteria 2906
323 Ga0495628_0102381 3300046516 Bacteria 2209
324 Ga0495630_0001412 3300046517 Bacteria 16602
325 Ga0495630_0004733 3300046517 Bacteria 9547
326 Ga0495631_0000182 3300046518 Bacteria 42891
327 Ga0495643_0000051 3300046522 Bacteria 207804
328 Ga0495644_0001629 3300046523 Bacteria 9146
329 Ga0495648_0004257 3300046524 Bacteria 12278
330 Ga0495648_0018651 3300046524 Bacteria 4901
331 Ga0495648_0030635 3300046524 Bacteria 3553
332 Ga0495648_0054026 3300046524 Bacteria 2429
333 Ga0495648_0067362 3300046524 Bacteria 2094
334 Ga0495648_0084369 3300046524 Bacteria 1797
335 Ga0495666_0000060 3300046526 Bacteria 41912
336 Ga0495666_0002840 3300046526 Bacteria 8667
337 Ga0495666_0029423 3300046526 Bacteria 2702
338 Ga0495666_0040869 3300046526 Bacteria 2248
339 Ga0495652_0001838 3300046529 Bacteria 22545
340 Ga0495652_0016504 3300046529 Bacteria 6605
341 Ga0495652_0038138 3300046529 Bacteria 4164
342 Ga0495652_0156017 3300046529 Bacteria 1777
343 Ga0495665_0001624 3300046531 Bacteria 12037
344 Ga0495640_0009140 3300046533 Bacteria 7737
345 Ga0495640_0012832 3300046533 Bacteria 6392
346 Ga0495586_0002855 3300046535 Bacteria 9333
347 Ga0495587_0002127 3300046536 Bacteria 13241
348 Ga0495587_0010656 3300046536 Bacteria 5839
349 Ga0495609_0001951 3300046538 Bacteria 13109
350 Ga0495609_0036797 3300046538 Bacteria 2209
351 Ga0495621_0022001 3300046539 Bacteria 2108
352 Ga0495597_0002758 3300046542 Bacteria 10818
353 Ga0495645_0000671 3300046543 Bacteria 23558
354 Ga0495645_0046744 3300046543 Bacteria 3154
355 Ga0495645_0056436 3300046543 Bacteria 2851
356 Ga0495645_0211967 3300046543 Bacteria 1307
357 Ga0495622_0001070 3300046557 Bacteria 14421
358 Ga0495633_0000123 3300046558 Bacteria 104682
359 Ga0495656_0018478 3300046615 Bacteria 2677
360 Ga0495668_0041225 3300046616 Bacteria 2573
361 Ga0495634_0002070 3300046642 Bacteria 16973
362 Ga0495634_0168142 3300046642 Bacteria 1379
363 Ga0495611_0001934 3300046648 Bacteria 9845
364 Ga0495625_0006109 3300046660 Bacteria 10791
365 Ga0495625_0009265 3300046660 Bacteria 8260
366 Ga0495625_0057147 3300046660 Bacteria 2775
367 Ga0495625_0071832 3300046660 Bacteria 2428
368 Ga0495625_0073987 3300046660 Bacteria 2387
369 Ga0495625_0161344 3300046660 Bacteria 1502
370 Ga0495635_0002052 3300046663 Bacteria 13648
371 Ga0495635_0002302 3300046663 Bacteria 12987
372 Ga0495635_0006292 3300046663 Bacteria 8271
373 Ga0495635_0159437 3300046663 Bacteria 1535
374 Ga0495659_0002131 3300046664 Bacteria 6452
375 Ga0495661_0001386 3300046665 Bacteria 20365
376 Ga0495661_0002010 3300046665 Bacteria 16034
377 Ga0495657_0022156 3300046675 Bacteria 4555
378 Ga0495657_0082010 3300046675 Bacteria 2085
379 Ga0495599_0006398 3300046678 Bacteria 7103
380 Ga0495599_0012315 3300046678 Bacteria 5268
381 Ga0495599_0065516 3300046678 Bacteria 2269
382 Ga0495623_0003661 3300046679 Bacteria 10156
383 Ga0495623_0012713 3300046679 Bacteria 5449
384 Ga0495623_0018755 3300046679 Bacteria 4467
385 Ga0495646_0000327 3300046680 Bacteria 24455
386 Ga0495646_0000922 3300046680 Bacteria 16703
387 Ga0495646_0003965 3300046680 Bacteria 9258
388 Ga0495658_0001174 3300046683 Bacteria 13812
389 Ga0495613_0000484 3300046689 Bacteria 33725
390 Ga0495613_0010858 3300046689 Bacteria 6757
391 Ga0495624_0006440 3300046690 Bacteria 8331
392 Ga0495624_0006600 3300046690 Bacteria 8214
393 Ga0495624_0016215 3300046690 Bacteria 5016
394 Ga0495624_0016853 3300046690 Bacteria 4916
395 Ga0495624_0028769 3300046690 Bacteria 3628
396 Ga0495624_0148963 3300046690 Bacteria 1432
397 Ga0495670_0030233 3300046691 Bacteria 2690
398 Ga0495671_0055284 3300046692 Bacteria 1966
399 Ga0495671_0090597 3300046692 Bacteria 1497
400 Ga0495649_0010756 3300046694 Bacteria 5391
401 Ga0495649_0061822 3300046694 Bacteria 2013
402 Ga0495649_0067734 3300046694 Bacteria 1915
403 Ga0495589_0030159 3300046794 Bacteria 2732
404 Ga0495600_0000903 3300046809 Bacteria 15902
405 Ga0495600_0008523 3300046809 Bacteria 6303
406 Ga0495581_0000109 3300047315 Bacteria 34524
407 Ga0495604_0007596 3300047317 Bacteria 8582
408 Ga0495604_0034859 3300047317 Bacteria 3977
409 Ga0495636_0008752 3300047318 Bacteria 3990
410 Ga0495674_0008626 3300047319 Bacteria 9694
411 Ga0495674_0014957 3300047319 Bacteria 7264
412 Ga0495674_0024938 3300047319 Bacteria 5488
413 Ga0495674_0035881 3300047319 Bacteria 4469
414 Ga0495674_0149020 3300047319 Bacteria 1962
415 Ga0495672_0000030 3300047320 Bacteria 305021
416 Ga0495672_0010466 3300047320 Bacteria 6605
417 Ga0495676_0000589 3300047321 Bacteria 30003
418 Ga0495676_0023154 3300047321 Bacteria 5394
419 Ga0495676_0033937 3300047321 Bacteria 4288
420 Ga0495680_0010735 3300047322 Bacteria 8162
421 Ga0495683_0002068 3300047323 Bacteria 12436
422 Ga0495683_0024408 3300047323 Bacteria 3102
423 Ga0495687_001381 3300047443 Bacteria 22447
424 Ga0495675_0001280 3300047444 Bacteria 15253
425 Ga0495675_0015162 3300047444 Bacteria 4872
426 Ga0495677_0001585 3300047445 Bacteria 9169
427 Ga0495679_000006 3300047446 Bacteria 449956
428 Ga0495679_000464 3300047446 Bacteria 29754
429 Ga0495679_001198 3300047446 Bacteria 15417
430 Ga0495685_000071 3300047447 Bacteria 38265
431 Ga0495673_0000012 3300047469 Bacteria 656908
432 Ga0495673_0004686 3300047469 Bacteria 8491
433 Ga0495684_0015787 3300047471 Bacteria 5812
434 Ga0495684_0028956 3300047471 Bacteria 4250
435 Ga0495686_0000625 3300047472 Bacteria 48634
436 Ga0495593_0006168 3300047673 Bacteria 7051
437 Ga0495593_0006631 3300047673 Bacteria 6774
438 Ga0495593_0023304 3300047673 Bacteria 3442
439 Ga0495602_0015557 3300048088 Bacteria 7671
440 Ga0495602_0063208 3300048088 Bacteria 3208
441 Ga0495614_0007239 3300048089 Bacteria 4944
442 Ga0495614_0010109 3300048089 Bacteria 4164
443 Ga0495626_0014982 3300048091 Bacteria 3978
444 Ga0495626_0016445 3300048091 Bacteria 3756
445 Ga0495626_0019656 3300048091 Bacteria 3376
