F466464

General Info

Members Datasets Scaffolds Average Seq Length
585 318 1134 318

Family's Representative Sequence

Representative Sequence 3300035724|Ga0373933_0008375|Ga0373933_0008375_29_1174
Length 381
Sequence MIGDAEIRVAQRLGALRHRRHVLARRQATSRADVNAKIHLSPVWLAAWDRVLSSLPTQFKREEQMQIGCSAPSSGPLIAPDSLVRIATEAEMLGFDYITVSDHVMMPKSVVSRYPYSASGEFPSGAGAARLEQLTTAAFIAAATSKLRIVTSVMVVPHRPAVLTAKILATIDYLSKGRLTLGIGAGWCKEEFEAIGAPPFEDRGNVTDEWMMACKELWAKDDPKFNGKYVKFSDVVFTPKPAQKSIPIWVGGESGPALRRTAKYADAWYPIGTNPQFPMDTLTRFKAGVAKLRDLTAKAGRDPSAVTVAYRISSNAEAQPKGTVDGERKLFTGGAADFVGDIKALAEAGVTSFDSGMFAPTLAGTVDNMRRFKDEVMAKVK

Samples

Sample ID Description Type Environment
1 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
50 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
51 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
58 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
59 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
76 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
101 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
102 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
108 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
153 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
154 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
155 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
156 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
173 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
174 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
175 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
179 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
180 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
181 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
182 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
187 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
188 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
189 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
209 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
210 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
211 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
212 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
213 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
214 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
215 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
221 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
224 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
231 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
232 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
235 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
236 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
237 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
238 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
239 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
240 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
241 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
248 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
249 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
250 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
251 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
252 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
256 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
257 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
258 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
259 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
267 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
268 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
269 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
270 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
271 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
272 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
273 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
276 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
277 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
278 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
279 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
280 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
281 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
282 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
285 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
286 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
288 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
292 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
293 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
294 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
295 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
302 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
303 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
304 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
305 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
306 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
307 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
312 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
313 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
314 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
315 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
316 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
317 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
318 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.34
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.18
Nodule 0.17
Rhizoplane 5.13
Rhizosphere 82.05
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373933_0008375 3300035724 Bacteria 5647
2 rootH2_10030919 3300003320 Bacteria 1593
3 rootH1_10159843 3300003323 Bacteria 3231
4 JGI25404J52841_10000129 3300003659 Bacteria 7895
5 Ga0065715_10238085 3300005293 Bacteria 1209
6 Ga0070683_100101208 3300005329 Bacteria 2713
