F466437

General Info

Members Datasets Scaffolds Average Seq Length
585 293 1170 187

Family's Representative Sequence

Representative Sequence 3300005617|Ga0068859_100361948|Ga0068859_1003619483
Length 222
Sequence VTGRRRLWLVRSGKSRLVRNAQEVEMTVETPKDLQGRRVALLVANEGVEQVELTEPRTALDRAGATTELLAPRGGSVQAFNHLDKADTFDVDAPVSSVGVGDFDALVLPGGVANADQLRLDPDAVAFVGEFLRRGKPVGVICHGPWAMVEADAVRGRTMTSWPSVQTDLRNAGANWVDEEVVTCEHGPGVIVSSRKPDDLPAFCREIVHQFATSGDVAAARK

Samples

Sample ID Description Type Environment
1 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
27 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
91 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
150 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
151 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
152 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
153 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
154 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
155 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
181 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
182 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
183 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
184 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
185 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
186 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
187 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
188 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
193 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
205 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
206 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
216 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
221 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
222 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
223 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
251 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
252 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
253 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
254 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
255 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
256 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
257 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
258 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
259 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
260 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
261 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
262 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
263 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
264 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
267 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
268 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
269 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
276 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
277 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
278 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
279 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
280 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
281 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
282 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
283 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
284 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
287 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
288 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
289 2643221617 Nocardioides sp. Root79 Isolate Unclassified
290 2643221620 Nocardioides sp. Root240 Isolate Unclassified
291 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
292 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
293 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.28
Metatranscriptomes 7.86
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.91
Nodule 0
Rhizoplane 6.5
Rhizosphere 88.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068859_100361948 3300005617 Bacteria 1546
2 JGI24743J22301_10009778 3300001991 Bacteria 1705
3 Ga0006777J48905_1080901 3300003308 Bacteria 637
4 Ga0070658_10002264 3300005327 Bacteria 16160
5 Ga0070658_10040081 3300005327 Bacteria 3779
6 Ga0070658_10075929 3300005327 Bacteria 2757
7 Ga0070683_100168264 3300005329 Bacteria 2080
8 Ga0070683_100216970 3300005329 Bacteria 1818
9 Ga0070683_100356622 3300005329 Bacteria 1393
10 Ga0070683_100808224 3300005329 Bacteria 899
11 Ga0070670_100364217 3300005331 Bacteria 1272
12 Ga0068869_100015795 3300005334 Bacteria 5075
13 Ga0068869_100083830 3300005334 Bacteria 2385
14 Ga0068869_100203502 3300005334 Bacteria 1562
15 Ga0070680_100000880 3300005336 Bacteria 21288
16 Ga0070680_100040735 3300005336 Bacteria 3763
17 Ga0070680_100229950 3300005336 Bacteria 1566
18 Ga0070682_100095003 3300005337 Bacteria 1957
19 Ga0070682_100165691 3300005337 Bacteria 1531
20 Ga0070682_100343966 3300005337 Bacteria 1110
21 Ga0070682_100542363 3300005337 Bacteria 909
22 Ga0068868_100106952 3300005338 Bacteria 2270
23 Ga0070660_100007743 3300005339 Bacteria 7492
24 Ga0070660_100090226 3300005339 Bacteria 2416
25 Ga0070660_100136448 3300005339 Bacteria 1966
26 Ga0070692_10002171 3300005345 Bacteria 7513
27 Ga0070669_100645400 3300005353 Bacteria 890
28 Ga0070674_100363789 3300005356 Bacteria 1172
29 Ga0070688_100086489 3300005365 Bacteria 2040
30 Ga0070659_100000756 3300005366 Bacteria 23470
31 Ga0070659_100025397 3300005366 Bacteria 4549
32 Ga0070659_100049844 3300005366 Bacteria 3293
33 Ga0070659_100076060 3300005366 Bacteria 2677
34 Ga0070659_100575423 3300005366 Bacteria 966
35 Ga0070709_10065037 3300005434 Bacteria 2334
36 Ga0070714_100014638 3300005435 Bacteria 6304
37 Ga0070714_100571446 3300005435 Bacteria 1084
38 Ga0070714_100795217 3300005435 Bacteria 916
39 Ga0070713_100050053 3300005436 Bacteria 3449