446 Ga0496100_0000624 3300048903 Bacteria 16781
447 Ga0496100_0002907 3300048903 Bacteria 8795
448 Ga0496101_0004067 3300048904 Bacteria 9144
449 Ga0496101_0004895 3300048904 Bacteria 8502
450 Ga0496101_0009712 3300048904 Bacteria 6333
451 Ga0496102_0000161 3300048905 Bacteria 90439
452 Ga0496102_0012843 3300048905 Bacteria 7249
453 Ga0496103_0000247 3300048906 Bacteria 52403
454 Ga0496103_0014464 3300048906 Bacteria 4685
455 Ga0496103_0018811 3300048906 Bacteria 4147
456 Ga0496104_0038880 3300048907 Bacteria 4453
457 Ga0496104_0231076 3300048907 Bacteria 1761
458 Ga0496105_0011662 3300048908 Bacteria 6954
459 Ga0496105_0026962 3300048908 Bacteria 4690
460 Ga0496105_0148038 3300048908 Bacteria 1931
461 Ga0496106_0011528 3300048909 Bacteria 6536
462 Ga0496107_0067556 3300048910 Bacteria 2594
463 Ga0496108_0026680 3300048911 Bacteria 4767
464 Ga0496108_0062085 3300048911 Bacteria 3146
465 Ga0496109_0052167 3300048912 Bacteria 3727
466 Ga0496110_0009042 3300048913 Bacteria 8039
467 Ga0496110_0025448 3300048913 Bacteria 5057
468 Ga0496111_0020486 3300048914 Bacteria 4604
469 Ga0496112_0054005 3300048915 Bacteria 3947
470 Ga0496112_0280846 3300048915 Bacteria 1612
471 Ga0496113_0000639 3300048916 Bacteria 17622
472 Ga0496113_0262034 3300048916 Bacteria 1381
473 Ga0496114_0073966 3300048917 Bacteria 2868
474 Ga0496116_0013171 3300048919 Bacteria 6691
475 Ga0496116_0019139 3300048919 Bacteria 5251
476 Ga0496117_0000722 3300048920 Bacteria 52144
477 Ga0496117_0004180 3300048920 Bacteria 16143
478 Ga0496117_0018633 3300048920 Bacteria 5739
479 Ga0496117_0019390 3300048920 Bacteria 5587
480 Ga0496118_0000441 3300048921 Bacteria 68784
481 Ga0496118_0001077 3300048921 Bacteria 42600
482 Ga0496118_0003693 3300048921 Bacteria 18967
483 Ga0496118_0005177 3300048921 Bacteria 14937
484 Ga0496118_0017580 3300048921 Bacteria 6500
485 Ga0496118_0027917 3300048921 Bacteria 4766
486 Ga0496118_0031770 3300048921 Bacteria 4367
487 Ga0496119_0021540 3300048922 Bacteria 4654
488 Ga0496121_0001960 3300048924 Bacteria 32769
489 Ga0496121_0008923 3300048924 Bacteria 11638
490 Ga0496121_0009766 3300048924 Bacteria 10973
491 Ga0496121_0032981 3300048924 Bacteria 4696
492 Ga0496121_0035896 3300048924 Bacteria 4429
493 Ga0496122_0011093 3300048925 Bacteria 9187
494 Ga0496122_0094161 3300048925 Bacteria 2029
495 Ga0496123_0020940 3300048926 Bacteria 5097
496 Ga0496123_0047154 3300048926 Bacteria 2915
497 Ga0496123_0069849 3300048926 Bacteria 2202
498 Ga0496124_0065827 3300048927 Bacteria 3020
499 Ga0496125_0020286 3300048928 Bacteria 6240
500 Ga0496125_0032846 3300048928 Bacteria 4603
501 Ga0496126_0000102 3300048929 Bacteria 201540
502 Ga0496126_0005701 3300048929 Bacteria 14110
503 Ga0496126_0027379 3300048929 Bacteria 5445
504 Ga0495678_000040 3300049459 Bacteria 190664
505 Ga0495678_005736 3300049459 Bacteria 6747
506 Ga0495678_010880 3300049459 Bacteria 4388
507 Ga0495682_0002519 3300049460 Bacteria 8650
508 Ga0495682_0014965 3300049460 Bacteria 2940
509 nmdc:mga0k408_105400_c1 3300050493 Bacteria 1664
510 nmdc:mga07m45_31431_c1 3300050496 Bacteria 2943
511 nmdc:mga05p37_1576_c1 3300050507 Bacteria 19968
512 nmdc:mga06r32_156666_c1 3300050510 Bacteria 2259
513 nmdc:mga0a205_274606_c1 3300050515 Bacteria 1562
514 nmdc:mga0a205_45791_c1 3300050515 Bacteria 4219
515 Ga0495601_0003095 3300053077 Bacteria 9496
516 Ga0495601_0037438 3300053077 Bacteria 3033
517 Ga0500650_0004587 3300053098 Bacteria 5017
518 Ga0500562_000058 3300053108 Bacteria 54762
519 Ga0500594_0003130 3300053118 Bacteria 3615
520 Ga0500595_001767 3300053119 Bacteria 11248
521 Ga0500626_017939 3300053128 Bacteria 3116
522 Ga0500658_0000101 3300053134 Bacteria 39385
523 Ga0500559_0001638 3300053136 Bacteria 12403
524 Ga0500568_0000111 3300053139 Bacteria 75413
525 Ga0500616_0015054 3300053153 Bacteria 4431
526 Ga0500616_0049272 3300053153 Bacteria 2230
527 Ga0500624_000138 3300053157 Bacteria 30876
528 Ga0587085_005812 3300059506 Unclassified 1472

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003323 rootH1_10015716 rootH1_100157163 321
2 3300047447 Ga0495685_000071 Ga0495685_000071_16571_17683 369
3 3300013105 Ga0157369_10207906 Ga0157369_102079061 375
4 3300046690 Ga0495624_0028769 Ga0495624_0028769_1970_3184 375
5 3300048929 Ga0496126_0000102 Ga0496126_0000102_71269_72483 375
6 3300005468 Ga0070707_100000015 Ga0070707_10000001562 376
7 3300046516 Ga0495628_0102381 Ga0495628_0102381_243_1457 379
8 3300046526 Ga0495666_0029423 Ga0495666_0029423_805_2019 379
9 3300046678 Ga0495599_0065516 Ga0495599_0065516_547_1761 379
10 3300047317 Ga0495604_0034859 Ga0495604_0034859_335_1549 379
11 3300037418 Ga0395900_0000585 Ga0395900_0000585_21834_23042 380
12 3300046472 Ga0495580_0113504 Ga0495580_0113504_577_1791 380
13 3300046524 Ga0495648_0067362 Ga0495648_0067362_454_1668 380
14 3300013105 Ga0157369_10074148 Ga0157369_100741482 383
15 3300013307 Ga0157372_10075063 Ga0157372_100750633 384
16 3300013296 Ga0157374_10002224 Ga0157374_100022242 388
17 3300006852 Ga0075433_10075279 Ga0075433_100752792 389
18 3300050515 nmdc:mga0a205_274606_c1 nmdc:mga0a205_274606_c1_144_1352 389
19 3300003320 rootH2_10126121 rootH2_101261212 390
20 3300003322 rootL2_10192769 rootL2_101927693 390
21 3300021361 Ga0213872_10000139 Ga0213872_100001394 390
22 3300039447 Ga0436361_0734234 Ga0436361_0734234_18595_19794 390
23 3300039447 Ga0436361_0632398 Ga0436361_0632398_344_1546 391
24 3300047472 Ga0495686_0000625 Ga0495686_0000625_44617_45810 391
25 3300005289 Ga0065704_10127031 Ga0065704_101270312 392
26 3300005983 Ga0081540_1033130 Ga0081540_10331302 392
27 3300009553 Ga0105249_10222707 Ga0105249_102227072 392
28 3300044712 Ga0453684_0046108 Ga0453684_0046108_3859_5043 392
29 iso_pu_bacteria 2848694841 2848701926 392
30 3300031250 Ga0265331_10001700 Ga0265331_100017008 393
31 3300031251 Ga0265327_10002400 Ga0265327_1000240013 393