7 Ga0070683_100282497 3300005329 Bacteria 1579
8 Ga0068869_100154434 3300005334 Bacteria 1782
9 Ga0070680_100001756 3300005336 Bacteria 15929
10 Ga0070680_100084694 3300005336 Bacteria 2618
11 Ga0070682_100122280 3300005337 Bacteria 1750
12 Ga0068868_100038030 3300005338 Bacteria 3734
13 Ga0070660_100200734 3300005339 Bacteria 1618
14 Ga0070691_10000821 3300005341 Bacteria 12463
15 Ga0070661_100088309 3300005344 Bacteria 2294
16 Ga0070668_100008736 3300005347 Bacteria 7524
17 Ga0070668_100038380 3300005347 Bacteria 3660
18 Ga0070668_100115029 3300005347 Bacteria 2144
19 Ga0070669_100182330 3300005353 Bacteria 1643
20 Ga0070675_100114187 3300005354 Bacteria 2288
21 Ga0070674_100001074 3300005356 Bacteria 14307
22 Ga0070674_100027452 3300005356 Bacteria 3730
23 Ga0070688_100040050 3300005365 Bacteria 2870
24 Ga0070688_100114586 3300005365 Bacteria 1797
25 Ga0070667_100310438 3300005367 Bacteria 1421
26 Ga0070709_10090195 3300005434 Bacteria 2020
27 Ga0070714_100061545 3300005435 Bacteria 3225
28 Ga0070713_100030707 3300005436 Bacteria 4270
29 Ga0070713_100050835 3300005436 Bacteria 3426
30 Ga0070713_100069160 3300005436 Bacteria 2977
31 Ga0070713_100080622 3300005436 Bacteria 2776
32 Ga0070713_100350225 3300005436 Bacteria 1370
33 Ga0070713_100667940 3300005436 Bacteria 990
34 Ga0070710_10069846 3300005437 Bacteria 2022
35 Ga0070694_100142942 3300005444 Bacteria 1740
36 Ga0070708_100103724 3300005445 Bacteria 2607
37 Ga0070708_100138311 3300005445 Bacteria 2257
38 Ga0070663_100072070 3300005455 Bacteria 2515
39 Ga0070663_100227377 3300005455 Bacteria 1467
40 Ga0070678_100509840 3300005456 Bacteria 1062
41 Ga0070681_10002051 3300005458 Bacteria 18267
42 Ga0070681_10168673 3300005458 Bacteria 2111
43 Ga0068867_100021184 3300005459 Bacteria 4636
44 Ga0068867_100519229 3300005459 Bacteria 1027
45 Ga0070685_10134858 3300005466 Bacteria 1547
46 Ga0070706_100049105 3300005467 Bacteria 3894
47 Ga0070706_100426131 3300005467 Bacteria 1235
48 Ga0070707_100422244 3300005468 Bacteria 1294
49 Ga0070698_100007463 3300005471 Bacteria 11829
50 Ga0070698_100266281 3300005471 Bacteria 1646
51 Ga0070679_100015969 3300005530 Bacteria 7230
52 Ga0070679_100595850 3300005530 Bacteria 1048
53 Ga0070684_100005664 3300005535 Bacteria 9595
54 Ga0070697_100328070 3300005536 Bacteria 1319
55 Ga0068853_100347726 3300005539 Bacteria 1379
56 Ga0070686_100041796 3300005544 Bacteria 2868
57 Ga0070693_100094073 3300005547 Bacteria 1812
58 Ga0070665_100029936 3300005548 Bacteria 5479
59 Ga0070665_100122465 3300005548 Bacteria 2603
60 Ga0070704_100487413 3300005549 Bacteria 1068
61 Ga0068855_100004887 3300005563 Bacteria 16360
62 Ga0068855_100216746 3300005563 Bacteria 2148
63 Ga0068857_100039165 3300005577 Bacteria 4198
64 Ga0068854_100164325 3300005578 Bacteria 1722
65 Ga0068856_100197555 3300005614 Unclassified 2026
66 Ga0068852_100027732 3300005616 Bacteria 4620
67 Ga0068852_100069422 3300005616 Bacteria 3088
68 Ga0068852_100257676 3300005616 Bacteria 1674
69 Ga0068859_100582984 3300005617 Bacteria 1212
70 Ga0068861_100093926 3300005719 Bacteria 2372
71 Ga0068861_100210513 3300005719 Bacteria 1637
72 Ga0068858_100092489 3300005842 Plasmid 2815
73 Ga0068858_100204158 3300005842 Bacteria 1870
74 Ga0068860_100229594 3300005843 Bacteria 1803
75 Ga0068862_100171602 3300005844 Bacteria 1942
76 Ga0068862_100273222 3300005844 Bacteria 1546
77 Ga0068862_100287570 3300005844 Bacteria 1509
78 Ga0081455_10000911 3300005937 Bacteria 37905
79 Ga0081455_10033729 3300005937 Bacteria 4596
80 Ga0081455_10034652 3300005937 Bacteria 4521
81 Ga0081455_10102075 3300005937 Bacteria 2301
82 Ga0081455_10129048 3300005937 Bacteria 1980
83 Ga0081540_1000370 3300005983 Bacteria 45002
84 Ga0081540_1005450 3300005983 Bacteria 9494
85 Ga0081540_1010161 3300005983 Bacteria 6402
86 Ga0081540_1012027 3300005983 Bacteria 5731
87 Ga0081540_1037353 3300005983 Bacteria 2576
88 Ga0081539_10002318 3300005985 Bacteria 27421
89 Ga0081539_10004117 3300005985 Bacteria 16568
90 Ga0070717_10054641 3300006028 Bacteria 3293
91 Ga0075365_10024536 3300006038 Bacteria 3806
92 Ga0075365_10075629 3300006038 Bacteria 2273
93 Ga0075368_10021290 3300006042 Bacteria 2462
94 Ga0075368_10021322 3300006042 Bacteria 2460
95 Ga0075368_10070053 3300006042 Bacteria 1415
96 Ga0075363_100002481 3300006048 Bacteria 7551
97 Ga0075364_10060420 3300006051 Bacteria 2485
98 Ga0070716_100303463 3300006173 Bacteria 1112
99 Ga0070712_100007702 3300006175 Bacteria 6736
100 Ga0070712_100105303 3300006175 Unclassified 2094
101 Ga0070712_100161606 3300006175 Bacteria 1730
102 Ga0070712_100194147 3300006175 Bacteria 1591
103 Ga0075362_10012025 3300006177 Bacteria 3425
104 Ga0075362_10075544 3300006177 Bacteria 1545
105 Ga0075367_10002181 3300006178 Bacteria 8816
106 Ga0075367_10029320 3300006178 Bacteria 3147
107 Ga0075367_10151611 3300006178 Bacteria 1439
108 Ga0075369_10008108 3300006186 Bacteria 4029
109 Ga0075366_10031709 3300006195 Bacteria 3111
110 Ga0075366_10130988 3300006195 Bacteria 1513
111 Ga0075428_100007216 3300006844 Bacteria 12310
112 Ga0075428_100680046 3300006844 Bacteria 1097
113 Ga0075430_100041228 3300006846 Bacteria 3906
114 Ga0075431_100000022 3300006847 Bacteria 81789
115 Ga0075434_100037820 3300006871 Bacteria 4777
116 Ga0075434_100129905 3300006871 Bacteria 2538
117 Ga0075429_100001093 3300006880 Bacteria 21833
118 Ga0068865_100262575 3300006881 Bacteria 1368
119 Ga0068865_100292031 3300006881 Bacteria 1302
120 Ga0075436_100099513 3300006914 Bacteria 2024
121 Ga0075436_100235604 3300006914 Unclassified 1301
122 Ga0097620_100582910 3300006931 Bacteria 1212
123 Ga0075435_100332267 3300007076 Bacteria 1302
124 Ga0105250_10049961 3300009092 Bacteria 1678
125 Ga0105240_10006552 3300009093 Bacteria 17102
126 Ga0105240_10173530 3300009093 Bacteria 2551
127 Ga0111539_10000091 3300009094 Bacteria 94456
128 Ga0111539_10247827 3300009094 Bacteria 2074
129 Ga0105245_10557794 3300009098 Bacteria 1168