40 Ga0070710_10021709 3300005437 Bacteria 3351
41 Ga0070701_10076595 3300005438 Bacteria 1801
42 Ga0070711_100100227 3300005439 Bacteria 2106
43 Ga0070700_100003774 3300005441 Bacteria 7842
44 Ga0070700_100446963 3300005441 Bacteria 983
45 Ga0070708_100565979 3300005445 Bacteria 1072
46 Ga0070708_100666275 3300005445 Bacteria 980
47 Ga0070681_10000004 3300005458 Bacteria 205157
48 Ga0070681_10049718 3300005458 Bacteria 4186
49 Ga0070681_10198139 3300005458 Bacteria 1927
50 Ga0070681_10336262 3300005458 Bacteria 1419
51 Ga0070681_10465926 3300005458 Bacteria 1176
52 Ga0070706_100018337 3300005467 Bacteria 6457
53 Ga0070707_100608015 3300005468 Bacteria 1056
54 Ga0070698_100011358 3300005471 Bacteria 9453
55 Ga0070679_100000012 3300005530 Bacteria 155885
56 Ga0070679_100002003 3300005530 Bacteria 18279
57 Ga0070679_100091216 3300005530 Bacteria 3035
58 Ga0070679_100119099 3300005530 Bacteria 2625
59 Ga0070684_100009334 3300005535 Bacteria 7721
60 Ga0070684_100162579 3300005535 Bacteria 2026
61 Ga0068853_100069588 3300005539 Bacteria 3062
62 Ga0070672_101261900 3300005543 Bacteria 659
63 Ga0070693_100699918 3300005547 Bacteria 742
64 Ga0070665_100000682 3300005548 Bacteria 45471
65 Ga0070665_101001238 3300005548 Bacteria 848
66 Ga0068855_100020941 3300005563 Bacteria 7841
67 Ga0068857_100075410 3300005577 Bacteria 3007
68 Ga0068854_100118007 3300005578 Bacteria 2010
69 Ga0068854_100180986 3300005578 Bacteria 1646
70 Ga0068856_100121388 3300005614 Bacteria 2615
71 Ga0068856_100306812 3300005614 Bacteria 1605
72 Ga0068856_100422500 3300005614 Bacteria 1353
73 Ga0070702_100165425 3300005615 Bacteria 1434
74 Ga0068852_100012103 3300005616 Bacteria 6533
75 Ga0068852_100037430 3300005616 Bacteria 4068
76 Ga0068852_100837178 3300005616 Bacteria 935
77 Ga0068859_100116872 3300005617 Bacteria 2732
78 Ga0068859_100901691 3300005617 Bacteria 969
79 Ga0068864_100028018 3300005618 Bacteria 4761
80 Ga0068866_10090420 3300005718 Bacteria 1666
81 Ga0068866_10331156 3300005718 Bacteria 961
82 Ga0068861_100238935 3300005719 Bacteria 1544
83 Ga0068851_10512137 3300005834 Bacteria 721
84 Ga0068870_10011684 3300005840 Bacteria 4080
85 Ga0068863_100647729 3300005841 Bacteria 1048
86 Ga0068858_100217927 3300005842 Bacteria 1807
87 Ga0068860_100130693 3300005843 Bacteria 2409
88 Ga0068860_101479191 3300005843 Bacteria 701
89 Ga0081455_10014302 3300005937 Bacteria 7786
90 Ga0081538_10071566 3300005981 Bacteria 1907
91 Ga0081538_10171097 3300005981 Bacteria 948
92 Ga0070717_10238346 3300006028 Bacteria 1603
93 Ga0075365_10021710 3300006038 Bacteria 4009
94 Ga0075365_10147686 3300006038 Bacteria 1634
95 Ga0075365_10584006 3300006038 Bacteria 790
96 Ga0075363_100027371 3300006048 Bacteria 2923
97 Ga0075364_10213714 3300006051 Bacteria 1308
98 Ga0075364_10573742 3300006051 Bacteria 771
99 Ga0070716_100236424 3300006173 Bacteria 1236
100 Ga0070712_100016737 3300006175 Bacteria 4740
101 Ga0070712_100219598 3300006175 Bacteria 1504
102 Ga0070712_100544253 3300006175 Bacteria 977
103 Ga0097621_100420234 3300006237 Bacteria 1200
104 Ga0075428_100131739 3300006844 Bacteria 2719
105 Ga0075428_100187631 3300006844 Bacteria 2237
106 Ga0075430_100478111 3300006846 Bacteria 1028
107 Ga0075433_10068512 3300006852 Bacteria 3115
108 Ga0068865_100015376 3300006881 Bacteria 4880
109 Ga0097620_100116872 3300006931 Bacteria 2732
110 Ga0097620_100361940 3300006931 Bacteria 1546
111 Ga0097620_100901806 3300006931 Bacteria 969
112 Ga0111539_10095523 3300009094 Bacteria 3491
113 Ga0111539_10489025 3300009094 Bacteria 1433
114 Ga0111539_10680514 3300009094 Bacteria 1198
115 Ga0105245_10016035 3300009098 Bacteria 6528
116 Ga0105245_10059078 3300009098 Bacteria 3452
117 Ga0105245_10249265 3300009098 Bacteria 1724
118 Ga0105245_11872114 3300009098 Bacteria 653
119 Ga0105247_10104288 3300009101 Bacteria 1816
120 Ga0105247_10146900 3300009101 Bacteria 1550
121 Ga0114129_10867766 3300009147 Bacteria 1146
122 Ga0105243_10017843 3300009148 Bacteria 5369
123 Ga0105243_10186445 3300009148 Bacteria 1808
124 Ga0105243_11461385 3300009148 Bacteria 706
125 Ga0105248_10060403 3300009177 Bacteria 4255
126 Ga0105248_10178622 3300009177 Bacteria 2392
127 Ga0105248_10199019 3300009177 Bacteria 2257
128 Ga0105237_10250771 3300009545 Bacteria 1772
129 Ga0105237_10786757 3300009545 Bacteria 958
130 Ga0105238_10104995 3300009551 Bacteria 2807
131 Ga0105249_10285464 3300009553 Bacteria 1650
132 Ga0105249_10478796 3300009553 Bacteria 1287
133 Ga0105249_11292858 3300009553 Bacteria 801
134 Ga0105033_113028 3300009986 Bacteria 739
135 Ga0105246_10000798 3300011119 Bacteria 17873
136 Ga0157371_10167671 3300013102 Bacteria 1569
137 Ga0157371_10203384 3300013102 Bacteria 1420
138 Ga0157369_10002533 3300013105 Bacteria 21842
139 Ga0157369_10044933 3300013105 Bacteria 4806
140 Ga0157369_10112238 3300013105 Bacteria 2896
141 Ga0157369_10329548 3300013105 Bacteria 1586
142 Ga0157369_10598366 3300013105 Bacteria 1138
143 Ga0157369_10795143 3300013105 Bacteria 972
144 Ga0157369_11296544 3300013105 Bacteria 742
145 Ga0157374_10710657 3300013296 Bacteria 1018
146 Ga0157374_10802217 3300013296 Bacteria 957
147 Ga0157374_10871156 3300013296 Bacteria 918
148 Ga0157374_10981499 3300013296 Bacteria 864
149 Ga0157374_11566027 3300013296 Bacteria 683
150 Ga0157378_10984488 3300013297 Bacteria 877
151 Ga0163162_10024071 3300013306 Bacteria 6009
152 Ga0163162_11661171 3300013306 Bacteria 729
153 Ga0157372_10001996 3300013307 Bacteria 22167
154 Ga0157372_10076213 3300013307 Bacteria 3786
155 Ga0157372_10106908 3300013307 Bacteria 3201
156 Ga0157372_10152770 3300013307 Bacteria 2665
157 Ga0157372_10235091 3300013307 Bacteria 2125
158 Ga0157372_10542848 3300013307 Bacteria 1355
159 Ga0157372_10938666 3300013307 Bacteria 1003
160 Ga0157372_10978504 3300013307 Bacteria 980
161 Ga0157375_10524394 3300013308 Bacteria 1347
162 Ga0163163_10027494 3300014325 Bacteria 5450