32 3300003354 JGI25160J50197_1000964 JGI25160J50197_10009643 394
33 3300006852 Ga0075433_10072710 Ga0075433_100727104 394
34 3300025302 Ga0207426_1000089 Ga0207426_1000089122 394
35 3300028573 Ga0265334_10001873 Ga0265334_100018738 394
36 3300050515 nmdc:mga0a205_45791_c1 nmdc:mga0a205_45791_c1_2445_3632 394
37 3300031251 Ga0265327_10000217 Ga0265327_1000021723 395
38 3300042876 Ga0451577_0030468 Ga0451577_0030468_2376_3575 395
39 3300059506 Ga0587085_005812 Ga0587085_005812_120_1319 395
40 3300031251 Ga0265327_10000199 Ga0265327_1000019951 396
41 3300044712 Ga0453684_0446073 Ga0453684_0446073_165_1364 396
42 3300045051 Ga0451576_0001296 Ga0451576_0001296_248_1447 396
43 3300053153 Ga0500616_0049272 Ga0500616_0049272_460_1659 396
44 iso_pu_bacteria 2508501125 2509127065 396
45 iso_pu_bacteria 2513020051 2513230220 396
46 iso_pu_bacteria 2513237151 2513961097 396
47 iso_pu_bacteria 2643221672 2644397560 396
48 iso_pu_bacteria 2738541296 2738822084 396
49 iso_pu_bacteria 2738541298 2738834566 396
50 iso_pu_bacteria 2738541306 2738875770 396
51 iso_pu_bacteria 2738541307 2738882940 396
52 iso_pu_bacteria 2738543002 2739187722 396
53 iso_pu_bacteria 2738543008 2739222368 396
54 iso_pu_bacteria 2738543023 2739304266 396
55 iso_pu_bacteria 2818991436 2819541124 396
56 iso_pu_bacteria 2945934425 2945938465 396
57 iso_pu_bacteria 641736151 642423596 396
58 iso_pu_bacteria 8055266321 8055268708 396
59 3300002774 JGI25150J39212_1001106 JGI25150J39212_10011063 397
60 3300006844 Ga0075428_100050916 Ga0075428_1000509161 397
61 3300009094 Ga0111539_10019163 Ga0111539_100191635 397
62 3300025258 Ga0209129_1000245 Ga0209129_10002454 397
63 3300025263 Ga0209565_1000165 Ga0209565_100016537 397
64 3300025291 Ga0209675_1000321 Ga0209675_100032137 397
65 3300025294 Ga0209025_1000615 Ga0209025_10006154 397
66 3300025295 Ga0209564_1000352 Ga0209564_100035237 397
67 3300025297 Ga0209758_1000297 Ga0209758_100029737 397
68 3300025299 Ga0209256_1000238 Ga0209256_100023837 397
69 3300025302 Ga0207426_1000294 Ga0207426_100029437 397
70 3300025304 Ga0209257_1005188 Ga0209257_10051886 397
71 3300050510 nmdc:mga06r32_156666_c1 nmdc:mga06r32_156666_c1_887_2095 397
72 iso_pu_bacteria 2738541277 2738723308 397
73 iso_pu_bacteria 2738541283 2738756346 397
74 iso_pu_bacteria 2738543019 2739284039 397
75 iso_pu_bacteria 2928084124 2928088078 397
76 3300003320 rootH2_10022331 rootH2_100223312 398
77 3300003323 rootH1_10074395 rootH1_100743955 398
78 3300009147 Ga0114129_10005656 Ga0114129_100056569 398
79 3300009545 Ga0105237_10024972 Ga0105237_100249724 398
80 3300013307 Ga0157372_10564412 Ga0157372_105644121 398
81 3300021361 Ga0213872_10001832 Ga0213872_100018325 398
82 3300021361 Ga0213872_10004883 Ga0213872_100048835 398
83 3300025914 Ga0207671_10049687 Ga0207671_100496872 398
84 3300028573 Ga0265334_10038951 Ga0265334_100389512 398
85 3300028786 Ga0307517_10004553 Ga0307517_1000455320 398
86 3300028786 Ga0307517_10062588 Ga0307517_100625882 398
87 3300031616 Ga0307508_10008282 Ga0307508_100082827 398
88 3300031711 Ga0265314_10106053 Ga0265314_101060531 398
89 3300031730 Ga0307516_10210867 Ga0307516_102108672 398
90 3300037471 Ga0395905_0000003 Ga0395905_0000003_957210_958439 398
91 3300039447 Ga0436361_0837010 Ga0436361_0837010_1318_2514 398
92 3300044712 Ga0453684_0011915 Ga0453684_0011915_7667_8890 398
93 3300046660 Ga0495625_0073987 Ga0495625_0073987_681_1907 398
94 3300046660 Ga0495625_0161344 Ga0495625_0161344_208_1434 398
95 3300050493 nmdc:mga0k408_105400_c1 nmdc:mga0k408_105400_c1_58_1263 398
96 3300050507 nmdc:mga05p37_1576_c1 nmdc:mga05p37_1576_c1_10133_11332 398
97 3300053098 Ga0500650_0004587 Ga0500650_0004587_1268_2494 398
98 iso_pu_bacteria 2512047030 2512352265 398
99 iso_pu_bacteria 2513237166 2514046678 398
100 iso_pu_bacteria 2515154122 2515684528 398
101 iso_pu_bacteria 2562617112 2563060375 398
102 iso_pu_bacteria 2600255067 2600814374 398
103 iso_pu_bacteria 2711768613 2713475549 398
104 iso_pu_bacteria 2791355137 2792837322 398
105 iso_pu_bacteria 2818991450 2819620500 398
106 iso_pu_bacteria 2842324504 2842332791 398
107 iso_pu_bacteria 2842348783 2842356997 398
108 iso_pu_bacteria 2842454564 2842460776 398
109 iso_pu_bacteria 2885270888 2885279362 398
110 iso_pu_bacteria 2900634093 2900640410 398
111 iso_pu_bacteria 2902682994 2902684759 398
112 iso_pu_bacteria 2921643360 2921645858 398
113 iso_pu_bacteria 2928108538 2928108898 398
114 iso_pu_bacteria 2928135762 2928136122 398
115 iso_pu_bacteria 2928503688 2928504097 398
116 iso_pu_bacteria 642555112 642595842 398
117 iso_pu_bacteria 642555113 642616952 398
118 3300003316 rootH1_10175801 rootH1_101758012 399
119 3300003322 rootL2_10120755 rootL2_101207553 399
120 3300028794 Ga0307515_10000006 Ga0307515_10000006633 399
121 3300028794 Ga0307515_10003072 Ga0307515_1000307227 399
122 3300031456 Ga0307513_10197277 Ga0307513_101972772 399
123 3300042876 Ga0451577_0158103 Ga0451577_0158103_416_1642 399
124 3300045051 Ga0451576_0200431 Ga0451576_0200431_787_1986 399
125 3300045051 Ga0451576_0309321 Ga0451576_0309321_406_1632 399
126 3300046453 Ga0495627_019615 Ga0495627_019615_71_1279 399
127 3300046558 Ga0495633_0000123 Ga0495633_0000123_63150_64358 399
128 3300047321 Ga0495676_0033937 Ga0495676_0033937_1121_2320 399
129 3300047471 Ga0495684_0028956 Ga0495684_0028956_2979_4190 399
130 3300053108 Ga0500562_000058 Ga0500562_000058_834_2051 399
131 iso_pu_bacteria 2599185214 2599625316 399
132 iso_pu_bacteria 2599185226 2599673232 399
133 iso_pu_bacteria 2599185227 2599682902 399
134 iso_pu_bacteria 2599185229 2599694840 399
135 iso_pu_bacteria 2831265667 2831267483 399
136 iso_pu_bacteria 2885198086 2885198217 399
137 iso_pu_bacteria 2885211737 2885212403 399
138 3300002705 JGI25156J39149_1000203 JGI25156J39149_100020328 400
139 3300002737 JGI25162J39368_1000083 JGI25162J39368_100008397 400
140 3300002737 JGI25162J39368_1000152 JGI25162J39368_100015224 400