130 Ga0114129_10000009 3300009147 Bacteria 149356
131 Ga0105243_10092363 3300009148 Bacteria 2495
132 Ga0105242_10190803 3300009176 Bacteria 1814
133 Ga0105248_10158381 3300009177 Bacteria 2555
134 Ga0105248_10168342 3300009177 Bacteria 2470
135 Ga0105237_10142109 3300009545 Bacteria 2394
136 Ga0105237_10283989 3300009545 Bacteria 1658
137 Ga0105238_10056841 3300009551 Bacteria 3924
138 Ga0105238_10085826 3300009551 Bacteria 3135
139 Ga0105238_10113434 3300009551 Bacteria 2690
140 Ga0105249_10024316 3300009553 Bacteria 5444
141 Ga0105249_10194705 3300009553 Bacteria 1980
142 Ga0099796_10011081 3300010159 Bacteria 2503
143 Ga0105239_10364248 3300010375 Bacteria 1633
144 Ga0157373_10104430 3300013100 Bacteria 1993
145 Ga0157370_10014309 3300013104 Bacteria 8119
146 Ga0157370_10060466 3300013104 Bacteria 3597
147 Ga0157369_10016093 3300013105 Bacteria 8416
148 Ga0157369_10270841 3300013105 Bacteria 1769
149 Ga0157369_10389142 3300013105 Bacteria 1447
150 Ga0157374_10182685 3300013296 Bacteria 2049
151 Ga0157374_10482583 3300013296 Bacteria 1243
152 Ga0163162_10329850 3300013306 Bacteria 1658
153 Ga0163162_10627192 3300013306 Bacteria 1200
154 Ga0157375_10371107 3300013308 Bacteria 1597
155 Ga0163163_10309021 3300014325 Bacteria 1634
156 Ga0163163_10467311 3300014325 Bacteria 1322
157 Ga0182008_10038268 3300014497 Bacteria 2398
158 Ga0157379_10399488 3300014968 Bacteria 1263
159 Ga0157376_10037289 3300014969 Bacteria 3944
160 Ga0157376_10055797 3300014969 Bacteria 3298
161 Ga0163161_10290597 3300017792 Bacteria 1285
162 Ga0206353_11861950 3300020082 Bacteria 1084
163 Ga0213873_10025849 3300021358 Bacteria 1421
164 Ga0213872_10065857 3300021361 Bacteria 1636
165 Ga0213872_10105110 3300021361 Bacteria 1257
166 Ga0213874_10004851 3300021377 Bacteria 3104
167 Ga0213874_10006413 3300021377 Bacteria 2783
168 Ga0213876_10004677 3300021384 Bacteria 7626
169 Ga0213876_10063044 3300021384 Bacteria 1957
170 Ga0213876_10149390 3300021384 Bacteria 1242
171 Ga0213875_10000298 3300021388 Bacteria 47640
172 Ga0213875_10045153 3300021388 Bacteria 2068
173 Ga0213875_10059670 3300021388 Bacteria 1785
174 Ga0213871_10015139 3300021441 Bacteria 1840
175 Ga0224712_10040560 3300022467 Bacteria 1752
176 Ga0209758_1040275 3300025297 Bacteria 1765
177 Ga0207653_10030504 3300025885 Bacteria 1740
178 Ga0207692_10009072 3300025898 Bacteria 4142
179 Ga0207692_10034484 3300025898 Bacteria 2451
180 Ga0207688_10066974 3300025901 Bacteria 2032
181 Ga0207699_10012364 3300025906 Bacteria 4342
182 Ga0207699_10020272 3300025906 Bacteria 3560
183 Ga0207645_10137934 3300025907 Bacteria 1589
184 Ga0207643_10043471 3300025908 Bacteria 2535
185 Ga0207705_10005412 3300025909 Bacteria 9550
186 Ga0207684_10169976 3300025910 Bacteria 1879
187 Ga0207684_10232752 3300025910 Bacteria 1590
188 Ga0207654_10112132 3300025911 Bacteria 1699
189 Ga0207707_10000134 3300025912 Bacteria 77031
190 Ga0207707_10084609 3300025912 Bacteria 2770
191 Ga0207707_10109887 3300025912 Bacteria 2409
192 Ga0207707_10191174 3300025912 Bacteria 1786
193 Ga0207695_10028341 3300025913 Bacteria 6215
194 Ga0207693_10040226 3300025915 Bacteria 3682
195 Ga0207693_10131948 3300025915 Unclassified 1964
196 Ga0207663_10105021 3300025916 Bacteria 1905
197 Ga0207657_10222505 3300025919 Bacteria 1512
198 Ga0207649_10012191 3300025920 Bacteria 4761
199 Ga0207649_10372619 3300025920 Bacteria 1062
200 Ga0207652_10004682 3300025921 Bacteria 11096
201 Ga0207646_10032825 3300025922 Bacteria 4696
202 Ga0207694_10092546 3300025924 Bacteria 2387
203 Ga0207659_10266407 3300025926 Bacteria 1396
204 Ga0207700_10011874 3300025928 Bacteria 5582
205 Ga0207700_10048210 3300025928 Bacteria 3162
206 Ga0207700_10098999 3300025928 Bacteria 2321
207 Ga0207700_10130369 3300025928 Bacteria 2052
208 Ga0207700_10162537 3300025928 Bacteria 1856
209 Ga0207700_10199793 3300025928 Bacteria 1684
210 Ga0207700_10217293 3300025928 Bacteria 1619
211 Ga0207700_10319918 3300025928 Bacteria 1344
212 Ga0207700_10361845 3300025928 Bacteria 1265
213 Ga0207706_10234412 3300025933 Bacteria 1605
214 Ga0207706_10291632 3300025933 Bacteria 1422
215 Ga0207670_10077216 3300025936 Bacteria 2319
216 Ga0207669_10003139 3300025937 Bacteria 7124
217 Ga0207669_10124815 3300025937 Bacteria 1756
218 Ga0207669_10402734 3300025937 Bacteria 1072
219 Ga0207704_10154699 3300025938 Bacteria 1623
220 Ga0207665_10127485 3300025939 Bacteria 1803
221 Ga0207691_10174270 3300025940 Bacteria 1882
222 Ga0207691_10198238 3300025940 Bacteria 1748
223 Ga0207711_10071703 3300025941 Bacteria 3007
224 Ga0207661_10001838 3300025944 Bacteria 14507
225 Ga0207661_10229461 3300025944 Bacteria 1643
226 Ga0207661_10382788 3300025944 Bacteria 1273
227 Ga0207679_10006933 3300025945 Bacteria 7182
228 Ga0207679_10030759 3300025945 Bacteria 3752
229 Ga0207667_10015015 3300025949 Bacteria 8810
230 Ga0207667_10020340 3300025949 Bacteria 7387
231 Ga0207667_10194931 3300025949 Bacteria 2078
232 Ga0207667_10442328 3300025949 Bacteria 1322
233 Ga0207712_10362108 3300025961 Bacteria 1208
234 Ga0207668_10008021 3300025972 Bacteria 6285
235 Ga0207668_10042255 3300025972 Bacteria 3086
236 Ga0207668_10157939 3300025972 Bacteria 1763
237 Ga0207640_10244400 3300025981 Bacteria 1389
238 Ga0207703_10468685 3300026035 Bacteria 1179
239 Ga0207639_10171882 3300026041 Bacteria 1836
240 Ga0207639_10344921 3300026041 Bacteria 1328
241 Ga0207678_10173339 3300026067 Bacteria 1842
242 Ga0207678_10195920 3300026067 Bacteria 1727
243 Ga0207702_10110228 3300026078 Bacteria 2446
244 Ga0207702_10160847 3300026078 Bacteria 2050
245 Ga0207674_10041836 3300026116 Bacteria 4736
246 Ga0207675_100137188 3300026118 Bacteria 2322
247 Ga0207698_10051205 3300026142 Bacteria 3155
248 Ga0207698_10234627 3300026142 Bacteria 1668
249 Ga0207428_10003442 3300027907 Bacteria 15369
250 Ga0268266_10016185 3300028379 Bacteria 6377
251 Ga0268266_10020428 3300028379 Bacteria 5644
252 Ga0268266_10095640 3300028379 Bacteria 2609
253 Ga0268266_10104721 3300028379 Bacteria 2498