163 Ga0163163_10393281 3300014325 Bacteria 1444
164 Ga0157380_10006795 3300014326 Bacteria 8083
165 Ga0157380_10219769 3300014326 Bacteria 1699
166 Ga0157377_10890042 3300014745 Bacteria 665
167 Ga0157379_10005072 3300014968 Bacteria 11290
168 Ga0157376_10423235 3300014969 Bacteria 1293
169 Ga0163161_10035731 3300017792 Bacteria 3557
170 Ga0163161_10124255 3300017792 Bacteria 1941
171 Ga0197907_10093497 3300020069 Bacteria 906
172 Ga0197907_10398369 3300020069 Bacteria 1109
173 Ga0197907_10819275 3300020069 Bacteria 687
174 Ga0197907_10847394 3300020069 Bacteria 692
175 Ga0197907_11196807 3300020069 Bacteria 847
176 Ga0197907_11347802 3300020069 Bacteria 927
177 Ga0206356_10104586 3300020070 Bacteria 1354
178 Ga0206356_11156169 3300020070 Bacteria 796
179 Ga0206356_11372662 3300020070 Bacteria 663
180 Ga0206356_11776623 3300020070 Bacteria 1115
181 Ga0206349_1964521 3300020075 Bacteria 721
182 Ga0206355_1192453 3300020076 Bacteria 1303
183 Ga0206355_1506559 3300020076 Bacteria 1093
184 Ga0206351_10102620 3300020077 Bacteria 730
185 Ga0206351_10124985 3300020077 Bacteria 969
186 Ga0206351_10140478 3300020077 Bacteria 817
187 Ga0206351_10267418 3300020077 Bacteria 621
188 Ga0206351_10271054 3300020077 Bacteria 959
189 Ga0206351_10356002 3300020077 Bacteria 1088
190 Ga0206352_11095537 3300020078 Bacteria 829
191 Ga0206350_10314508 3300020080 Bacteria 1351
192 Ga0206350_10455733 3300020080 Bacteria 977
193 Ga0206350_10552454 3300020080 Bacteria 1073
194 Ga0206350_10577538 3300020080 Bacteria 992
195 Ga0206350_11238853 3300020080 Bacteria 781
196 Ga0206350_11317238 3300020080 Bacteria 1695
197 Ga0206350_11655131 3300020080 Bacteria 640
198 Ga0206354_10383207 3300020081 Bacteria 1260
199 Ga0206354_10412445 3300020081 Bacteria 1402
200 Ga0206354_11032737 3300020081 Bacteria 1075
201 Ga0206353_10894913 3300020082 Bacteria 1353
202 Ga0206353_11269258 3300020082 Bacteria 734
203 Ga0154015_1608689 3300020610 Bacteria 647
204 Ga0213875_10000263 3300021388 Bacteria 52579
205 Ga0213875_10200167 3300021388 Bacteria 939
206 Ga0224712_10018732 3300022467 Bacteria 2320
207 Ga0224712_10038795 3300022467 Bacteria 1782
208 Ga0224712_10078846 3300022467 Bacteria 1355
209 Ga0224712_10084556 3300022467 Bacteria 1317
210 Ga0224712_10180596 3300022467 Bacteria 951
211 Ga0224712_10181983 3300022467 Bacteria 947
212 Ga0224712_10345824 3300022467 Bacteria 702
213 Ga0224712_10376674 3300022467 Bacteria 674
214 Ga0224712_10447253 3300022467 Bacteria 620
215 Ga0207692_10100924 3300025898 Bacteria 1584
216 Ga0207692_10103755 3300025898 Bacteria 1566
217 Ga0207642_10095584 3300025899 Bacteria 1479
218 Ga0207642_10116146 3300025899 Bacteria 1372
219 Ga0207710_10109087 3300025900 Bacteria 1313
220 Ga0207688_10169014 3300025901 Bacteria 1299
221 Ga0207699_11016676 3300025906 Bacteria 613
222 Ga0207643_10005131 3300025908 Bacteria 7008
223 Ga0207643_10058268 3300025908 Bacteria 2201
224 Ga0207705_10001935 3300025909 Bacteria 16168
225 Ga0207705_10073655 3300025909 Bacteria 2478
226 Ga0207705_10116518 3300025909 Bacteria 1978
227 Ga0207705_10273707 3300025909 Bacteria 1291
228 Ga0207684_10357140 3300025910 Bacteria 1257
229 Ga0207707_10002057 3300025912 Bacteria 18261
230 Ga0207707_10098091 3300025912 Bacteria 2561
231 Ga0207707_10346400 3300025912 Bacteria 1280
232 Ga0207707_10350383 3300025912 Bacteria 1272
233 Ga0207671_10170476 3300025914 Bacteria 1690
234 Ga0207693_10019026 3300025915 Bacteria 5467
235 Ga0207693_10031217 3300025915 Bacteria 4209
236 Ga0207663_10022532 3300025916 Bacteria 3602
237 Ga0207660_10040097 3300025917 Bacteria 3277
238 Ga0207660_10057662 3300025917 Bacteria 2782
239 Ga0207660_10309328 3300025917 Bacteria 1260
240 Ga0207660_10453328 3300025917 Bacteria 1037
241 Ga0207662_10178516 3300025918 Bacteria 1365
242 Ga0207657_10194337 3300025919 Bacteria 1635
243 Ga0207657_10223485 3300025919 Bacteria 1508
244 Ga0207649_10247734 3300025920 Bacteria 1282
245 Ga0207652_10002443 3300025921 Bacteria 15687
246 Ga0207652_10071568 3300025921 Bacteria 3013
247 Ga0207652_10103733 3300025921 Bacteria 2514
248 Ga0207652_10484045 3300025921 Bacteria 1114
249 Ga0207694_10275281 3300025924 Bacteria 1381
250 Ga0207650_11143551 3300025925 Bacteria 663
251 Ga0207659_10242681 3300025926 Bacteria 1458
252 Ga0207687_10138264 3300025927 Bacteria 1845
253 Ga0207687_10769978 3300025927 Bacteria 820
254 Ga0207700_10003873 3300025928 Bacteria 8744
255 Ga0207700_10033488 3300025928 Bacteria 3677
256 Ga0207664_10045087 3300025929 Bacteria 3456
257 Ga0207664_10051349 3300025929 Bacteria 3255
258 Ga0207664_10072317 3300025929 Bacteria 2780
259 Ga0207690_10005159 3300025932 Bacteria 7708
260 Ga0207690_10021873 3300025932 Bacteria 3972
261 Ga0207690_10034508 3300025932 Bacteria 3260
262 Ga0207690_10060786 3300025932 Bacteria 2566
263 Ga0207709_10291268 3300025935 Bacteria 1210
264 Ga0207709_10500900 3300025935 Bacteria 948
265 Ga0207709_10549943 3300025935 Bacteria 908
266 Ga0207704_10157920 3300025938 Bacteria 1610
267 Ga0207704_10572576 3300025938 Bacteria 921
268 Ga0207665_10391796 3300025939 Bacteria 1056
269 Ga0207691_10005058 3300025940 Bacteria 12723
270 Ga0207711_10379004 3300025941 Bacteria 1312
271 Ga0207711_10985710 3300025941 Bacteria 782
272 Ga0207689_10313595 3300025942 Bacteria 1301
273 Ga0207661_10060642 3300025944 Bacteria 3053
274 Ga0207661_10274674 3300025944 Bacteria 1505
275 Ga0207661_10371241 3300025944 Bacteria 1293
276 Ga0207661_10867114 3300025944 Bacteria 831
277 Ga0207679_11094948 3300025945 Bacteria 731
278 Ga0207667_10007314 3300025949 Bacteria 13296
279 Ga0207712_10031141 3300025961 Bacteria 3590
280 Ga0207712_10274120 3300025961 Bacteria 1374
281 Ga0207712_10336485 3300025961 Bacteria 1250
282 Ga0207712_10371069 3300025961 Bacteria 1195
283 Ga0207640_10034685 3300025981 Bacteria 3151
284 Ga0207677_10152859 3300026023 Bacteria 1783
285 Ga0207703_10458999 3300026035 Bacteria 1191