141 3300002771 JGI25163J39215_1001584 JGI25163J39215_10015842 400
142 3300003214 JGI25165J46597_1000064 JGI25165J46597_100006497 400
143 3300003322 rootL2_10103277 rootL2_101032772 400
144 3300003751 Ga0055538_1000031 Ga0055538_100003189 400
145 3300003752 Ga0055539_1000041 Ga0055539_100004189 400
146 3300003756 Ga0055533_1000051 Ga0055533_100005197 400
147 3300003759 Ga0055525_1000061 Ga0055525_100006190 400
148 3300003781 Ga0055536_1004894 Ga0055536_10048946 400
149 3300003791 Ga0055530_10010353 Ga0055530_100103532 400
150 3300003792 Ga0055540_1000436 Ga0055540_10004363 400
151 3300003794 Ga0055531_10000447 Ga0055531_1000044728 400
152 3300003841 Ga0055541_1000028 Ga0055541_100002890 400
153 3300005344 Ga0070661_100130917 Ga0070661_1001309172 400
154 3300005457 Ga0070662_100030750 Ga0070662_1000307502 400
155 3300005539 Ga0068853_100011400 Ga0068853_1000114009 400
156 3300005548 Ga0070665_100160850 Ga0070665_1001608502 400
157 3300005564 Ga0070664_100033377 Ga0070664_1000333775 400
158 3300006042 Ga0075368_10048407 Ga0075368_100484072 400
159 3300006353 Ga0075370_10002667 Ga0075370_100026678 400
160 3300009036 Ga0105244_10002309 Ga0105244_1000230911 400
161 3300009093 Ga0105240_10002995 Ga0105240_100029953 400
162 3300009148 Ga0105243_10003224 Ga0105243_100032243 400
163 3300009545 Ga0105237_10001115 Ga0105237_1000111535 400
164 3300009551 Ga0105238_10042933 Ga0105238_100429336 400
165 3300009551 Ga0105238_10236971 Ga0105238_102369711 400
166 3300010375 Ga0105239_10001815 Ga0105239_1000181528 400
167 3300014497 Ga0182008_10001746 Ga0182008_1000174612 400
168 3300015261 Ga0182006_1005866 Ga0182006_10058663 400
169 3300015261 Ga0182006_1007883 Ga0182006_10078832 400
170 3300015262 Ga0182007_10000432 Ga0182007_1000043212 400
171 3300015262 Ga0182007_10023437 Ga0182007_100234372 400
172 3300015265 Ga0182005_1003406 Ga0182005_10034063 400
173 3300025207 Ga0209760_102590 Ga0209760_1025902 400
174 3300025224 Ga0209784_100039 Ga0209784_100039127 400
175 3300025225 Ga0209566_100023 Ga0209566_100023127 400
176 3300025226 Ga0209674_100040 Ga0209674_100040127 400
177 3300025228 Ga0209672_106428 Ga0209672_1064282 400
178 3300025230 Ga0209563_100072 Ga0209563_100072127 400
179 3300025233 Ga0209437_100097 Ga0209437_100097127 400
180 3300025253 Ga0209677_100041 Ga0209677_100041127 400
181 3300025256 Ga0209759_1000010 Ga0209759_1000010241 400
182 3300025261 Ga0209233_1000122 Ga0209233_1000122127 400
183 3300025292 Ga0209676_1000880 Ga0209676_100088028 400
184 3300025298 Ga0209050_1001354 Ga0209050_100135418 400
185 3300025303 Ga0209051_1000669 Ga0209051_100066928 400
186 3300025304 Ga0209257_1000149 Ga0209257_1000149165 400
187 3300025728 Ga0207655_1003116 Ga0207655_10031169 400
188 3300025903 Ga0207680_10006967 Ga0207680_100069675 400
189 3300025904 Ga0207647_10010390 Ga0207647_100103902 400
190 3300025913 Ga0207695_10019213 Ga0207695_1001921310 400
191 3300025914 Ga0207671_10017877 Ga0207671_100178773 400
192 3300025920 Ga0207649_10036869 Ga0207649_100368695 400
193 3300025933 Ga0207706_10005691 Ga0207706_100056916 400
194 3300025935 Ga0207709_10001115 Ga0207709_1000111510 400
195 3300025945 Ga0207679_10038927 Ga0207679_100389272 400
196 3300025981 Ga0207640_10175919 Ga0207640_101759192 400
197 3300026121 Ga0207683_10230902 Ga0207683_102309022 400
198 3300031251 Ga0265327_10013587 Ga0265327_100135877 400
199 3300031911 Ga0307412_10000002 Ga0307412_10000002458 400
200 3300035112 Ga0373932_0003554 Ga0373932_0003554_544_1767 400
201 3300035691 Ga0373931_0047018 Ga0373931_0047018_600_1823 400
202 3300036401 Ga0373937_0107146 Ga0373937_0107146_1360_2562 400
203 3300046462 Ga0495651_0002782 Ga0495651_0002782_8962_10164 400
204 3300046462 Ga0495651_0076834 Ga0495651_0076834_788_1990 400
205 3300046463 Ga0495653_0000968 Ga0495653_0000968_12891_14093 400
206 3300046472 Ga0495580_0045898 Ga0495580_0045898_534_1736 400
207 3300046511 Ga0495608_0012300 Ga0495608_0012300_371_1573 400
208 3300046511 Ga0495608_0027059 Ga0495608_0027059_718_1920 400
209 3300046512 Ga0495610_0003281 Ga0495610_0003281_9846_11048 400
210 3300046516 Ga0495628_0003210 Ga0495628_0003210_689_1891 400
211 3300046516 Ga0495628_0003625 Ga0495628_0003625_3916_5118 400
212 3300046516 Ga0495628_0062998 Ga0495628_0062998_137_1339 400
213 3300046529 Ga0495652_0001838 Ga0495652_0001838_17132_18334 400
214 3300046529 Ga0495652_0016504 Ga0495652_0016504_1984_3186 400
215 3300046543 Ga0495645_0046744 Ga0495645_0046744_804_2006 400
216 3300046543 Ga0495645_0056436 Ga0495645_0056436_830_2032 400
217 3300046543 Ga0495645_0211967 Ga0495645_0211967_85_1287 400
218 3300046663 Ga0495635_0006292 Ga0495635_0006292_4262_5464 400
219 3300046663 Ga0495635_0159437 Ga0495635_0159437_221_1423 400
220 3300046678 Ga0495599_0006398 Ga0495599_0006398_5204_6406 400
221 3300046679 Ga0495623_0018755 Ga0495623_0018755_2267_3469 400
222 3300046680 Ga0495646_0000922 Ga0495646_0000922_7473_8675 400
223 3300046680 Ga0495646_0003965 Ga0495646_0003965_3579_4781 400
224 3300046683 Ga0495658_0001174 Ga0495658_0001174_9845_11047 400
225 3300046690 Ga0495624_0006440 Ga0495624_0006440_5433_6635 400
226 3300046690 Ga0495624_0016853 Ga0495624_0016853_1393_2595 400
227 3300046694 Ga0495649_0067734 Ga0495649_0067734_22_1224 400
228 3300046809 Ga0495600_0000903 Ga0495600_0000903_1876_3078 400
229 3300047319 Ga0495674_0149020 Ga0495674_0149020_669_1871 400
230 3300047323 Ga0495683_0024408 Ga0495683_0024408_1581_2783 400
231 3300048091 Ga0495626_0014982 Ga0495626_0014982_1737_2939 400
232 3300048911 Ga0496108_0062085 Ga0496108_0062085_522_1730 400
233 3300048912 Ga0496109_0052167 Ga0496109_0052167_1272_2480 400
234 3300048913 Ga0496110_0009042 Ga0496110_0009042_5658_6866 400
235 3300048914 Ga0496111_0020486 Ga0496111_0020486_1177_2385 400
236 3300048919 Ga0496116_0019139 Ga0496116_0019139_2153_3355 400