254 Ga0268266_10220776 3300028379 Bacteria 1742
255 Ga0268266_10352657 3300028379 Unclassified 1383
256 Ga0268266_10563564 3300028379 Bacteria 1092
257 Ga0268265_10300680 3300028380 Bacteria 1445
258 Ga0268265_10305364 3300028380 Bacteria 1435
259 Ga0268264_10372422 3300028381 Bacteria 1365
260 Ga0268264_10470047 3300028381 Bacteria 1221
261 Ga0265334_10003259 3300028573 Bacteria 7409
262 Ga0265338_10221873 3300028800 Bacteria 1411
263 Ga0265338_10348025 3300028800 Bacteria 1066
264 Ga0307512_10078286 3300030522 Bacteria 2397
265 Ga0307513_10118615 3300031456 Bacteria 2620
266 Ga0307416_100485154 3300032002 Bacteria 1297
267 Ga0307415_100068897 3300032126 Bacteria 2478
268 Ga0307510_10002894 3300033180 Bacteria 19752
269 Ga0373930_0005265 3300034816 Bacteria 2144
270 Ga0373926_0036674 3300035083 Bacteria 1743
271 Ga0373934_0045790 3300035086 Bacteria 1730
272 Ga0373923_0079620 3300035111 Bacteria 1419
273 Ga0373932_0072275 3300035112 Bacteria 1072
274 Ga0373936_0021891 3300035113 Bacteria 2488
275 Ga0373936_0044080 3300035113 Bacteria 1794
276 Ga0373941_0069001 3300035115 Bacteria 1169
277 Ga0373953_0029191 3300035117 Bacteria 2132
278 Ga0373953_0048959 3300035117 Bacteria 1704
279 Ga0373954_0028269 3300035118 Bacteria 2577
280 Ga0373954_0064032 3300035118 Unclassified 1738
281 Ga0373954_0103781 3300035118 Bacteria 1372
282 Ga0373956_0016665 3300035119 Bacteria 3088
283 Ga0373956_0034079 3300035119 Bacteria 2242
284 Ga0373943_0012475 3300035170 Bacteria 3828
285 Ga0373946_0081550 3300035171 Bacteria 1417
286 Ga0373955_0026612 3300035172 Bacteria 2982
287 Ga0373931_0000538 3300035691 Bacteria 15536
288 Ga0373931_0113155 3300035691 Bacteria 1542
289 Ga0373935_0016808 3300035692 Bacteria 4428
290 Ga0373935_0046966 3300035692 Bacteria 2728
291 Ga0373935_0070810 3300035692 Bacteria 2248
292 Ga0373935_0079720 3300035692 Bacteria 2126
293 Ga0373927_0022423 3300035695 Bacteria 4136
294 Ga0373927_0043164 3300035695 Bacteria 2920
295 Ga0373927_0067416 3300035695 Bacteria 2315
296 Ga0373927_0165338 3300035695 Bacteria 1450
297 Ga0373933_0046278 3300035724 Bacteria 2583
298 Ga0373933_0125103 3300035724 Bacteria 1613
299 Ga0373933_0199586 3300035724 Bacteria 1280
300 Ga0373947_0161248 3300035725 Bacteria 1450
301 Ga0373947_0166172 3300035725 Bacteria 1429
302 Ga0373937_0000675 3300036401 Bacteria 29693
303 Ga0373937_0027798 3300036401 Bacteria 5117
304 Ga0373937_0030918 3300036401 Bacteria 4849
305 Ga0373937_0108585 3300036401 Bacteria 2580
306 Ga0373937_0251631 3300036401 Bacteria 1666
307 Ga0373937_0259699 3300036401 Bacteria 1638
308 Ga0373937_0269488 3300036401 Bacteria 1607
309 Ga0373937_0453772 3300036401 Bacteria 1217
310 Ga0373925_0029674 3300037068 Bacteria 4012
311 Ga0373925_0224033 3300037068 Bacteria 1502
312 Ga0373925_0228112 3300037068 Bacteria 1488
313 Ga0373925_0398186 3300037068 Bacteria 1123
314 Ga0395899_0018898 3300037312 Bacteria 5237
315 Ga0395899_0030007 3300037312 Bacteria 4092
316 Ga0395899_0048943 3300037312 Bacteria 3143
317 Ga0395900_0004655 3300037418 Bacteria 14474
318 Ga0395900_0016192 3300037418 Bacteria 7596
319 Ga0395900_0190154 3300037418 Bacteria 2083
320 Ga0395898_0015919 3300037466 Bacteria 7706
321 Ga0395898_0050603 3300037466 Bacteria 4065
322 Ga0395898_0243736 3300037466 Bacteria 1714
323 Ga0436364_0211627 3300037853 Bacteria 2120
324 Ga0436364_0266271 3300037853 Bacteria 210347
325 Ga0436364_0760207 3300037853 Bacteria 1407
326 Ga0436364_0971108 3300037853 Unclassified 3737
327 Ga0436364_1504371 3300037853 Bacteria 3346
328 Ga0395901_0010856 3300038443 Bacteria 9231
329 Ga0395901_0011453 3300038443 Bacteria 8987
330 Ga0395901_0025222 3300038443 Bacteria 6103
331 Ga0395901_0223094 3300038443 Bacteria 1969
332 Ga0395901_0250054 3300038443 Bacteria 1847
333 Ga0436365_0192065 3300039437 Bacteria 1929
334 Ga0436365_0609072 3300039437 Bacteria 1929
335 Ga0436365_1182930 3300039437 Bacteria 2581
336 Ga0436365_1463747 3300039437 Bacteria 11274
337 Ga0436360_0180080 3300039438 Bacteria 4733
338 Ga0436360_0576573 3300039438 Bacteria 1777
339 Ga0436361_0603711 3300039447 Bacteria 1641
340 Ga0436361_0939140 3300039447 Bacteria 1795
341 Ga0436363_0080798 3300039450 Bacteria 11740
342 Ga0436363_0390744 3300039450 Bacteria 903
343 Ga0436363_1264272 3300039450 Bacteria 1350
344 Ga0436362_0994655 3300039453 Bacteria 3038
345 Ga0439465_0017183 3300041413 Bacteria 2258
346 Ga0439465_0019593 3300041413 Bacteria 2115
347 Ga0439465_0050726 3300041413 Bacteria 1358
348 Ga0466969_0125267 3300044656 Bacteria 1194
349 Ga0466963_0123529 3300044694 Bacteria 1783
350 Ga0466964_0048043 3300044706 Bacteria 1744
351 Ga0466957_0013983 3300044842 Bacteria 4668
352 Ga0466959_0036191 3300045049 Bacteria 3647
353 Ga0451576_0048698 3300045051 Bacteria 4450
354 Ga0466958_0252269 3300045836 Bacteria 1129
355 Ga0466967_0075819 3300045976 Bacteria 3023
356 Ga0466967_0083003 3300045976 Bacteria 2897
357 Ga0495592_0037919 3300046454 Bacteria 3627
358 Ga0495592_0058634 3300046454 Bacteria 2839
359 Ga0495603_0008302 3300046455 Bacteria 6277
360 Ga0495603_0012272 3300046455 Bacteria 5187
361 Ga0495629_0000708 3300046459 Bacteria 27003
362 Ga0495629_0163488 3300046459 Bacteria 1546
363 Ga0495638_0015103 3300046460 Bacteria 5194
364 Ga0495641_0019023 3300046461 Bacteria 3527
365 Ga0495651_0032976 3300046462 Bacteria 4040
366 Ga0495651_0099783 3300046462 Bacteria 2165
367 Ga0495651_0306212 3300046462 Bacteria 1064
368 Ga0495653_0073355 3300046463 Bacteria 2554
369 Ga0495580_0010335 3300046472 Bacteria 7275
370 Ga0495580_0049988 3300046472 Bacteria 2957
371 Ga0495582_0003136 3300046473 Bacteria 9274
372 Ga0495605_0066797 3300046474 Bacteria 1707
373 Ga0495639_0002986 3300046475 Bacteria 7366
374 Ga0495662_0043466 3300046476 Bacteria 2169
375 Ga0495664_0002389 3300046477 Bacteria 10069
376 Ga0495664_0135353 3300046477 Bacteria 1493
377 Ga0495584_0049501 3300046491 Bacteria 2117
378 Ga0495585_0026892 3300046492 Bacteria 3285
379 Ga0495594_0004174 3300046499 Bacteria 7418