286 Ga0207639_10448144 3300026041 Bacteria 1171
287 Ga0207678_10960936 3300026067 Bacteria 756
288 Ga0207708_10158371 3300026075 Bacteria 1787
289 Ga0207702_10052015 3300026078 Bacteria 3464
290 Ga0207702_10841211 3300026078 Bacteria 908
291 Ga0207648_10667374 3300026089 Bacteria 962
292 Ga0207676_10428458 3300026095 Bacteria 1242
293 Ga0207674_10004941 3300026116 Bacteria 15927
294 Ga0207674_10567859 3300026116 Bacteria 1096
295 Ga0207674_10887819 3300026116 Bacteria 859
296 Ga0207675_100002793 3300026118 Bacteria 17155
297 Ga0207675_100972724 3300026118 Bacteria 867
298 Ga0207683_10005878 3300026121 Bacteria 10524
299 Ga0207683_10144974 3300026121 Bacteria 2141
300 Ga0207698_10087949 3300026142 Bacteria 2532
301 Ga0207698_10193414 3300026142 Bacteria 1815
302 Ga0207698_10275909 3300026142 Bacteria 1552
303 Ga0207428_10091832 3300027907 Bacteria 2357
304 Ga0268266_10000731 3300028379 Bacteria 44067
305 Ga0268264_10460658 3300028381 Bacteria 1233
306 Ga0307408_100236781 3300031548 Bacteria 1498
307 Ga0316578_10014363 3300031728 Bacteria 4228
308 Ga0316577_10285251 3300031733 Bacteria 935
309 Ga0307413_10308640 3300031824 Bacteria 1203
310 Ga0307413_10802312 3300031824 Bacteria 791
311 Ga0307410_10017935 3300031852 Bacteria 4265
312 Ga0307410_10195855 3300031852 Bacteria 1540
313 Ga0307410_10353834 3300031852 Bacteria 1174
314 Ga0307410_10418308 3300031852 Bacteria 1087
315 Ga0307406_10178387 3300031901 Bacteria 1544
316 Ga0307406_10776459 3300031901 Bacteria 807
317 Ga0307407_10208631 3300031903 Bacteria 1314
318 Ga0307409_100135356 3300031995 Bacteria 2113
319 Ga0307409_100440661 3300031995 Bacteria 1255
320 Ga0307416_100013958 3300032002 Bacteria 5480
321 Ga0307416_100786889 3300032002 Bacteria 1046
322 Ga0307416_101147152 3300032002 Bacteria 882
323 Ga0307411_10204002 3300032005 Bacteria 1521
324 Ga0307415_100074763 3300032126 Bacteria 2396
325 Ga0307415_100087315 3300032126 Bacteria 2247
326 Ga0373923_0004073 3300035111 Bacteria 4804
327 Ga0373945_0202121 3300035116 Bacteria 825
328 Ga0373954_0113745 3300035118 Bacteria 1310
329 Ga0316574_0040651 3300035398 Bacteria 2864
330 Ga0373924_0025880 3300035410 Bacteria 2322
331 Ga0373935_0029801 3300035692 Bacteria 3378
332 Ga0373935_0086824 3300035692 Bacteria 2042
333 Ga0373935_0350123 3300035692 Bacteria 1053
334 Ga0373935_0508630 3300035692 Bacteria 875
335 Ga0373927_0335465 3300035695 Bacteria 996
336 Ga0373933_0051453 3300035724 Bacteria 2462
337 Ga0373937_0208454 3300036401 Bacteria 1838
338 Ga0316584_0155027 3300036712 Bacteria 1703
339 Ga0373925_0283452 3300037068 Bacteria 1335
340 Ga0395899_0001439 3300037312 Bacteria 20342
341 Ga0395899_0036384 3300037312 Bacteria 3693
342 Ga0395899_0697744 3300037312 Bacteria 637
343 Ga0395900_0126727 3300037418 Bacteria 2619
344 Ga0395900_0369143 3300037418 Bacteria 1405
345 Ga0395900_0430897 3300037418 Bacteria 1278
346 Ga0395900_0549525 3300037418 Bacteria 1099
347 Ga0395898_0006551 3300037466 Bacteria 12425
348 Ga0395898_0019493 3300037466 Bacteria 6901
349 Ga0395898_0141512 3300037466 Bacteria 2303
350 Ga0395898_0213836 3300037466 Bacteria 1839
351 Ga0395905_0060301 3300037471 Bacteria 3547
352 Ga0395905_0233454 3300037471 Bacteria 1720
353 Ga0436364_0065152 3300037853 Bacteria 40870
354 Ga0436364_1180688 3300037853 Bacteria 5404
355 Ga0436364_1378650 3300037853 Bacteria 35855
356 Ga0436364_1547827 3300037853 Bacteria 1259
357 Ga0395901_0015331 3300038443 Bacteria 7799
358 Ga0395901_0022866 3300038443 Bacteria 6409
359 Ga0395901_0077313 3300038443 Bacteria 3473
360 Ga0395901_0187730 3300038443 Bacteria 2168
361 Ga0395901_0442469 3300038443 Bacteria 1330
362 Ga0395901_0580921 3300038443 Bacteria 1132
363 Ga0395901_0919245 3300038443 Bacteria 856
364 Ga0436365_1863934 3300039437 Bacteria 938
365 Ga0436363_0397587 3300039450 Bacteria 1509
366 Ga0436362_0441812 3300039453 Bacteria 858
367 Ga0451841_0792004 3300041498 Bacteria 673
368 Ga0451843_0157306 3300041509 Bacteria 899
369 Ga0439449_0021989 3300042007 Bacteria 2387
370 Ga0439450_090250 3300042008 Bacteria 769
371 Ga0466972_0437207 3300044658 Bacteria 614
372 Ga0466965_0311954 3300044683 Bacteria 855
373 Ga0466961_0004247 3300044693 Bacteria 8966
374 Ga0466961_0085320 3300044693 Bacteria 1997
375 Ga0466963_0128204 3300044694 Bacteria 1751
376 Ga0466963_0167120 3300044694 Bacteria 1532
377 Ga0466963_0295481 3300044694 Bacteria 1139
378 Ga0466963_0361181 3300044694 Bacteria 1023
379 Ga0466963_0889232 3300044694 Bacteria 628
380 Ga0466971_0126756 3300044719 Bacteria 1183
381 Ga0466971_0181062 3300044719 Bacteria 991
382 Ga0466968_0036937 3300044735 Bacteria 2048
383 Ga0466970_0195570 3300044765 Bacteria 1124
384 Ga0466970_0252237 3300044765 Bacteria 989
385 Ga0466970_0441437 3300044765 Bacteria 745
386 Ga0466957_0089557 3300044842 Bacteria 1926
387 Ga0466957_0113781 3300044842 Bacteria 1719
388 Ga0466957_0330123 3300044842 Bacteria 1031
389 Ga0466957_0384511 3300044842 Bacteria 958
390 Ga0466960_0000037 3300044901 Bacteria 43394
391 Ga0466960_0016299 3300044901 Bacteria 3220
392 Ga0466960_0149209 3300044901 Bacteria 1248
393 Ga0466960_0335600 3300044901 Bacteria 859
394 Ga0466960_0581942 3300044901 Bacteria 663
395 Ga0466959_0037198 3300045049 Bacteria 3596
396 Ga0466959_0048179 3300045049 Bacteria 3132
397 Ga0466959_0131191 3300045049 Bacteria 1776
398 Ga0466959_0234900 3300045049 Bacteria 1268
399 Ga0466958_0073627 3300045836 Bacteria 2092
400 Ga0466958_0545800 3300045836 Bacteria 753
401 Ga0466958_0580309 3300045836 Bacteria 729
402 Ga0466958_0709178 3300045836 Bacteria 655
403 Ga0466967_0180139 3300045976 Bacteria 1993
404 Ga0466967_0235533 3300045976 Bacteria 1744
405 Ga0466967_0262733 3300045976 Bacteria 1652
406 Ga0466967_0273526 3300045976 Bacteria 1619
407 Ga0466967_0282858 3300045976 Bacteria 1592
408 Ga0466967_0390953 3300045976 Bacteria 1352
409 Ga0466967_0486626 3300045976 Bacteria 1209