237 3300048921 Ga0496118_0003693 Ga0496118_0003693_16399_17601 400
238 3300048921 Ga0496118_0031770 Ga0496118_0031770_236_1438 400
239 3300048925 Ga0496122_0011093 Ga0496122_0011093_2536_3759 400
240 3300048926 Ga0496123_0020940 Ga0496123_0020940_632_1855 400
241 3300048928 Ga0496125_0020286 Ga0496125_0020286_3196_4398 400
242 3300050496 nmdc:mga07m45_31431_c1 nmdc:mga07m45_31431_c1_1163_2365 400
243 3300053077 Ga0495601_0003095 Ga0495601_0003095_3614_4816 400
244 3300053077 Ga0495601_0037438 Ga0495601_0037438_128_1330 400
245 3300053119 Ga0500595_001767 Ga0500595_001767_836_2038 400
246 iso_pu_bacteria 2818991446 2819602168 400
247 iso_pu_bacteria 2899924645 2899928765 400
248 iso_pu_bacteria 2904541872 2904549984 400
249 iso_pu_bacteria 2928037797 2928043299 400
250 iso_pu_bacteria 2928044640 2928051176 400
251 iso_pu_bacteria 2928051484 2928058768 400
252 iso_pu_bacteria 2928064002 2928066159 400
253 iso_pu_bacteria 2928070936 2928077813 400
254 iso_pu_bacteria 2929160207 2929164872 400
255 3300005331 Ga0070670_100002808 Ga0070670_10000280810 401
256 3300005335 Ga0070666_10008348 Ga0070666_100083485 401
257 3300005335 Ga0070666_10047779 Ga0070666_100477792 401
258 3300005344 Ga0070661_100102163 Ga0070661_1001021632 401
259 3300005367 Ga0070667_100068884 Ga0070667_1000688844 401
260 3300005457 Ga0070662_100010365 Ga0070662_1000103654 401
261 3300005459 Ga0068867_100079914 Ga0068867_1000799142 401
262 3300005548 Ga0070665_100001686 Ga0070665_1000016867 401
263 3300005578 Ga0068854_100002447 Ga0068854_1000024478 401
264 3300005616 Ga0068852_100030106 Ga0068852_1000301065 401
265 3300005616 Ga0068852_100313484 Ga0068852_1003134841 401
266 3300005842 Ga0068858_100000825 Ga0068858_10000082515 401
267 3300009093 Ga0105240_10000551 Ga0105240_1000055149 401
268 3300009093 Ga0105240_10038859 Ga0105240_100388593 401
269 3300009174 Ga0105241_10019938 Ga0105241_100199385 401
270 3300009545 Ga0105237_10251413 Ga0105237_102514132 401
271 3300009553 Ga0105249_10030868 Ga0105249_100308683 401
272 3300009982 Ga0105147_100484 Ga0105147_1004844 401
273 3300010375 Ga0105239_10037131 Ga0105239_100371313 401
274 3300013105 Ga0157369_10062297 Ga0157369_100622974 401
275 3300013307 Ga0157372_10018637 Ga0157372_100186378 401
276 3300014497 Ga0182008_10002997 Ga0182008_100029977 401
277 3300015261 Ga0182006_1013506 Ga0182006_10135062 401
278 3300015262 Ga0182007_10003291 Ga0182007_100032917 401
279 3300025903 Ga0207680_10028575 Ga0207680_100285754 401
280 3300025903 Ga0207680_10084315 Ga0207680_100843152 401
281 3300025904 Ga0207647_10001230 Ga0207647_100012308 401
282 3300025911 Ga0207654_10032284 Ga0207654_100322843 401
283 3300025913 Ga0207695_10000016 Ga0207695_10000016389 401
284 3300025913 Ga0207695_10000758 Ga0207695_100007588 401
285 3300025913 Ga0207695_10033988 Ga0207695_100339885 401
286 3300025914 Ga0207671_10034970 Ga0207671_100349702 401
287 3300025924 Ga0207694_10001284 Ga0207694_1000128416 401
288 3300025933 Ga0207706_10013523 Ga0207706_100135235 401
289 3300025961 Ga0207712_10000731 Ga0207712_100007313 401
290 3300025986 Ga0207658_10035689 Ga0207658_100356894 401
291 3300026035 Ga0207703_10000503 Ga0207703_1000050319 401
292 3300026041 Ga0207639_10001076 Ga0207639_1000107610 401
293 3300026067 Ga0207678_10002350 Ga0207678_1000235014 401
294 3300026078 Ga0207702_10119631 Ga0207702_101196313 401
295 3300026142 Ga0207698_10267279 Ga0207698_102672792 401
296 3300028379 Ga0268266_10000006 Ga0268266_10000006847 401
297 3300028794 Ga0307515_10003775 Ga0307515_100037756 401
298 3300028800 Ga0265338_10000092 Ga0265338_1000009255 401
299 3300031616 Ga0307508_10000357 Ga0307508_1000035751 401
300 3300031649 Ga0307514_10006151 Ga0307514_100061513 401
301 3300046475 Ga0495639_0013282 Ga0495639_0013282_763_1974 401
302 3300046513 Ga0495616_0000350 Ga0495616_0000350_27617_28828 401
303 3300046660 Ga0495625_0057147 Ga0495625_0057147_292_1500 401
304 3300046675 Ga0495657_0082010 Ga0495657_0082010_81_1292 401
305 3300047319 Ga0495674_0024938 Ga0495674_0024938_1264_2475 401
306 3300047320 Ga0495672_0010466 Ga0495672_0010466_5323_6531 401
307 3300048903 Ga0496100_0002907 Ga0496100_0002907_3291_4502 401
308 3300048904 Ga0496101_0004067 Ga0496101_0004067_4530_5741 401
309 3300048905 Ga0496102_0012843 Ga0496102_0012843_1601_2812 401
310 3300048906 Ga0496103_0014464 Ga0496103_0014464_2995_4206 401
311 3300048907 Ga0496104_0038880 Ga0496104_0038880_570_1781 401
312 3300048908 Ga0496105_0011662 Ga0496105_0011662_1295_2506 401
313 3300048909 Ga0496106_0011528 Ga0496106_0011528_1518_2729 401
314 3300048911 Ga0496108_0026680 Ga0496108_0026680_2435_3646 401
315 3300048913 Ga0496110_0025448 Ga0496110_0025448_2176_3387 401
316 3300048917 Ga0496114_0073966 Ga0496114_0073966_243_1454 401
317 3300048924 Ga0496121_0032981 Ga0496121_0032981_146_1354 401
318 3300048926 Ga0496123_0069849 Ga0496123_0069849_51_1259 401
319 3300053128 Ga0500626_017939 Ga0500626_017939_392_1600 401
320 3300053134 Ga0500658_0000101 Ga0500658_0000101_35283_36491 401
321 3300053136 Ga0500559_0001638 Ga0500559_0001638_7907_9115 401
322 3300053139 Ga0500568_0000111 Ga0500568_0000111_9836_11044 401
323 3300053153 Ga0500616_0015054 Ga0500616_0015054_2310_3518 401
324 3300053157 Ga0500624_000138 Ga0500624_000138_23948_25156 401
325 3300001989 JGI24739J22299_10000637 JGI24739J22299_1000063712 402
326 3300001990 JGI24737J22298_10039946 JGI24737J22298_100399461 402
327 3300002705 JGI25156J39149_1000978 JGI25156J39149_100097810 402
328 3300003322 rootL2_10002802 rootL2_100028026 402
329 3300003322 rootL2_10023011 rootL2_100230112 402
330 3300003354 JGI25160J50197_1000080 JGI25160J50197_100008034 402
331 3300005262 Ga0065165_1000211 Ga0065165_100021134 402
332 3300005339 Ga0070660_100135872 Ga0070660_1001358722 402
333 3300005366 Ga0070659_100057036 Ga0070659_1000570364 402
334 3300005530 Ga0070679_100230383 Ga0070679_1002303832 402