380 Ga0495594_0051149 3300046499 Bacteria 2273
381 Ga0495594_0182080 3300046499 Bacteria 1196
382 Ga0495596_0058695 3300046500 Bacteria 1500
383 Ga0495606_0003152 3300046507 Bacteria 17859
384 Ga0495608_0019886 3300046511 Bacteria 4617
385 Ga0495608_0082658 3300046511 Bacteria 2085
386 Ga0495618_0043069 3300046514 Bacteria 2848
387 Ga0495620_0070460 3300046515 Bacteria 1432
388 Ga0495628_0032354 3300046516 Bacteria 4222
389 Ga0495628_0036029 3300046516 Bacteria 3974
390 Ga0495628_0200165 3300046516 Bacteria 1505
391 Ga0495628_0345010 3300046516 Bacteria 1095
392 Ga0495630_0002613 3300046517 Bacteria 12475
393 Ga0495630_0358338 3300046517 Bacteria 1116
394 Ga0495644_0022512 3300046523 Bacteria 2402
395 Ga0495642_0078166 3300046528 Bacteria 1390
396 Ga0495652_0087802 3300046529 Bacteria 2550
397 Ga0495665_0002120 3300046531 Bacteria 10739
398 Ga0495640_0018279 3300046533 Bacteria 5204
399 Ga0495640_0030018 3300046533 Bacteria 3897
400 Ga0495640_0039282 3300046533 Bacteria 3322
401 Ga0495640_0052180 3300046533 Bacteria 2809
402 Ga0495640_0059007 3300046533 Bacteria 2615
403 Ga0495640_0110135 3300046533 Bacteria 1800
404 Ga0495640_0130227 3300046533 Bacteria 1629
405 Ga0495586_0081920 3300046535 Bacteria 1774
406 Ga0495586_0082692 3300046535 Bacteria 1766
407 Ga0495587_0024611 3300046536 Bacteria 3688
408 Ga0495598_0016681 3300046537 Bacteria 1879
409 Ga0495621_0013737 3300046539 Bacteria 2549
410 Ga0495645_0003240 3300046543 Bacteria 11042
411 Ga0495645_0022504 3300046543 Bacteria 4560
412 Ga0495645_0120318 3300046543 Bacteria 1849
413 Ga0495622_0046990 3300046557 Bacteria 2006
414 Ga0495667_0002746 3300046559 Bacteria 11760
415 Ga0495667_0011244 3300046559 Bacteria 6059
416 Ga0495667_0091151 3300046559 Bacteria 1974
417 Ga0495667_0095363 3300046559 Bacteria 1926
418 Ga0495667_0109578 3300046559 Bacteria 1784
419 Ga0495656_0057210 3300046615 Bacteria 1688
420 Ga0495668_0089088 3300046616 Bacteria 1691
421 Ga0495668_0147252 3300046616 Bacteria 1289
422 Ga0495634_0040370 3300046642 Bacteria 3174
423 Ga0495634_0045837 3300046642 Bacteria 2953
424 Ga0495634_0089797 3300046642 Bacteria 1997
425 Ga0495625_0184460 3300046660 Bacteria 1385
426 Ga0495625_0221467 3300046660 Bacteria 1240
427 Ga0495635_0004326 3300046663 Bacteria 9836
428 Ga0495635_0069634 3300046663 Bacteria 2412
429 Ga0495588_0001004 3300046674 Bacteria 12297
430 Ga0495657_0018310 3300046675 Bacteria 5073
431 Ga0495599_0027881 3300046678 Bacteria 3538
432 Ga0495599_0039682 3300046678 Bacteria 2958
433 Ga0495599_0040393 3300046678 Bacteria 2930
434 Ga0495599_0087878 3300046678 Bacteria 1940
435 Ga0495623_0117514 3300046679 Bacteria 1605
436 Ga0495646_0011105 3300046680 Bacteria 5717
437 Ga0495658_0001960 3300046683 Bacteria 10528
438 Ga0495658_0059792 3300046683 Bacteria 2183
439 Ga0495658_0119912 3300046683 Bacteria 1590
440 Ga0495669_0028155 3300046684 Bacteria 2459
441 Ga0495669_0045307 3300046684 Bacteria 1960
442 Ga0495613_0014107 3300046689 Bacteria 5927
443 Ga0495613_0230740 3300046689 Unclassified 1297
444 Ga0495624_0003274 3300046690 Bacteria 12069
445 Ga0495670_0012714 3300046691 Bacteria 4140
446 Ga0495600_0035587 3300046809 Bacteria 3235
447 Ga0495600_0136525 3300046809 Bacteria 1593
448 Ga0495600_0153314 3300046809 Bacteria 1491
449 Ga0495581_0001031 3300047315 Bacteria 15076
450 Ga0495604_0111760 3300047317 Bacteria 1991
451 Ga0495636_0012788 3300047318 Bacteria 3325
452 Ga0495674_0131945 3300047319 Bacteria 2104
453 Ga0495674_0347585 3300047319 Bacteria 1204
454 Ga0495672_0062874 3300047320 Bacteria 2133
455 Ga0495676_0012956 3300047321 Bacteria 7502
456 Ga0495676_0074526 3300047321 Bacteria 2598
457 Ga0495676_0184574 3300047321 Bacteria 1459
458 Ga0495680_0036268 3300047322 Bacteria 3961
459 Ga0495680_0119381 3300047322 Bacteria 1948
460 Ga0495680_0146698 3300047322 Bacteria 1723
461 Ga0495680_0167312 3300047322 Bacteria 1593
462 Ga0495680_0289562 3300047322 Bacteria 1152
463 Ga0495675_0031183 3300047444 Bacteria 3403
464 Ga0495675_0109807 3300047444 Bacteria 1722
465 Ga0495677_0108635 3300047445 Bacteria 1053
466 Ga0495679_030490 3300047446 Bacteria 1750
467 Ga0495685_044374 3300047447 Bacteria 1516
468 Ga0495681_0106599 3300047470 Unclassified 1218
469 Ga0495684_0013456 3300047471 Bacteria 6297
470 Ga0495684_0035266 3300047471 Bacteria 3836
471 Ga0495593_0001063 3300047673 Bacteria 16031
472 Ga0495602_0000124 3300048088 Bacteria 72960
473 Ga0495602_0242284 3300048088 Unclassified 1348
474 Ga0495602_0321448 3300048088 Bacteria 1126
475 Ga0496100_0158325 3300048903 Bacteria 1621
476 Ga0496100_0386675 3300048903 Bacteria 1063
477 Ga0496101_0073023 3300048904 Bacteria 2519
478 Ga0496101_0128496 3300048904 Bacteria 1922
479 Ga0496101_0396903 3300048904 Bacteria 1086
480 Ga0496102_0025542 3300048905 Bacteria 5259
481 Ga0496102_0042330 3300048905 Bacteria 4127
482 Ga0496102_0064527 3300048905 Bacteria 3354
483 Ga0496103_0323813 3300048906 Bacteria 991
484 Ga0496104_0050571 3300048907 Bacteria 3921
485 Ga0496105_0012533 3300048908 Bacteria 6714
486 Ga0496106_0020066 3300048909 Bacteria 4957
487 Ga0496107_0006787 3300048910 Bacteria 7882
488 Ga0496107_0167285 3300048910 Bacteria 1630
489 Ga0496107_0210940 3300048910 Bacteria 1444
490 Ga0496108_0009792 3300048911 Bacteria 7764
491 Ga0496108_0081610 3300048911 Bacteria 2740
492 Ga0496108_0379830 3300048911 Bacteria 1234
493 Ga0496109_0093246 3300048912 Bacteria 2786
494 Ga0496110_0152822 3300048913 Bacteria 2090
495 Ga0496111_0275326 3300048914 Bacteria 1249
496 Ga0496112_0001395 3300048915 Bacteria 18455
497 Ga0496112_0071298 3300048915 Bacteria 3434
498 Ga0496112_0129764 3300048915 Bacteria 2492
499 Ga0496112_0280432 3300048915 Bacteria 1614
500 Ga0496113_0020027 3300048916 Bacteria 4694
501 Ga0496113_0468252 3300048916 Bacteria 1012
502 Ga0496114_0230286 3300048917 Bacteria 1628
503 Ga0496114_0349755 3300048917 Unclassified 1307
504 Ga0496115_0291603 3300048918 Bacteria 1338