410 Ga0466967_0796908 3300045976 Bacteria 938
411 Ga0495592_0002084 3300046454 Bacteria 14096
412 Ga0495629_0038910 3300046459 Bacteria 3349
413 Ga0495641_0046316 3300046461 Bacteria 2000
414 Ga0495651_0001462 3300046462 Bacteria 18262
415 Ga0495639_0142628 3300046475 Bacteria 1152
416 Ga0495639_0315706 3300046475 Bacteria 781
417 Ga0495662_0067720 3300046476 Bacteria 1728
418 Ga0495664_0039968 3300046477 Bacteria 2772
419 Ga0495608_0001665 3300046511 Bacteria 15968
420 Ga0495618_0019779 3300046514 Bacteria 4144
421 Ga0495618_0155440 3300046514 Bacteria 1460
422 Ga0495628_0015749 3300046516 Bacteria 6311
423 Ga0495628_0118350 3300046516 Bacteria 2034
424 Ga0495630_0004997 3300046517 Bacteria 9331
425 Ga0495630_0019903 3300046517 Bacteria 4941
426 Ga0495630_0196477 3300046517 Bacteria 1539
427 Ga0495652_0023808 3300046529 Bacteria 5425
428 Ga0495640_0001411 3300046533 Bacteria 18929
429 Ga0495640_0256883 3300046533 Bacteria 1092
430 Ga0495586_0284094 3300046535 Bacteria 947
431 Ga0495587_0001259 3300046536 Bacteria 16827
432 Ga0495645_0015478 3300046543 Bacteria 5425
433 Ga0495645_0174504 3300046543 Bacteria 1477
434 Ga0495667_0011177 3300046559 Bacteria 6075
435 Ga0495625_0000032 3300046660 Bacteria 233135
436 Ga0495635_0008308 3300046663 Bacteria 7245
437 Ga0495599_0000479 3300046678 Bacteria 22810
438 Ga0495599_0170643 3300046678 Bacteria 1342
439 Ga0495646_0002516 3300046680 Bacteria 11262
440 Ga0495600_0004920 3300046809 Bacteria 8020
441 Ga0495581_0029622 3300047315 Bacteria 3172
442 Ga0495674_0006249 3300047319 Bacteria 11431
443 Ga0495674_0015855 3300047319 Bacteria 7034
444 Ga0495676_0122420 3300047321 Bacteria 1890
445 Ga0495676_0154758 3300047321 Bacteria 1628
446 Ga0495675_0064401 3300047444 Bacteria 2319
447 Ga0495684_0001577 3300047471 Bacteria 18280
448 Ga0495602_0000747 3300048088 Bacteria 30870
449 Ga0496101_0013924 3300048904 Bacteria 5401
450 Ga0496101_0760214 3300048904 Bacteria 765
451 Ga0496101_0840992 3300048904 Bacteria 723
452 Ga0496102_0059865 3300048905 Bacteria 3483
453 Ga0496103_0079676 3300048906 Bacteria 2058
454 Ga0496104_1458890 3300048907 Bacteria 587
455 Ga0496105_0075986 3300048908 Bacteria 2774
456 Ga0496105_0158267 3300048908 Bacteria 1860
457 Ga0496105_0257914 3300048908 Bacteria 1411
458 Ga0496106_0008586 3300048909 Bacteria 7558
459 Ga0496106_0391912 3300048909 Bacteria 1116
460 Ga0496107_0064382 3300048910 Bacteria 2658
461 Ga0496107_0277955 3300048910 Bacteria 1246
462 Ga0496107_0850082 3300048910 Bacteria 667
463 Ga0496108_0111355 3300048911 Bacteria 2341
464 Ga0496108_0508262 3300048911 Bacteria 1052
465 Ga0496108_0620964 3300048911 Bacteria 941
466 Ga0496108_0949719 3300048911 Bacteria 736
467 Ga0496108_1132446 3300048911 Bacteria 664
468 Ga0496109_0048810 3300048912 Bacteria 3851
469 Ga0496109_0097025 3300048912 Bacteria 2732
470 Ga0496109_0112720 3300048912 Bacteria 2529
471 Ga0496109_0195844 3300048912 Bacteria 1899
472 Ga0496109_0623366 3300048912 Bacteria 1015
473 Ga0496110_0005485 3300048913 Bacteria 9949
474 Ga0496110_0071893 3300048913 Bacteria 3069
475 Ga0496110_0161763 3300048913 Bacteria 2029
476 Ga0496110_0249103 3300048913 Bacteria 1617
477 Ga0496110_0282225 3300048913 Bacteria 1512
478 Ga0496111_0030116 3300048914 Bacteria 3859
479 Ga0496111_0156446 3300048914 Bacteria 1691
480 Ga0496111_0590680 3300048914 Bacteria 813
481 Ga0496112_0017910 3300048915 Bacteria 6666
482 Ga0496112_0068087 3300048915 Bacteria 3515
483 Ga0496112_0244800 3300048915 Bacteria 1745
484 Ga0496114_0007989 3300048917 Bacteria 8370
485 Ga0496114_0051301 3300048917 Bacteria 3435
486 Ga0496114_0920312 3300048917 Bacteria 756
487 Ga0501031_0042531 3300049568 Bacteria 2965
488 Ga0501031_0166010 3300049568 Bacteria 1443
489 Ga0501031_0518456 3300049568 Bacteria 768
490 Ga0501032_0501323 3300049569 Bacteria 776
491 Ga0501033_0191444 3300049570 Bacteria 1464
492 Ga0501033_0379835 3300049570 Bacteria 987
493 Ga0501033_0557995 3300049570 Bacteria 788
494 Ga0501034_0322985 3300049571 Bacteria 1476
495 Ga0501036_0060999 3300049572 Bacteria 3194
496 Ga0501036_0290534 3300049572 Bacteria 1368
497 Ga0501036_0427760 3300049572 Bacteria 1104
498 Ga0501036_0489727 3300049572 Bacteria 1023
499 Ga0501036_0627726 3300049572 Bacteria 890
500 Ga0501037_0048579 3300049573 Bacteria 3108
501 Ga0501038_0468921 3300049574 Bacteria 966
502 Ga0501039_0031754 3300049575 Bacteria 4072
503 Ga0501039_0102445 3300049575 Bacteria 2234
504 Ga0501039_0106197 3300049575 Bacteria 2193
505 Ga0501039_0420151 3300049575 Bacteria 1050
506 Ga0501040_0079353 3300049576 Bacteria 2272
507 Ga0501040_0148102 3300049576 Bacteria 1655
508 Ga0501040_0623081 3300049576 Bacteria 779
509 Ga0501041_0092421 3300049577 Bacteria 1868
510 Ga0501043_0186623 3300049579 Bacteria 1614
511 Ga0501047_0042793 3300049581 Bacteria 4375
512 Ga0501047_0129650 3300049581 Bacteria 2402
513 Ga0501048_0143516 3300049582 Bacteria 1688
514 Ga0501048_0180003 3300049582 Bacteria 1498
515 Ga0501067_0006269 3300049583 Bacteria 6598
516 Ga0501067_0012439 3300049583 Bacteria 4721
517 Ga0501067_0025190 3300049583 Bacteria 3298
518 Ga0501067_0033284 3300049583 Bacteria 2860
519 Ga0501068_0228920 3300049584 Bacteria 1182
520 Ga0501068_0554568 3300049584 Bacteria 747
521 Ga0501069_0002467 3300049585 Bacteria 9435
522 Ga0501069_0011541 3300049585 Bacteria 4682
523 Ga0501069_0244971 3300049585 Bacteria 1045
524 Ga0501070_0001075 3300049586 Bacteria 24476
525 Ga0501070_0019464 3300049586 Bacteria 5693
526 Ga0501070_0060149 3300049586 Bacteria 3149
527 Ga0501070_1143133 3300049586 Bacteria 599
528 Ga0501071_0284164 3300049587 Bacteria 1252
529 Ga0501071_0549186 3300049587 Bacteria 887
530 Ga0501071_0664927 3300049587 Bacteria 802
531 Ga0501071_0798449 3300049587 Bacteria 728
532 Ga0501072_0064374 3300049588 Bacteria 2891
533 Ga0501072_0168605 3300049588 Bacteria 1747