335 3300005539 Ga0068853_100184792 Ga0068853_1001847921 402
336 3300005577 Ga0068857_100162089 Ga0068857_1001620893 402
337 3300009011 Ga0105251_10000278 Ga0105251_1000027830 402
338 3300009093 Ga0105240_10221984 Ga0105240_102219841 402
339 3300009545 Ga0105237_10020124 Ga0105237_100201245 402
340 3300009551 Ga0105238_10086241 Ga0105238_100862413 402
341 3300010375 Ga0105239_10002015 Ga0105239_100020153 402
342 3300010375 Ga0105239_10018814 Ga0105239_100188145 402
343 3300015262 Ga0182007_10000313 Ga0182007_100003132 402
344 3300016635 Ga0183361_10002 Ga0183361_10002306 402
345 3300021361 Ga0213872_10000040 Ga0213872_1000004048 402
346 3300021361 Ga0213872_10000744 Ga0213872_1000074420 402
347 3300021361 Ga0213872_10002839 Ga0213872_100028392 402
348 3300021361 Ga0213872_10024022 Ga0213872_100240222 402
349 3300021361 Ga0213872_10043563 Ga0213872_100435632 402
350 3300025256 Ga0209759_1001343 Ga0209759_10013435 402
351 3300025295 Ga0209564_1004633 Ga0209564_10046337 402
352 3300025302 Ga0207426_1000021 Ga0207426_1000021300 402
353 3300025735 Ga0207713_1000190 Ga0207713_100019025 402
354 3300025904 Ga0207647_10015594 Ga0207647_100155942 402
355 3300025922 Ga0207646_10000025 Ga0207646_1000002551 402
356 3300026041 Ga0207639_10106608 Ga0207639_101066082 402
357 3300026116 Ga0207674_10024646 Ga0207674_100246465 402
358 3300028794 Ga0307515_10060273 Ga0307515_100602733 402
359 3300031344 Ga0265316_10137959 Ga0265316_101379592 402
360 3300031548 Ga0307408_100004702 Ga0307408_1000047026 402
361 3300037471 Ga0395905_0000004 Ga0395905_0000004_226077_227291 402
362 3300039447 Ga0436361_0106476 Ga0436361_0106476_10052_11263 402
363 3300039447 Ga0436361_0431677 Ga0436361_0431677_21537_22760 402
364 3300039447 Ga0436361_0953601 Ga0436361_0953601_66667_67899 402
365 3300039447 Ga0436361_1021320 Ga0436361_1021320_491_1729 402
366 3300044842 Ga0466957_0000181 Ga0466957_0000181_25163_26374 402
367 3300046454 Ga0495592_0012215 Ga0495592_0012215_1431_2645 402
368 3300046454 Ga0495592_0050946 Ga0495592_0050946_418_1842 402
369 3300046455 Ga0495603_0000664 Ga0495603_0000664_3428_4642 402
370 3300046455 Ga0495603_0007069 Ga0495603_0007069_3530_4744 402
371 3300046458 Ga0495591_002573 Ga0495591_002573_3140_4564 402
372 3300046459 Ga0495629_0000031 Ga0495629_0000031_73731_74945 402
373 3300046459 Ga0495629_0002543 Ga0495629_0002543_1426_2640 402
374 3300046459 Ga0495629_0007083 Ga0495629_0007083_234_1658 402
375 3300046461 Ga0495641_0005699 Ga0495641_0005699_3336_4550 402
376 3300046463 Ga0495653_0000258 Ga0495653_0000258_14869_16083 402
377 3300046463 Ga0495653_0000389 Ga0495653_0000389_1347_2561 402
378 3300046463 Ga0495653_0047127 Ga0495653_0047127_1263_2477 402
379 3300046471 Ga0495650_0002679 Ga0495650_0002679_4872_6101 402
380 3300046472 Ga0495580_0000021 Ga0495580_0000021_2918_4132 402
381 3300046472 Ga0495580_0000076 Ga0495580_0000076_49712_50926 402
382 3300046472 Ga0495580_0002282 Ga0495580_0002282_4508_5737 402
383 3300046472 Ga0495580_0036545 Ga0495580_0036545_903_2117 402
384 3300046473 Ga0495582_0000782 Ga0495582_0000782_12325_13539 402
385 3300046474 Ga0495605_0001421 Ga0495605_0001421_5683_6912 402
386 3300046476 Ga0495662_0044404 Ga0495662_0044404_248_1462 402
387 3300046477 Ga0495664_0002445 Ga0495664_0002445_7358_8572 402
388 3300046500 Ga0495596_0009489 Ga0495596_0009489_1300_2724 402
389 3300046500 Ga0495596_0052628 Ga0495596_0052628_246_1475 402
390 3300046506 Ga0495583_0002195 Ga0495583_0002195_2319_3533 402
391 3300046506 Ga0495583_0004445 Ga0495583_0004445_2944_4158 402
392 3300046511 Ga0495608_0005115 Ga0495608_0005115_2610_4034 402
393 3300046514 Ga0495618_0010899 Ga0495618_0010899_1780_2994 402
394 3300046515 Ga0495620_0005682 Ga0495620_0005682_1529_2758 402
395 3300046516 Ga0495628_0001230 Ga0495628_0001230_17029_18243 402
396 3300046516 Ga0495628_0001786 Ga0495628_0001786_9560_10774 402
397 3300046517 Ga0495630_0001412 Ga0495630_0001412_10804_12018 402
398 3300046517 Ga0495630_0004733 Ga0495630_0004733_2973_4397 402
399 3300046524 Ga0495648_0004257 Ga0495648_0004257_2421_3635 402
400 3300046524 Ga0495648_0018651 Ga0495648_0018651_1395_2819 402
401 3300046524 Ga0495648_0084369 Ga0495648_0084369_37_1266 402
402 3300046526 Ga0495666_0000060 Ga0495666_0000060_25583_26797 402
403 3300046526 Ga0495666_0002840 Ga0495666_0002840_4453_5877 402
404 3300046526 Ga0495666_0040869 Ga0495666_0040869_185_1399 402
405 3300046529 Ga0495652_0038138 Ga0495652_0038138_961_2175 402
406 3300046529 Ga0495652_0156017 Ga0495652_0156017_146_1360 402
407 3300046531 Ga0495665_0001624 Ga0495665_0001624_4262_5476 402
408 3300046533 Ga0495640_0009140 Ga0495640_0009140_190_1404 402
409 3300046533 Ga0495640_0012832 Ga0495640_0012832_4687_6111 402
410 3300046535 Ga0495586_0002855 Ga0495586_0002855_4417_5631 402
411 3300046536 Ga0495587_0002127 Ga0495587_0002127_10315_11739 402
412 3300046536 Ga0495587_0010656 Ga0495587_0010656_2029_3243 402
413 3300046543 Ga0495645_0000671 Ga0495645_0000671_18065_19279 402
414 3300046557 Ga0495622_0001070 Ga0495622_0001070_2404_3618 402
415 3300046642 Ga0495634_0002070 Ga0495634_0002070_12058_13272 402
416 3300046642 Ga0495634_0168142 Ga0495634_0168142_148_1362 402
417 3300046660 Ga0495625_0009265 Ga0495625_0009265_3483_4694 402
418 3300046660 Ga0495625_0071832 Ga0495625_0071832_447_1676 402
419 3300046663 Ga0495635_0002052 Ga0495635_0002052_7671_8885 402
420 3300046663 Ga0495635_0002302 Ga0495635_0002302_1512_2936 402
421 3300046665 Ga0495661_0001386 Ga0495661_0001386_11560_12984 402
422 3300046665 Ga0495661_0002010 Ga0495661_0002010_5261_6475 402
423 3300046675 Ga0495657_0022156 Ga0495657_0022156_2751_4175 402
424 3300046678 Ga0495599_0012315 Ga0495599_0012315_2101_3315 402
425 3300046679 Ga0495623_0003661 Ga0495623_0003661_3595_5019 402
426 3300046679 Ga0495623_0012713 Ga0495623_0012713_4146_5360 402