505 Ga0496118_0120239 3300048921 Bacteria 1715
506 Ga0496119_0009531 3300048922 Bacteria 8317
507 Ga0496120_0140713 3300048923 Unclassified 1225
508 Ga0496121_0214780 3300048924 Bacteria 1360
509 Ga0496124_0066630 3300048927 Bacteria 2998
510 Ga0496126_0126852 3300048929 Bacteria 2208
511 Ga0496126_0135302 3300048929 Bacteria 2126
512 Ga0501034_0010277 3300049571 Bacteria 9759
513 Ga0501034_0019698 3300049571 Bacteria 6897
514 Ga0501034_0049475 3300049571 Bacteria 4241
515 Ga0501046_0167528 3300049580 Bacteria 1650
516 Ga0501068_0008961 3300049584 Bacteria 5583
517 Ga0501073_0029105 3300049589 Bacteria 3947
518 Ga0501080_0033148 3300049742 Bacteria 4821
519 Ga0501080_0164164 3300049742 Bacteria 2050
520 Ga0501044_0110164 3300049823 Bacteria 2762
521 nmdc:mga03683_39378_c1 3300050489 Bacteria 1935
522 nmdc:mga03683_9135_c1 3300050489 Bacteria 3512
523 nmdc:mga03n38_38478_c1 3300050490 Bacteria 2069
524 nmdc:mga00v17_19719_c1 3300050491 Bacteria 3855
525 nmdc:mga0yw44_189570_c1 3300050492 Bacteria 1356
526 nmdc:mga0yw44_26878_c1 3300050492 Bacteria 3291
527 nmdc:mga0yw44_31637_c1 3300050492 Bacteria 3078
528 nmdc:mga0yw44_76467_c1 3300050492 Bacteria 2090
529 nmdc:mga0k408_17255_c1 3300050493 Bacteria 4019
530 nmdc:mga0k408_19752_c1 3300050493 Bacteria 3768
531 nmdc:mga06z11_115317_c1 3300050494 Bacteria 1492
532 nmdc:mga06z11_195643_c1 3300050494 Bacteria 1172
533 nmdc:mga06z11_2643_c1 3300050494 Bacteria 6869
534 nmdc:mga06z11_341101_c1 3300050494 Bacteria 896
535 nmdc:mga06z11_6505_c1 3300050494 Bacteria 4760
536 nmdc:mga04h51_5233_c1 3300050495 Bacteria 3294
537 nmdc:mga04h51_59763_c1 3300050495 Bacteria 1303
538 nmdc:mga05p37_8_c1 3300050507 Bacteria 153982
539 nmdc:mga09592_2051_c1 3300050508 Bacteria 16247
540 nmdc:mga0qj67_34642_c1 3300050509 Bacteria 3945
541 nmdc:mga06r32_425_c1 3300050510 Bacteria 35529
542 nmdc:mga08y16_154667_c1 3300050511 Bacteria 2383
543 nmdc:mga08y16_84_c1 3300050511 Bacteria 79627
544 nmdc:mga0n895_115217_c1 3300050512 Bacteria 2706
545 nmdc:mga0n895_203688_c1 3300050512 Bacteria 2009
546 nmdc:mga0rr50_86519_c1 3300050513 Bacteria 2431
547 nmdc:mga08x19_130665_c1 3300050514 Bacteria 1689
548 nmdc:mga08x19_197451_c1 3300050514 Bacteria 1378
549 nmdc:mga0sz30_792_c1 3300050516 Bacteria 11461
550 Ga0495601_0001494 3300053077 Bacteria 12891
551 Ga0495601_0017450 3300053077 Bacteria 4357
552 Ga0495612_0000646 3300053078 Bacteria 13999
553 Ga0495612_0007457 3300053078 Bacteria 4470
554 Ga0495595_0020566 3300053084 Bacteria 2873
555 Ga0495595_0044843 3300053084 Bacteria 2032
556 Ga0495619_0007724 3300053085 Bacteria 6807
557 Ga0495619_0010379 3300053085 Bacteria 5863
558 Ga0495619_0051227 3300053085 Bacteria 2728
559 Ga0500647_0016302 3300053091 Bacteria 3413
560 Ga0500641_0009123 3300053096 Bacteria 3557
561 Ga0500641_0009926 3300053096 Bacteria 3431
562 Ga0500590_023450 3300053148 Bacteria 3203
563 Ga0500616_0008272 3300053153 Bacteria 6481
564 Ga0500639_041228 3300053163 Bacteria 2428
565 Ga0500637_0008103 3300053178 Bacteria 5283
566 Ga0500552_001484 3300053733 Bacteria 2240
567 2513888109 2513237141 Bacteria 8496279
568 Ga0373933_0008375
569 rootH2_10030919
570 rootH1_10159843
571 JGI25404J52841_10000129
572 Ga0065715_10238085
573 Ga0070683_100101208
574 Ga0070683_100282497
575 Ga0068869_100154434
576 Ga0070680_100001756
577 Ga0070680_100084694
578 Ga0070682_100122280
579 Ga0068868_100038030
580 Ga0070660_100200734
581 Ga0070691_10000821
582 Ga0070661_100088309
583 Ga0070668_100008736
584 Ga0070668_100038380
585 Ga0070668_100115029
586 Ga0070669_100182330
587 Ga0070675_100114187
588 Ga0070674_100001074
589 Ga0070674_100027452
590 Ga0070688_100040050
591 Ga0070688_100114586
592 Ga0070667_100310438
593 Ga0070709_10090195
594 Ga0070714_100061545
595 Ga0070713_100030707
596 Ga0070713_100050835
597 Ga0070713_100069160
598 Ga0070713_100080622
599 Ga0070713_100350225
600 Ga0070713_100667940
601 Ga0070710_10069846
602 Ga0070694_100142942
603 Ga0070708_100103724
604 Ga0070708_100138311
605 Ga0070663_100072070
606 Ga0070663_100227377
607 Ga0070678_100509840
608 Ga0070681_10002051
609 Ga0070681_10168673
610 Ga0068867_100021184
611 Ga0068867_100519229
612 Ga0070685_10134858
613 Ga0070706_100049105
614 Ga0070706_100426131
615 Ga0070707_100422244
616 Ga0070698_100007463
617 Ga0070698_100266281
618 Ga0070679_100015969
619 Ga0070679_100595850
620 Ga0070684_100005664
621 Ga0070697_100328070
622 Ga0068853_100347726
623 Ga0070686_100041796
624 Ga0070693_100094073
625 Ga0070665_100029936
626 Ga0070665_100122465
627 Ga0070704_100487413
628 Ga0068855_100004887
629 Ga0068855_100216746
630 Ga0068857_100039165
631 Ga0068854_100164325
632 Ga0068856_100197555
633 Ga0068852_100027732
634 Ga0068852_100069422
635 Ga0068852_100257676
636 Ga0068859_100582984
637 Ga0068861_100093926
638 Ga0068861_100210513
639 Ga0068858_100092489
640 Ga0068858_100204158
641 Ga0068860_100229594
642 Ga0068862_100171602
643 Ga0068862_100273222
644 Ga0068862_100287570
645 Ga0081455_10000911
646 Ga0081455_10033729
647 Ga0081455_10034652
648 Ga0081455_10102075
649 Ga0081455_10129048
650 Ga0081540_1000370
651 Ga0081540_1005450
652 Ga0081540_1010161
653 Ga0081540_1012027
654 Ga0081540_1037353
655 Ga0081539_10002318
656 Ga0081539_10004117
657 Ga0070717_10054641
658 Ga0075365_10024536
659 Ga0075365_10075629
660 Ga0075368_10021290
661 Ga0075368_10021322
662 Ga0075368_10070053
663 Ga0075363_100002481
664 Ga0075364_10060420
665 Ga0070716_100303463
666 Ga0070712_100007702
667 Ga0070712_100105303
668 Ga0070712_100161606
669 Ga0070712_100194147
670 Ga0075362_10012025
671 Ga0075362_10075544
672 Ga0075367_10002181
673 Ga0075367_10029320
674 Ga0075367_10151611
675 Ga0075369_10008108
676 Ga0075366_10031709
677 Ga0075366_10130988
678 Ga0075428_100007216
679 Ga0075428_100680046
680 Ga0075430_100041228
681 Ga0075431_100000022
682 Ga0075434_100037820
683 Ga0075434_100129905
684 Ga0075429_100001093
685 Ga0068865_100262575
686 Ga0068865_100292031
687 Ga0075436_100099513
688 Ga0075436_100235604