534 Ga0501073_0090972 3300049589 Bacteria 2121
535 Ga0501074_0064671 3300049590 Bacteria 2633
536 Ga0501075_0046451 3300049591 Bacteria 3262
537 Ga0501075_1078750 3300049591 Bacteria 610
538 Ga0501076_0069763 3300049592 Bacteria 2809
539 Ga0501076_0339780 3300049592 Bacteria 1232
540 Ga0501077_0247960 3300049593 Bacteria 1132
541 Ga0501080_0039954 3300049742 Bacteria 4378
542 Ga0501080_0051130 3300049742 Bacteria 3845
543 Ga0501080_0224513 3300049742 Bacteria 1718
544 Ga0501081_0501686 3300049743 Bacteria 904
545 Ga0501083_0479343 3300049744 Bacteria 810
546 Ga0501035_0669373 3300049822 Bacteria 840
547 Ga0501044_0031886 3300049823 Bacteria 5542
548 Ga0501044_0298724 3300049823 Bacteria 1540
549 Ga0501045_0376150 3300049824 Bacteria 1057
550 nmdc:mga03n38_7939_c1 3300050490 Bacteria 3779
551 nmdc:mga00v17_105954_c1 3300050491 Bacteria 1779
552 nmdc:mga00v17_264720_c2 3300050491 Bacteria 769
553 nmdc:mga00v17_39072_c1 3300050491 Bacteria 2840
554 nmdc:mga0yw44_297591_c1 3300050492 Bacteria 1081
555 nmdc:mga0yw44_608441_c1 3300050492 Bacteria 742
556 nmdc:mga0yw44_78702_c1 3300050492 Bacteria 2062
557 nmdc:mga05p37_1066118_c1 3300050507 Bacteria 850
558 nmdc:mga09592_731628_c1 3300050508 Bacteria 840
559 nmdc:mga08y16_24654_c1 3300050511 Bacteria 6349
560 nmdc:mga0n895_849906_c1 3300050512 Bacteria 900
561 nmdc:mga08x19_44596_c1 3300050514 Bacteria 2831
562 Ga0495601_0030111 3300053077 Bacteria 3369
563 Ga0495601_0102315 3300053077 Bacteria 1851
564 Ga0495612_0012775 3300053078 Bacteria 3385
565 Ga0495655_0041503 3300053083 Bacteria 1177
566 Ga0500643_003868 3300053087 Bacteria 6966
567 Ga0500593_066918 3300053117 Bacteria 1568
568 Ga0500568_0000046 3300053139 Bacteria 124601
569 Ga0500616_0001313 3300053153 Bacteria 24565
570 Ga0501084_0478697 3300054114 Bacteria 1052
571 Ga0590077_120428 3300059426 Bacteria 620
572 Ga0587073_0013981 3300059492 Bacteria 1421
573 Ga0587080_040005 3300059503 Bacteria 851
574 Ga0587080_065666 3300059503 Bacteria 716
575 Ga0501082_0220083 3300060353 Bacteria 1652
576 Ga0501082_0462723 3300060353 Bacteria 1108
577 Ga0466962_0094796 3300061719 Bacteria 1431
578 Ga0530510_0069169 3300061734 Bacteria 2562
579 Ga0530510_0266835 3300061734 Bacteria 1277
580 Ga0530510_0393939 3300061734 Bacteria 1043
581 2644102143 2643221617 Bacteria 5139111
582 2644115366 2643221620 Bacteria 5134593
583 2812477628 2811994917 Bacteria 7761064
584 2912763938 2912757875 Bacteria 7940295
585 8053947415 8053945823 Bacteria 8962862
586 Ga0068859_100361948
587 JGI24743J22301_10009778
588 Ga0006777J48905_1080901
589 Ga0070658_10002264
590 Ga0070658_10040081
591 Ga0070658_10075929
592 Ga0070683_100168264
593 Ga0070683_100216970
594 Ga0070683_100356622
595 Ga0070683_100808224
596 Ga0070670_100364217
597 Ga0068869_100015795
598 Ga0068869_100083830
599 Ga0068869_100203502
600 Ga0070680_100000880
601 Ga0070680_100040735
602 Ga0070680_100229950
603 Ga0070682_100095003
604 Ga0070682_100165691
605 Ga0070682_100343966
606 Ga0070682_100542363
607 Ga0068868_100106952
608 Ga0070660_100007743
609 Ga0070660_100090226
610 Ga0070660_100136448
611 Ga0070692_10002171
612 Ga0070669_100645400
613 Ga0070674_100363789
614 Ga0070688_100086489
615 Ga0070659_100000756
616 Ga0070659_100025397
617 Ga0070659_100049844
618 Ga0070659_100076060
619 Ga0070659_100575423
620 Ga0070709_10065037
621 Ga0070714_100014638
622 Ga0070714_100571446
623 Ga0070714_100795217
624 Ga0070713_100050053
625 Ga0070710_10021709
626 Ga0070701_10076595
627 Ga0070711_100100227
628 Ga0070700_100003774
629 Ga0070700_100446963
630 Ga0070708_100565979
631 Ga0070708_100666275
632 Ga0070681_10000004
633 Ga0070681_10049718
634 Ga0070681_10198139
635 Ga0070681_10336262
636 Ga0070681_10465926
637 Ga0070706_100018337
638 Ga0070707_100608015
639 Ga0070698_100011358
640 Ga0070679_100000012
641 Ga0070679_100002003
642 Ga0070679_100091216
643 Ga0070679_100119099
644 Ga0070684_100009334
645 Ga0070684_100162579
646 Ga0068853_100069588
647 Ga0070672_101261900
648 Ga0070693_100699918
649 Ga0070665_100000682
650 Ga0070665_101001238
651 Ga0068855_100020941
652 Ga0068857_100075410
653 Ga0068854_100118007
654 Ga0068854_100180986
655 Ga0068856_100121388
656 Ga0068856_100306812
657 Ga0068856_100422500
658 Ga0070702_100165425
659 Ga0068852_100012103
660 Ga0068852_100037430
661 Ga0068852_100837178
662 Ga0068859_100116872
663 Ga0068859_100901691
664 Ga0068864_100028018
665 Ga0068866_10090420
666 Ga0068866_10331156
667 Ga0068861_100238935
668 Ga0068851_10512137
669 Ga0068870_10011684
670 Ga0068863_100647729
671 Ga0068858_100217927
672 Ga0068860_100130693
673 Ga0068860_101479191
674 Ga0081455_10014302
675 Ga0081538_10071566
676 Ga0081538_10171097
677 Ga0070717_10238346
678 Ga0075365_10021710
679 Ga0075365_10147686
680 Ga0075365_10584006
681 Ga0075363_100027371
682 Ga0075364_10213714
683 Ga0075364_10573742
684 Ga0070716_100236424
685 Ga0070712_100016737
686 Ga0070712_100219598
687 Ga0070712_100544253
688 Ga0097621_100420234
689 Ga0075428_100131739
690 Ga0075428_100187631
691 Ga0075430_100478111
692 Ga0075433_10068512
693 Ga0068865_100015376
694 Ga0097620_100116872
695 Ga0097620_100361940
696 Ga0097620_100901806
697 Ga0111539_10095523
698 Ga0111539_10489025
699 Ga0111539_10680514
700 Ga0105245_10016035
701 Ga0105245_10059078
702 Ga0105245_10249265
703 Ga0105245_11872114
704 Ga0105247_10104288
705 Ga0105247_10146900
706 Ga0114129_10867766
707 Ga0105243_10017843
708 Ga0105243_10186445
709 Ga0105243_11461385
710 Ga0105248_10060403
711 Ga0105248_10178622
712 Ga0105248_10199019
713 Ga0105237_10250771
714 Ga0105237_10786757
715 Ga0105238_10104995
716 Ga0105249_10285464
717 Ga0105249_10478796
718 Ga0105249_11292858
719 Ga0105033_113028
720 Ga0105246_10000798
721 Ga0157371_10167671
722 Ga0157371_10203384
723 Ga0157369_10002533
724 Ga0157369_10044933
725 Ga0157369_10112238
726 Ga0157369_10329548
727 Ga0157369_10598366
728 Ga0157369_10795143
729 Ga0157369_11296544