427 3300046680 Ga0495646_0000327 Ga0495646_0000327_8735_9949 402
428 3300046689 Ga0495613_0000484 Ga0495613_0000484_28809_30023 402
429 3300046689 Ga0495613_0010858 Ga0495613_0010858_152_1576 402
430 3300046690 Ga0495624_0006600 Ga0495624_0006600_1642_2856 402
431 3300046690 Ga0495624_0016215 Ga0495624_0016215_961_2175 402
432 3300046690 Ga0495624_0148963 Ga0495624_0148963_145_1359 402
433 3300046692 Ga0495671_0090597 Ga0495671_0090597_173_1387 402
434 3300046694 Ga0495649_0061822 Ga0495649_0061822_748_1977 402
435 3300046794 Ga0495589_0030159 Ga0495589_0030159_1473_2687 402
436 3300046809 Ga0495600_0008523 Ga0495600_0008523_4345_5769 402
437 3300047315 Ga0495581_0000109 Ga0495581_0000109_32616_33830 402
438 3300047317 Ga0495604_0007596 Ga0495604_0007596_4987_6201 402
439 3300047319 Ga0495674_0008626 Ga0495674_0008626_7853_9277 402
440 3300047319 Ga0495674_0014957 Ga0495674_0014957_2909_4126 402
441 3300047319 Ga0495674_0035881 Ga0495674_0035881_2423_3637 402
442 3300047321 Ga0495676_0000589 Ga0495676_0000589_20848_22062 402
443 3300047321 Ga0495676_0023154 Ga0495676_0023154_1022_2446 402
444 3300047322 Ga0495680_0010735 Ga0495680_0010735_4554_5768 402
445 3300047323 Ga0495683_0002068 Ga0495683_0002068_5877_7301 402
446 3300047444 Ga0495675_0001280 Ga0495675_0001280_4691_6115 402
447 3300047444 Ga0495675_0015162 Ga0495675_0015162_1610_2824 402
448 3300047446 Ga0495679_000006 Ga0495679_000006_148914_150143 402
449 3300047446 Ga0495679_000464 Ga0495679_000464_6753_7967 402
450 3300047446 Ga0495679_001198 Ga0495679_001198_3599_5023 402
451 3300047469 Ga0495673_0004686 Ga0495673_0004686_3374_4798 402
452 3300047471 Ga0495684_0015787 Ga0495684_0015787_1524_2738 402
453 3300047673 Ga0495593_0006168 Ga0495593_0006168_1916_3130 402
454 3300047673 Ga0495593_0006631 Ga0495593_0006631_4601_5815 402
455 3300047673 Ga0495593_0023304 Ga0495593_0023304_1414_2838 402
456 3300048088 Ga0495602_0015557 Ga0495602_0015557_1980_3194 402
457 3300048088 Ga0495602_0063208 Ga0495602_0063208_961_2175 402
458 3300048089 Ga0495614_0007239 Ga0495614_0007239_1064_2278 402
459 3300048089 Ga0495614_0010109 Ga0495614_0010109_961_2175 402
460 3300048091 Ga0495626_0016445 Ga0495626_0016445_2423_3652 402
461 3300048091 Ga0495626_0019656 Ga0495626_0019656_65_1279 402
462 3300048903 Ga0496100_0000624 Ga0496100_0000624_9281_10495 402
463 3300048904 Ga0496101_0004895 Ga0496101_0004895_1023_2237 402
464 3300048904 Ga0496101_0009712 Ga0496101_0009712_420_1634 402
465 3300048905 Ga0496102_0000161 Ga0496102_0000161_62118_63332 402
466 3300048906 Ga0496103_0000247 Ga0496103_0000247_22108_23322 402
467 3300048906 Ga0496103_0018811 Ga0496103_0018811_2721_3950 402
468 3300048907 Ga0496104_0231076 Ga0496104_0231076_257_1471 402
469 3300048908 Ga0496105_0026962 Ga0496105_0026962_924_2138 402
470 3300048908 Ga0496105_0148038 Ga0496105_0148038_146_1390 402
471 3300048910 Ga0496107_0067556 Ga0496107_0067556_66_1280 402
472 3300048915 Ga0496112_0054005 Ga0496112_0054005_262_1476 402
473 3300048915 Ga0496112_0280846 Ga0496112_0280846_77_1291 402
474 3300048916 Ga0496113_0000639 Ga0496113_0000639_4992_6206 402
475 3300048916 Ga0496113_0262034 Ga0496113_0262034_55_1269 402
476 3300048919 Ga0496116_0013171 Ga0496116_0013171_3346_4560 402
477 3300048920 Ga0496117_0000722 Ga0496117_0000722_27285_28499 402
478 3300048920 Ga0496117_0004180 Ga0496117_0004180_8957_10186 402
479 3300048921 Ga0496118_0000441 Ga0496118_0000441_40474_41688 402
480 3300048921 Ga0496118_0001077 Ga0496118_0001077_27807_29036 402
481 3300048921 Ga0496118_0005177 Ga0496118_0005177_3092_4306 402
482 3300048921 Ga0496118_0027917 Ga0496118_0027917_2559_3788 402
483 3300048922 Ga0496119_0021540 Ga0496119_0021540_2056_3270 402
484 3300048924 Ga0496121_0001960 Ga0496121_0001960_6266_7480 402
485 3300048924 Ga0496121_0008923 Ga0496121_0008923_6299_7513 402
486 3300048924 Ga0496121_0009766 Ga0496121_0009766_2648_3862 402
487 3300048925 Ga0496122_0094161 Ga0496122_0094161_606_1820 402
488 3300048929 Ga0496126_0005701 Ga0496126_0005701_6723_7937 402
489 3300049459 Ga0495678_005736 Ga0495678_005736_5403_6632 402
490 3300049460 Ga0495682_0014965 Ga0495682_0014965_662_2086 402
491 iso_pu_bacteria 2751185846 2753570103 402
492 3300003322 rootL2_10026352 rootL2_100263523 403
493 3300003322 rootL2_10026353 rootL2_100263533 403
494 3300003763 Ga0055529_1000076 Ga0055529_100007616 403
495 3300003771 Ga0055526_1000259 Ga0055526_100025918 403
496 3300003773 Ga0055537_1000106 Ga0055537_100010643 403
497 3300003775 Ga0055524_1004631 Ga0055524_10046314 403
498 3300003784 Ga0055534_1000355 Ga0055534_10003554 403
499 3300003790 Ga0055528_1000011 Ga0055528_1000011183 403
500 3300021361 Ga0213872_10000001 Ga0213872_10000001139 403
501 3300025245 Ga0207425_1001817 Ga0207425_10018172 403
502 3300025263 Ga0209565_1000003 Ga0209565_1000003858 403
503 3300025272 Ga0209455_1000073 Ga0209455_100007317 403
504 3300025273 Ga0209673_1000003 Ga0209673_1000003744 403
505 3300025273 Ga0209673_1000454 Ga0209673_100045427 403
506 3300025291 Ga0209675_1000003 Ga0209675_1000003180 403
507 3300025291 Ga0209675_1006477 Ga0209675_10064775 403
508 3300025294 Ga0209025_1001104 Ga0209025_100110429 403
509 3300025294 Ga0209025_1004533 Ga0209025_10045334 403
510 3300025295 Ga0209564_1000070 Ga0209564_1000070187 403
511 3300025295 Ga0209564_1000249 Ga0209564_100024914 403
512 3300025297 Ga0209758_1000343 Ga0209758_100034329 403
513 3300025299 Ga0209256_1000029 Ga0209256_1000029245 403
514 3300025299 Ga0209256_1000047 Ga0209256_1000047199 403
515 3300025302 Ga0207426_1000194 Ga0207426_100019478 403
516 3300025949 Ga0207667_10168766 Ga0207667_101687662 403
517 3300031507 Ga0307509_10000018 Ga0307509_10000018188 403
518 3300031711 Ga0265314_10074454 Ga0265314_100744543 403
519 3300039447 Ga0436361_0404657 Ga0436361_0404657_79155_80387 403
520 3300044735 Ga0466968_0015258 Ga0466968_0015258_1104_2363 403