689 Ga0097620_100582910
690 Ga0075435_100332267
691 Ga0105250_10049961
692 Ga0105240_10006552
693 Ga0105240_10173530
694 Ga0111539_10000091
695 Ga0111539_10247827
696 Ga0105245_10557794
697 Ga0114129_10000009
698 Ga0105243_10092363
699 Ga0105242_10190803
700 Ga0105248_10158381
701 Ga0105248_10168342
702 Ga0105237_10142109
703 Ga0105237_10283989
704 Ga0105238_10056841
705 Ga0105238_10085826
706 Ga0105238_10113434
707 Ga0105249_10024316
708 Ga0105249_10194705
709 Ga0099796_10011081
710 Ga0105239_10364248
711 Ga0157373_10104430
712 Ga0157370_10014309
713 Ga0157370_10060466
714 Ga0157369_10016093
715 Ga0157369_10270841
716 Ga0157369_10389142
717 Ga0157374_10182685
718 Ga0157374_10482583
719 Ga0163162_10329850
720 Ga0163162_10627192
721 Ga0157375_10371107
722 Ga0163163_10309021
723 Ga0163163_10467311
724 Ga0182008_10038268
725 Ga0157379_10399488
726 Ga0157376_10037289
727 Ga0157376_10055797
728 Ga0163161_10290597
729 Ga0206353_11861950
730 Ga0213873_10025849
731 Ga0213872_10065857
732 Ga0213872_10105110
733 Ga0213874_10004851
734 Ga0213874_10006413
735 Ga0213876_10004677
736 Ga0213876_10063044
737 Ga0213876_10149390
738 Ga0213875_10000298
739 Ga0213875_10045153
740 Ga0213875_10059670
741 Ga0213871_10015139
742 Ga0224712_10040560
743 Ga0209758_1040275
744 Ga0207653_10030504
745 Ga0207692_10009072
746 Ga0207692_10034484
747 Ga0207688_10066974
748 Ga0207699_10012364
749 Ga0207699_10020272
750 Ga0207645_10137934
751 Ga0207643_10043471
752 Ga0207705_10005412
753 Ga0207684_10169976
754 Ga0207684_10232752
755 Ga0207654_10112132
756 Ga0207707_10000134
757 Ga0207707_10084609
758 Ga0207707_10109887
759 Ga0207707_10191174
760 Ga0207695_10028341
761 Ga0207693_10040226
762 Ga0207693_10131948
763 Ga0207663_10105021
764 Ga0207657_10222505
765 Ga0207649_10012191
766 Ga0207649_10372619
767 Ga0207652_10004682
768 Ga0207646_10032825
769 Ga0207694_10092546
770 Ga0207659_10266407
771 Ga0207700_10011874
772 Ga0207700_10048210
773 Ga0207700_10098999
774 Ga0207700_10130369
775 Ga0207700_10162537
776 Ga0207700_10199793
777 Ga0207700_10217293
778 Ga0207700_10319918
779 Ga0207700_10361845
780 Ga0207706_10234412
781 Ga0207706_10291632
782 Ga0207670_10077216
783 Ga0207669_10003139
784 Ga0207669_10124815
785 Ga0207669_10402734
786 Ga0207704_10154699
787 Ga0207665_10127485
788 Ga0207691_10174270
789 Ga0207691_10198238
790 Ga0207711_10071703
791 Ga0207661_10001838
792 Ga0207661_10229461
793 Ga0207661_10382788
794 Ga0207679_10006933
795 Ga0207679_10030759
796 Ga0207667_10015015
797 Ga0207667_10020340
798 Ga0207667_10194931
799 Ga0207667_10442328
800 Ga0207712_10362108
801 Ga0207668_10008021
802 Ga0207668_10042255
803 Ga0207668_10157939
804 Ga0207640_10244400
805 Ga0207703_10468685
806 Ga0207639_10171882
807 Ga0207639_10344921
808 Ga0207678_10173339
809 Ga0207678_10195920
810 Ga0207702_10110228
811 Ga0207702_10160847
812 Ga0207674_10041836
813 Ga0207675_100137188
814 Ga0207698_10051205
815 Ga0207698_10234627
816 Ga0207428_10003442
817 Ga0268266_10016185
818 Ga0268266_10020428
819 Ga0268266_10095640
820 Ga0268266_10104721
821 Ga0268266_10220776
822 Ga0268266_10352657
823 Ga0268266_10563564
824 Ga0268265_10300680
825 Ga0268265_10305364
826 Ga0268264_10372422
827 Ga0268264_10470047
828 Ga0265334_10003259
829 Ga0265338_10221873
830 Ga0265338_10348025
831 Ga0307512_10078286
832 Ga0307513_10118615
833 Ga0307416_100485154
834 Ga0307415_100068897
835 Ga0307510_10002894
836 Ga0373930_0005265
837 Ga0373926_0036674
838 Ga0373934_0045790
839 Ga0373923_0079620
840 Ga0373932_0072275
841 Ga0373936_0021891
842 Ga0373936_0044080
843 Ga0373941_0069001
844 Ga0373953_0029191
845 Ga0373953_0048959
846 Ga0373954_0028269
847 Ga0373954_0064032
848 Ga0373954_0103781
849 Ga0373956_0016665
850 Ga0373956_0034079
851 Ga0373943_0012475
852 Ga0373946_0081550
853 Ga0373955_0026612
854 Ga0373931_0000538
855 Ga0373931_0113155
856 Ga0373935_0016808
857 Ga0373935_0046966
858 Ga0373935_0070810
859 Ga0373935_0079720
860 Ga0373927_0022423
861 Ga0373927_0043164
862 Ga0373927_0067416
863 Ga0373927_0165338
864 Ga0373933_0046278
865 Ga0373933_0125103
866 Ga0373933_0199586
867 Ga0373947_0161248
868 Ga0373947_0166172
869 Ga0373937_0000675
870 Ga0373937_0027798
871 Ga0373937_0030918
872 Ga0373937_0108585
873 Ga0373937_0251631
874 Ga0373937_0259699
875 Ga0373937_0269488
876 Ga0373937_0453772
877 Ga0373925_0029674
878 Ga0373925_0224033
879 Ga0373925_0228112
880 Ga0373925_0398186
881 Ga0395899_0018898
882 Ga0395899_0030007
883 Ga0395899_0048943
884 Ga0395900_0004655
885 Ga0395900_0016192
886 Ga0395900_0190154
887 Ga0395898_0015919
888 Ga0395898_0050603
889 Ga0395898_0243736
890 Ga0436364_0211627
891 Ga0436364_0266271
892 Ga0436364_0760207
893 Ga0436364_0971108
894 Ga0436364_1504371
895 Ga0395901_0010856
896 Ga0395901_0011453
897 Ga0395901_0025222
898 Ga0395901_0223094
899 Ga0395901_0250054
900 Ga0436365_0192065
901 Ga0436365_0609072
902 Ga0436365_1182930
903 Ga0436365_1463747
904 Ga0436360_0180080
905 Ga0436360_0576573
906 Ga0436361_0603711
907 Ga0436361_0939140
908 Ga0436363_0080798
909 Ga0436363_0390744
910 Ga0436363_1264272
911 Ga0436362_0994655
912 Ga0439465_0017183
913 Ga0439465_0019593
914 Ga0439465_0050726
915 Ga0466969_0125267
916 Ga0466963_0123529
917 Ga0466964_0048043
918 Ga0466957_0013983
919 Ga0466959_0036191
920 Ga0451576_0048698
921 Ga0466958_0252269
922 Ga0466967_0075819
923 Ga0466967_0083003
924 Ga0495592_0037919
925 Ga0495592_0058634
926 Ga0495603_0008302
927 Ga0495603_0012272
928 Ga0495629_0000708
929 Ga0495629_0163488
930 Ga0495638_0015103
931 Ga0495641_0019023
932 Ga0495651_0032976
933 Ga0495651_0099783
934 Ga0495651_0306212
935 Ga0495653_0073355
936 Ga0495580_0010335
937 Ga0495580_0049988
938 Ga0495582_0003136
939 Ga0495605_0066797
940 Ga0495639_0002986
941 Ga0495662_0043466
942 Ga0495664_0002389
943 Ga0495664_0135353
944 Ga0495584_0049501
945 Ga0495585_0026892
946 Ga0495594_0004174
947 Ga0495594_0051149
948 Ga0495594_0182080
949 Ga0495596_0058695
950 Ga0495606_0003152
951 Ga0495608_0019886