730 Ga0157374_10710657
731 Ga0157374_10802217
732 Ga0157374_10871156
733 Ga0157374_10981499
734 Ga0157374_11566027
735 Ga0157378_10984488
736 Ga0163162_10024071
737 Ga0163162_11661171
738 Ga0157372_10001996
739 Ga0157372_10076213
740 Ga0157372_10106908
741 Ga0157372_10152770
742 Ga0157372_10235091
743 Ga0157372_10542848
744 Ga0157372_10938666
745 Ga0157372_10978504
746 Ga0157375_10524394
747 Ga0163163_10027494
748 Ga0163163_10393281
749 Ga0157380_10006795
750 Ga0157380_10219769
751 Ga0157377_10890042
752 Ga0157379_10005072
753 Ga0157376_10423235
754 Ga0163161_10035731
755 Ga0163161_10124255
756 Ga0197907_10093497
757 Ga0197907_10398369
758 Ga0197907_10819275
759 Ga0197907_10847394
760 Ga0197907_11196807
761 Ga0197907_11347802
762 Ga0206356_10104586
763 Ga0206356_11156169
764 Ga0206356_11372662
765 Ga0206356_11776623
766 Ga0206349_1964521
767 Ga0206355_1192453
768 Ga0206355_1506559
769 Ga0206351_10102620
770 Ga0206351_10124985
771 Ga0206351_10140478
772 Ga0206351_10267418
773 Ga0206351_10271054
774 Ga0206351_10356002
775 Ga0206352_11095537
776 Ga0206350_10314508
777 Ga0206350_10455733
778 Ga0206350_10552454
779 Ga0206350_10577538
780 Ga0206350_11238853
781 Ga0206350_11317238
782 Ga0206350_11655131
783 Ga0206354_10383207
784 Ga0206354_10412445
785 Ga0206354_11032737
786 Ga0206353_10894913
787 Ga0206353_11269258
788 Ga0154015_1608689
789 Ga0213875_10000263
790 Ga0213875_10200167
791 Ga0224712_10018732
792 Ga0224712_10038795
793 Ga0224712_10078846
794 Ga0224712_10084556
795 Ga0224712_10180596
796 Ga0224712_10181983
797 Ga0224712_10345824
798 Ga0224712_10376674
799 Ga0224712_10447253
800 Ga0207692_10100924
801 Ga0207692_10103755
802 Ga0207642_10095584
803 Ga0207642_10116146
804 Ga0207710_10109087
805 Ga0207688_10169014
806 Ga0207699_11016676
807 Ga0207643_10005131
808 Ga0207643_10058268
809 Ga0207705_10001935
810 Ga0207705_10073655
811 Ga0207705_10116518
812 Ga0207705_10273707
813 Ga0207684_10357140
814 Ga0207707_10002057
815 Ga0207707_10098091
816 Ga0207707_10346400
817 Ga0207707_10350383
818 Ga0207671_10170476
819 Ga0207693_10019026
820 Ga0207693_10031217
821 Ga0207663_10022532
822 Ga0207660_10040097
823 Ga0207660_10057662
824 Ga0207660_10309328
825 Ga0207660_10453328
826 Ga0207662_10178516
827 Ga0207657_10194337
828 Ga0207657_10223485
829 Ga0207649_10247734
830 Ga0207652_10002443
831 Ga0207652_10071568
832 Ga0207652_10103733
833 Ga0207652_10484045
834 Ga0207694_10275281
835 Ga0207650_11143551
836 Ga0207659_10242681
837 Ga0207687_10138264
838 Ga0207687_10769978
839 Ga0207700_10003873
840 Ga0207700_10033488
841 Ga0207664_10045087
842 Ga0207664_10051349
843 Ga0207664_10072317
844 Ga0207690_10005159
845 Ga0207690_10021873
846 Ga0207690_10034508
847 Ga0207690_10060786
848 Ga0207709_10291268
849 Ga0207709_10500900
850 Ga0207709_10549943
851 Ga0207704_10157920
852 Ga0207704_10572576
853 Ga0207665_10391796
854 Ga0207691_10005058
855 Ga0207711_10379004
856 Ga0207711_10985710
857 Ga0207689_10313595
858 Ga0207661_10060642
859 Ga0207661_10274674
860 Ga0207661_10371241
861 Ga0207661_10867114
862 Ga0207679_11094948
863 Ga0207667_10007314
864 Ga0207712_10031141
865 Ga0207712_10274120
866 Ga0207712_10336485
867 Ga0207712_10371069
868 Ga0207640_10034685
869 Ga0207677_10152859
870 Ga0207703_10458999
871 Ga0207639_10448144
872 Ga0207678_10960936
873 Ga0207708_10158371
874 Ga0207702_10052015
875 Ga0207702_10841211
876 Ga0207648_10667374
877 Ga0207676_10428458
878 Ga0207674_10004941
879 Ga0207674_10567859
880 Ga0207674_10887819
881 Ga0207675_100002793
882 Ga0207675_100972724
883 Ga0207683_10005878
884 Ga0207683_10144974
885 Ga0207698_10087949
886 Ga0207698_10193414
887 Ga0207698_10275909
888 Ga0207428_10091832
889 Ga0268266_10000731
890 Ga0268264_10460658
891 Ga0307408_100236781
892 Ga0316578_10014363
893 Ga0316577_10285251
894 Ga0307413_10308640
895 Ga0307413_10802312
896 Ga0307410_10017935
897 Ga0307410_10195855
898 Ga0307410_10353834
899 Ga0307410_10418308
900 Ga0307406_10178387
901 Ga0307406_10776459
902 Ga0307407_10208631
903 Ga0307409_100135356
904 Ga0307409_100440661
905 Ga0307416_100013958
906 Ga0307416_100786889
907 Ga0307416_101147152
908 Ga0307411_10204002
909 Ga0307415_100074763
910 Ga0307415_100087315
911 Ga0373923_0004073
912 Ga0373945_0202121
913 Ga0373954_0113745
914 Ga0316574_0040651
915 Ga0373924_0025880
916 Ga0373935_0029801
917 Ga0373935_0086824
918 Ga0373935_0350123
919 Ga0373935_0508630
920 Ga0373927_0335465
921 Ga0373933_0051453
922 Ga0373937_0208454
923 Ga0316584_0155027
924 Ga0373925_0283452
925 Ga0395899_0001439
926 Ga0395899_0036384
927 Ga0395899_0697744
928 Ga0395900_0126727
929 Ga0395900_0369143
930 Ga0395900_0430897
931 Ga0395900_0549525
932 Ga0395898_0006551
933 Ga0395898_0019493
934 Ga0395898_0141512
935 Ga0395898_0213836
936 Ga0395905_0060301
937 Ga0395905_0233454
938 Ga0436364_0065152
939 Ga0436364_1180688
940 Ga0436364_1378650
941 Ga0436364_1547827
942 Ga0395901_0015331
943 Ga0395901_0022866
944 Ga0395901_0077313
945 Ga0395901_0187730
946 Ga0395901_0442469
947 Ga0395901_0580921
948 Ga0395901_0919245
949 Ga0436365_1863934
950 Ga0436363_0397587
951 Ga0436362_0441812
952 Ga0451841_0792004
953 Ga0451843_0157306
954 Ga0439449_0021989
955 Ga0439450_090250
956 Ga0466972_0437207
957 Ga0466965_0311954
958 Ga0466961_0004247
959 Ga0466961_0085320
960 Ga0466963_0128204
961 Ga0466963_0167120
962 Ga0466963_0295481
963 Ga0466963_0361181
964 Ga0466963_0889232
965 Ga0466971_0126756
966 Ga0466971_0181062
967 Ga0466968_0036937
968 Ga0466970_0195570
969 Ga0466970_0252237
970 Ga0466970_0441437
971 Ga0466957_0089557
972 Ga0466957_0113781
973 Ga0466957_0330123
974 Ga0466957_0384511
975 Ga0466960_0000037
976 Ga0466960_0016299
977 Ga0466960_0149209
978 Ga0466960_0335600
979 Ga0466960_0581942
980 Ga0466959_0037198
981 Ga0466959_0048179
982 Ga0466959_0131191
983 Ga0466959_0234900
984 Ga0466958_0073627
985 Ga0466958_0545800
986 Ga0466958_0580309