521 3300046452 Ga0495617_037283 Ga0495617_037283_253_1494 403
522 3300046474 Ga0495605_0024007 Ga0495605_0024007_1622_2863 403
523 3300046492 Ga0495585_0017898 Ga0495585_0017898_1296_2537 403
524 3300046501 Ga0495607_0015768 Ga0495607_0015768_3164_4405 403
525 3300046506 Ga0495583_0000014 Ga0495583_0000014_3608_4849 403
526 3300046512 Ga0495610_0002532 Ga0495610_0002532_2076_3317 403
527 3300046513 Ga0495616_0016292 Ga0495616_0016292_459_1700 403
528 3300046522 Ga0495643_0000051 Ga0495643_0000051_13068_14309 403
529 3300046523 Ga0495644_0001629 Ga0495644_0001629_6574_7815 403
530 3300046524 Ga0495648_0030635 Ga0495648_0030635_1277_2518 403
531 3300046524 Ga0495648_0054026 Ga0495648_0054026_853_2094 403
532 3300046538 Ga0495609_0001951 Ga0495609_0001951_4430_5671 403
533 3300046538 Ga0495609_0036797 Ga0495609_0036797_260_1501 403
534 3300046542 Ga0495597_0002758 Ga0495597_0002758_8652_9899 403
535 3300046615 Ga0495656_0018478 Ga0495656_0018478_434_1675 403
536 3300046648 Ga0495611_0001934 Ga0495611_0001934_7605_8846 403
537 3300046660 Ga0495625_0006109 Ga0495625_0006109_7246_8487 403
538 3300046664 Ga0495659_0002131 Ga0495659_0002131_3958_5199 403
539 3300046691 Ga0495670_0030233 Ga0495670_0030233_886_2127 403
540 3300046692 Ga0495671_0055284 Ga0495671_0055284_337_1578 403
541 3300046694 Ga0495649_0010756 Ga0495649_0010756_3002_4276 403
542 3300047318 Ga0495636_0008752 Ga0495636_0008752_1065_2306 403
543 3300047320 Ga0495672_0000030 Ga0495672_0000030_109005_110246 403
544 3300047443 Ga0495687_001381 Ga0495687_001381_15284_16525 403
545 3300047445 Ga0495677_0001585 Ga0495677_0001585_1421_2662 403
546 3300047469 Ga0495673_0000012 Ga0495673_0000012_501112_502341 403
547 3300048920 Ga0496117_0019390 Ga0496117_0019390_1334_2563 403
548 3300048924 Ga0496121_0035896 Ga0496121_0035896_347_1576 403
549 3300048926 Ga0496123_0047154 Ga0496123_0047154_1352_2590 403
550 3300048929 Ga0496126_0027379 Ga0496126_0027379_1457_2704 403
551 3300049459 Ga0495678_000040 Ga0495678_000040_12708_13949 403
552 3300049459 Ga0495678_010880 Ga0495678_010880_2071_3312 403
553 3300049460 Ga0495682_0002519 Ga0495682_0002519_6679_7920 403
554 3300001979 JGI24740J21852_10006707 JGI24740J21852_100067073 404
555 3300003761 Ga0055535_1000338 Ga0055535_100033815 404
556 3300003762 Ga0055542_1000103 Ga0055542_100010349 404
557 3300003781 Ga0055536_1006116 Ga0055536_10061164 404
558 3300003791 Ga0055530_10000237 Ga0055530_1000023731 404
559 3300005539 Ga0068853_100002802 Ga0068853_1000028027 404
560 3300013307 Ga0157372_10051846 Ga0157372_100518462 404
561 3300025228 Ga0209672_100869 Ga0209672_1008699 404
562 3300025229 Ga0209147_102071 Ga0209147_1020715 404
563 3300025242 Ga0209258_100133 Ga0209258_100133112 404
564 3300025245 Ga0207425_1000877 Ga0207425_100087710 404
565 3300025254 Ga0209148_1000188 Ga0209148_100018850 404
566 3300025284 Ga0209130_1000427 Ga0209130_100042710 404
567 3300025292 Ga0209676_1000111 Ga0209676_1000111133 404
568 3300025297 Ga0209758_1014472 Ga0209758_10144723 404
569 3300025298 Ga0209050_1000111 Ga0209050_100011158 404
570 3300025303 Ga0209051_1000340 Ga0209051_100034012 404
571 3300025304 Ga0209257_1000344 Ga0209257_100034493 404
572 3300025321 Ga0207656_10002283 Ga0207656_100022835 404
573 3300026041 Ga0207639_10032862 Ga0207639_100328623 404
574 3300031239 Ga0265328_10003427 Ga0265328_100034274 404
575 3300031251 Ga0265327_10002047 Ga0265327_100020472 404
576 3300046460 Ga0495638_0053773 Ga0495638_0053773_693_1919 404
577 3300046515 Ga0495620_0078404 Ga0495620_0078404_46_1272 404
578 3300046518 Ga0495631_0000182 Ga0495631_0000182_30556_31782 404
579 3300046539 Ga0495621_0022001 Ga0495621_0022001_63_1289 404
580 3300046616 Ga0495668_0041225 Ga0495668_0041225_551_1777 404
581 3300048920 Ga0496117_0018633 Ga0496117_0018633_3670_4884 404
582 3300048921 Ga0496118_0017580 Ga0496118_0017580_5028_6329 404
583 3300048927 Ga0496124_0065827 Ga0496124_0065827_80_1294 404
584 3300048928 Ga0496125_0032846 Ga0496125_0032846_2051_3265 404
585 3300053118 Ga0500594_0003130 Ga0500594_0003130_1067_2293 404

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10009

DUF2252

Uncharacterized protein conserved in bacteria (DUF2252)

85

462

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qqu-assembly3.cif.gz_C cocrystal structure of unphosphorylated igf with pyrimidine 8 0.4986 233 311
3v5q-assembly1.cif.gz_A discovery of a selective trk inhibitor with efficacy in rodent cancer tumor models 0.485 234 311
1rjb-assembly1.cif.gz_A crystal structure of flt3 0.4837 232 310
3zzw-assembly1.cif.gz_A crystal structure of the kinase domain of ror2 0.4606 233 309
5kmn-assembly1.cif.gz_A trka jm-kinase with 1-(2-methyl-4-phenyl-pyrimidin-5-yl)-3-[[2-(trifluoromethyl)phenyl]methyl]urea 0.4577 232 310
ID Description Score Start End Superfamily
af_A0A1D6IUE8_307_406_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5481 232 310 3.30.200.20
4gl6A01 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,;Domain of unknown function (DUF5037), N-terminal subdomain 0.5283 198 265 3.10.450.570
af_A0A0R0HYU4_121_262_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.5151 209 351 3.30.200.20
af_A0A0R0HYU4_121_262_3.30.200.20 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4898 209 351 3.30.200.20
3zzwA01 Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1 0.4897 233 310 3.30.200.20
ID Description Score Start End GO Terms
AF-A0A0Q7HRP9-F1-model_v4 DUF2252 domain-containing protein 0.9903 1 401
AF-A0A0Q7HRP9-F1-model_v4 DUF2252 domain-containing protein 0.9878 1 401
AF-A0A127QI64-F1-model_v4 DUF2252 domain-containing protein 0.9876 1 402
AF-A0A840FZC8-F1-model_v4 Uncharacterized protein (DUF2252 family) 0.9861 1 303
AF-A0A127QI64-F1-model_v4 DUF2252 domain-containing protein 0.9851 1 402

Feature Viewer

pLDDT pTM Quality
93.35 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map