952 Ga0495608_0082658
953 Ga0495618_0043069
954 Ga0495620_0070460
955 Ga0495628_0032354
956 Ga0495628_0036029
957 Ga0495628_0200165
958 Ga0495628_0345010
959 Ga0495630_0002613
960 Ga0495630_0358338
961 Ga0495644_0022512
962 Ga0495642_0078166
963 Ga0495652_0087802
964 Ga0495665_0002120
965 Ga0495640_0018279
966 Ga0495640_0030018
967 Ga0495640_0039282
968 Ga0495640_0052180
969 Ga0495640_0059007
970 Ga0495640_0110135
971 Ga0495640_0130227
972 Ga0495586_0081920
973 Ga0495586_0082692
974 Ga0495587_0024611
975 Ga0495598_0016681
976 Ga0495621_0013737
977 Ga0495645_0003240
978 Ga0495645_0022504
979 Ga0495645_0120318
980 Ga0495622_0046990
981 Ga0495667_0002746
982 Ga0495667_0011244
983 Ga0495667_0091151
984 Ga0495667_0095363
985 Ga0495667_0109578
986 Ga0495656_0057210
987 Ga0495668_0089088
988 Ga0495668_0147252
989 Ga0495634_0040370
990 Ga0495634_0045837
991 Ga0495634_0089797
992 Ga0495625_0184460
993 Ga0495625_0221467
994 Ga0495635_0004326
995 Ga0495635_0069634
996 Ga0495588_0001004
997 Ga0495657_0018310
998 Ga0495599_0027881
999 Ga0495599_0039682
1000 Ga0495599_0040393
1001 Ga0495599_0087878
1002 Ga0495623_0117514
1003 Ga0495646_0011105
1004 Ga0495658_0001960
1005 Ga0495658_0059792
1006 Ga0495658_0119912
1007 Ga0495669_0028155
1008 Ga0495669_0045307
1009 Ga0495613_0014107
1010 Ga0495613_0230740
1011 Ga0495624_0003274
1012 Ga0495670_0012714
1013 Ga0495600_0035587
1014 Ga0495600_0136525
1015 Ga0495600_0153314
1016 Ga0495581_0001031
1017 Ga0495604_0111760
1018 Ga0495636_0012788
1019 Ga0495674_0131945
1020 Ga0495674_0347585
1021 Ga0495672_0062874
1022 Ga0495676_0012956
1023 Ga0495676_0074526
1024 Ga0495676_0184574
1025 Ga0495680_0036268
1026 Ga0495680_0119381
1027 Ga0495680_0146698
1028 Ga0495680_0167312
1029 Ga0495680_0289562
1030 Ga0495675_0031183
1031 Ga0495675_0109807
1032 Ga0495677_0108635
1033 Ga0495679_030490
1034 Ga0495685_044374
1035 Ga0495681_0106599
1036 Ga0495684_0013456
1037 Ga0495684_0035266
1038 Ga0495593_0001063
1039 Ga0495602_0000124
1040 Ga0495602_0242284
1041 Ga0495602_0321448
1042 Ga0496100_0158325
1043 Ga0496100_0386675
1044 Ga0496101_0073023
1045 Ga0496101_0128496
1046 Ga0496101_0396903
1047 Ga0496102_0025542
1048 Ga0496102_0042330
1049 Ga0496102_0064527
1050 Ga0496103_0323813
1051 Ga0496104_0050571
1052 Ga0496105_0012533
1053 Ga0496106_0020066
1054 Ga0496107_0006787
1055 Ga0496107_0167285
1056 Ga0496107_0210940
1057 Ga0496108_0009792
1058 Ga0496108_0081610
1059 Ga0496108_0379830
1060 Ga0496109_0093246
1061 Ga0496110_0152822
1062 Ga0496111_0275326
1063 Ga0496112_0001395
1064 Ga0496112_0071298
1065 Ga0496112_0129764
1066 Ga0496112_0280432
1067 Ga0496113_0020027
1068 Ga0496113_0468252
1069 Ga0496114_0230286
1070 Ga0496114_0349755
1071 Ga0496115_0291603
1072 Ga0496118_0120239
1073 Ga0496119_0009531
1074 Ga0496120_0140713
1075 Ga0496121_0214780
1076 Ga0496124_0066630
1077 Ga0496126_0126852
1078 Ga0496126_0135302
1079 Ga0501034_0010277
1080 Ga0501034_0019698
1081 Ga0501034_0049475
1082 Ga0501046_0167528
1083 Ga0501068_0008961
1084 Ga0501073_0029105
1085 Ga0501080_0033148
1086 Ga0501080_0164164
1087 Ga0501044_0110164
1088 nmdc:mga03683_39378_c1
1089 nmdc:mga03683_9135_c1
1090 nmdc:mga03n38_38478_c1
1091 nmdc:mga00v17_19719_c1
1092 nmdc:mga0yw44_189570_c1
1093 nmdc:mga0yw44_26878_c1
1094 nmdc:mga0yw44_31637_c1
1095 nmdc:mga0yw44_76467_c1
1096 nmdc:mga0k408_17255_c1
1097 nmdc:mga0k408_19752_c1
1098 nmdc:mga06z11_115317_c1
1099 nmdc:mga06z11_195643_c1
1100 nmdc:mga06z11_2643_c1
1101 nmdc:mga06z11_341101_c1
1102 nmdc:mga06z11_6505_c1
1103 nmdc:mga04h51_5233_c1
1104 nmdc:mga04h51_59763_c1
1105 nmdc:mga05p37_8_c1
1106 nmdc:mga09592_2051_c1
1107 nmdc:mga0qj67_34642_c1
1108 nmdc:mga06r32_425_c1
1109 nmdc:mga08y16_154667_c1
1110 nmdc:mga08y16_84_c1
1111 nmdc:mga0n895_115217_c1
1112 nmdc:mga0n895_203688_c1
1113 nmdc:mga0rr50_86519_c1
1114 nmdc:mga08x19_130665_c1
1115 nmdc:mga08x19_197451_c1
1116 nmdc:mga0sz30_792_c1
1117 Ga0495601_0001494
1118 Ga0495601_0017450
1119 Ga0495612_0000646
1120 Ga0495612_0007457
1121 Ga0495595_0020566
1122 Ga0495595_0044843
1123 Ga0495619_0007724
1124 Ga0495619_0010379
1125 Ga0495619_0051227
1126 Ga0500647_0016302
1127 Ga0500641_0009123
1128 Ga0500641_0009926
1129 Ga0500590_023450
1130 Ga0500616_0008272
1131 Ga0500639_041228
1132 Ga0500637_0008103
1133 Ga0500552_001484
1134 2513888109

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

56

347

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2b81-assembly2.cif.gz_C crystal structure of the luciferase-like monooxygenase from bacillus cereus 0.8301 1 316
3rao-assembly2.cif.gz_A-2 crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.7996 2 316
3rao-assembly2.cif.gz_A-2 crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.7924 2 316
3rao-assembly2.cif.gz_B crystal structure of the luciferase-like monooxygenase from bacillus cereus atcc 10987. 0.7778 2 316
5lxe-assembly1.cif.gz_B f420-dependent glucose-6-phosphate dehydrogenase from rhodococcus jostii rha1 0.774 1 316
ID Description Score Start End Superfamily
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8923 20 317 3.20.20.30
af_O06216_16_274_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8858 20 317 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8848 3 317 3.20.20.30
af_P9WKP1_2_288_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8789 3 317 3.20.20.30
af_P9WKN5_1_280_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8748 2 314 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A382KAG6-F1-model_v4 Luciferase-like domain-containing protein 0.9814 1 184 GO:0008726
GO:0046306
AF-A0A2V6VE12-F1-model_v4 Luciferase-like domain-containing protein 0.9767 1 191 GO:0008726
GO:0046306
AF-A0A382KAG6-F1-model_v4 Luciferase-like domain-containing protein 0.9762 1 184 GO:0008726
GO:0046306
AF-A0A2E7PF21-F1-model_v4 LLM class F420-dependent oxidoreductase 0.9645 1 161 GO:0016705
AF-A0A381YWX9-F1-model_v4 Luciferase-like domain-containing protein 0.9632 1 317 GO:0008726
GO:0046306

Map