987 Ga0466958_0709178
988 Ga0466967_0180139
989 Ga0466967_0235533
990 Ga0466967_0262733
991 Ga0466967_0273526
992 Ga0466967_0282858
993 Ga0466967_0390953
994 Ga0466967_0486626
995 Ga0466967_0796908
996 Ga0495592_0002084
997 Ga0495629_0038910
998 Ga0495641_0046316
999 Ga0495651_0001462
1000 Ga0495639_0142628
1001 Ga0495639_0315706
1002 Ga0495662_0067720
1003 Ga0495664_0039968
1004 Ga0495608_0001665
1005 Ga0495618_0019779
1006 Ga0495618_0155440
1007 Ga0495628_0015749
1008 Ga0495628_0118350
1009 Ga0495630_0004997
1010 Ga0495630_0019903
1011 Ga0495630_0196477
1012 Ga0495652_0023808
1013 Ga0495640_0001411
1014 Ga0495640_0256883
1015 Ga0495586_0284094
1016 Ga0495587_0001259
1017 Ga0495645_0015478
1018 Ga0495645_0174504
1019 Ga0495667_0011177
1020 Ga0495625_0000032
1021 Ga0495635_0008308
1022 Ga0495599_0000479
1023 Ga0495599_0170643
1024 Ga0495646_0002516
1025 Ga0495600_0004920
1026 Ga0495581_0029622
1027 Ga0495674_0006249
1028 Ga0495674_0015855
1029 Ga0495676_0122420
1030 Ga0495676_0154758
1031 Ga0495675_0064401
1032 Ga0495684_0001577
1033 Ga0495602_0000747
1034 Ga0496101_0013924
1035 Ga0496101_0760214
1036 Ga0496101_0840992
1037 Ga0496102_0059865
1038 Ga0496103_0079676
1039 Ga0496104_1458890
1040 Ga0496105_0075986
1041 Ga0496105_0158267
1042 Ga0496105_0257914
1043 Ga0496106_0008586
1044 Ga0496106_0391912
1045 Ga0496107_0064382
1046 Ga0496107_0277955
1047 Ga0496107_0850082
1048 Ga0496108_0111355
1049 Ga0496108_0508262
1050 Ga0496108_0620964
1051 Ga0496108_0949719
1052 Ga0496108_1132446
1053 Ga0496109_0048810
1054 Ga0496109_0097025
1055 Ga0496109_0112720
1056 Ga0496109_0195844
1057 Ga0496109_0623366
1058 Ga0496110_0005485
1059 Ga0496110_0071893
1060 Ga0496110_0161763
1061 Ga0496110_0249103
1062 Ga0496110_0282225
1063 Ga0496111_0030116
1064 Ga0496111_0156446
1065 Ga0496111_0590680
1066 Ga0496112_0017910
1067 Ga0496112_0068087
1068 Ga0496112_0244800
1069 Ga0496114_0007989
1070 Ga0496114_0051301
1071 Ga0496114_0920312
1072 Ga0501031_0042531
1073 Ga0501031_0166010
1074 Ga0501031_0518456
1075 Ga0501032_0501323
1076 Ga0501033_0191444
1077 Ga0501033_0379835
1078 Ga0501033_0557995
1079 Ga0501034_0322985
1080 Ga0501036_0060999
1081 Ga0501036_0290534
1082 Ga0501036_0427760
1083 Ga0501036_0489727
1084 Ga0501036_0627726
1085 Ga0501037_0048579
1086 Ga0501038_0468921
1087 Ga0501039_0031754
1088 Ga0501039_0102445
1089 Ga0501039_0106197
1090 Ga0501039_0420151
1091 Ga0501040_0079353
1092 Ga0501040_0148102
1093 Ga0501040_0623081
1094 Ga0501041_0092421
1095 Ga0501043_0186623
1096 Ga0501047_0042793
1097 Ga0501047_0129650
1098 Ga0501048_0143516
1099 Ga0501048_0180003
1100 Ga0501067_0006269
1101 Ga0501067_0012439
1102 Ga0501067_0025190
1103 Ga0501067_0033284
1104 Ga0501068_0228920
1105 Ga0501068_0554568
1106 Ga0501069_0002467
1107 Ga0501069_0011541
1108 Ga0501069_0244971
1109 Ga0501070_0001075
1110 Ga0501070_0019464
1111 Ga0501070_0060149
1112 Ga0501070_1143133
1113 Ga0501071_0284164
1114 Ga0501071_0549186
1115 Ga0501071_0664927
1116 Ga0501071_0798449
1117 Ga0501072_0064374
1118 Ga0501072_0168605
1119 Ga0501073_0090972
1120 Ga0501074_0064671
1121 Ga0501075_0046451
1122 Ga0501075_1078750
1123 Ga0501076_0069763
1124 Ga0501076_0339780
1125 Ga0501077_0247960
1126 Ga0501080_0039954
1127 Ga0501080_0051130
1128 Ga0501080_0224513
1129 Ga0501081_0501686
1130 Ga0501083_0479343
1131 Ga0501035_0669373
1132 Ga0501044_0031886
1133 Ga0501044_0298724
1134 Ga0501045_0376150
1135 nmdc:mga03n38_7939_c1
1136 nmdc:mga00v17_105954_c1
1137 nmdc:mga00v17_264720_c2
1138 nmdc:mga00v17_39072_c1
1139 nmdc:mga0yw44_297591_c1
1140 nmdc:mga0yw44_608441_c1
1141 nmdc:mga0yw44_78702_c1
1142 nmdc:mga05p37_1066118_c1
1143 nmdc:mga09592_731628_c1
1144 nmdc:mga08y16_24654_c1
1145 nmdc:mga0n895_849906_c1
1146 nmdc:mga08x19_44596_c1
1147 Ga0495601_0030111
1148 Ga0495601_0102315
1149 Ga0495612_0012775
1150 Ga0495655_0041503
1151 Ga0500643_003868
1152 Ga0500593_066918
1153 Ga0500568_0000046
1154 Ga0500616_0001313
1155 Ga0501084_0478697
1156 Ga0590077_120428
1157 Ga0587073_0013981
1158 Ga0587080_040005
1159 Ga0587080_065666
1160 Ga0501082_0220083
1161 Ga0501082_0462723
1162 Ga0466962_0094796
1163 Ga0530510_0069169
1164 Ga0530510_0266835
1165 Ga0530510_0393939
1166 2644102143
1167 2644115366
1168 2812477628
1169 2912763938
1170 8053947415

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

37

210

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2vrn-assembly1.cif.gz_B the structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily 0.9853 5 179
3l18-assembly1.cif.gz_B ton1285, an intracellular protease from thermococcus onnurineus na1 0.9787 7 177
6q3t-assembly1.cif.gz_A structure of protease1 from pyrococcus horikoshii at room temperature in chipx microfluidic device 0.9774 9 177
6f2f-assembly1.cif.gz_A crystal structure of protease 1 from pyrococcus horikoshii co-cystallized in presence of 10 mm tb-xo4 and ammonium sulfate. 0.9766 9 177
7r66-assembly1.cif.gz_A structure of pfp1 protease from thermococcus thioreducens: large unit cell at 1.44 a resolution 0.9749 9 177
ID Description Score Start End Superfamily
2vrnB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9832 5 179 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9766 9 177 3.40.50.880
1oi4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9613 8 177 3.40.50.880
3fseB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9607 8 176 3.40.50.880
6f2fA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9536 9 177 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A7J9W6H1-F1-model_v4 DJ-1/PfpI/YhbO family deglycase/protease 1.002 4 179 GO:0006508
GO:0008233
AF-A0A558AK86-F1-model_v4 Type 1 glutamine amidotransferase 1.001 4 179 GO:0016740
AF-A0A7K2MGU3-F1-model_v4 Protease 1.001 9 148 GO:0006508
GO:0008233
AF-A0A7V9R8G5-F1-model_v4 Type 1 glutamine amidotransferase 1 2 179 GO:0016740
AF-A4FGZ7-F1-model_v4 Peptidase C56, PfpI 1 4 179

Map