F466405

General Info

Members Datasets Scaffolds Average Seq Length
584 292 1168 153

Family's Representative Sequence

Representative Sequence 3300050493|nmdc:mga0k408_356950_c1|nmdc:mga0k408_356950_c1_49_561
Length 170
Sequence MITTRRRWATAALDLHADRPNKKEMDTDDKVHIACPHCGAKNRVPVSRLTENPVCGKCKQALFTGKPLELTDADFAAKVADTDIPVVVDFWAPWCGPCRMMAPHFERAAGELEPQVRLAKLNTEEAQATAARYGIRSIPTLIVFKGGREVARQSGAMDSASLARWVRSVA

Samples

Sample ID Description Type Environment
1 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
6 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
7 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
114 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
116 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
119 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
120 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
122 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
123 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
125 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
185 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
186 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
187 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
190 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
193 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
194 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
195 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
196 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
206 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
207 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
208 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
209 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
210 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
211 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
212 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
213 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
214 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
215 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
218 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
219 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
220 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
221 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
222 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
225 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
226 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
227 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
228 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
229 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
230 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
234 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
237 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
251 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
252 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
253 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
254 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
255 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
256 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
257 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
258 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
259 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
266 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
267 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
268 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
269 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
270 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
275 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
276 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
277 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
278 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
279 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
282 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
283 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
284 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
285 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
286 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
287 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
288 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
289 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
290 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
291 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
292 2842780639 Pseudoxanthomonas sp. R-71986 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.12
Metatranscriptomes 0.51
Isolates 1.37

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.51
Nodule 0.17
Rhizoplane 4.62
Rhizosphere 84.93
Stem 0
Stem Tuber 0
Unclassified 1.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga0k408_356950_c1 3300050493 Bacteria 871
2 MBSR1b_contig_9428239 2162886012 Bacteria 822
3 JGI25162J39368_1000386 3300002737 Bacteria 37462
4 JGI25154J39366_1019018 3300002738 Bacteria 670
5 JGI25164J39214_1000230 3300002772 Bacteria 43387
6 JGI25165J46597_1000365 3300003214 Bacteria 50517
7 Ga0055535_1000890 3300003761 Bacteria 20542
8 Ga0055535_1004708 3300003761 Bacteria 3221
9 Ga0055542_1000262 3300003762 Bacteria 58778
10 Ga0055542_1000335 3300003762 Bacteria 50095
11 Ga0055529_1000357 3300003763 Bacteria 50095
12 Ga0055531_10011650 3300003794 Bacteria 4215
13 Ga0065712_10070808 3300005290 Bacteria 5691
14 Ga0065715_10113979 3300005293 Bacteria 2467
15 Ga0065715_10134094 3300005293 Bacteria 1961
16 Ga0070676_10024865 3300005328 Bacteria 3379
17 Ga0070676_10050309 3300005328 Bacteria 2443
18 Ga0070683_100063172 3300005329 Bacteria 3444
19 Ga0070683_100117852 3300005329 Bacteria 2507
20 Ga0070690_100000419 3300005330 Bacteria 21559
21 Ga0070670_100031655 3300005331 Bacteria 4556
22 Ga0070670_100797746 3300005331 Bacteria 853
23 Ga0068869_100050012 3300005334 Bacteria 3029
24 Ga0068869_100141074 3300005334 Bacteria 1860
25 Ga0068869_101848146 3300005334 Bacteria 541
26 Ga0070666_10056041 3300005335 Bacteria 2661
27 Ga0070680_100199511 3300005336 Bacteria 1687
28 Ga0070682_100087163 3300005337 Bacteria 2035
29 Ga0070682_100284157 3300005337 Bacteria 1207
30 Ga0068868_100013601 3300005338 Bacteria 5975
31 Ga0070660_100007435 3300005339 Bacteria 7633
32 Ga0070660_100040705 3300005339 Bacteria 3538
33 Ga0070689_100082534 3300005340 Bacteria 2525
34 Ga0070689_100610960 3300005340 Bacteria 945
35 Ga0070691_10089590 3300005341 Bacteria 1515
36 Ga0070687_100022946 3300005343 Bacteria 2959
37 Ga0070687_100113130 3300005343 Bacteria 1540
38 Ga0070687_100292142 3300005343 Bacteria 1031
39 Ga0070661_100039136 3300005344 Bacteria 3454
40 Ga0070661_100120159 3300005344 Bacteria 1968
41 Ga0070668_100004280 3300005347 Bacteria 10590
42 Ga0070668_100304772 3300005347 Bacteria 1337
43 Ga0070668_101419435 3300005347 Bacteria 633
44 Ga0070669_100028720 3300005353 Bacteria 4005
45 Ga0070669_100134027 3300005353 Bacteria 1904
46 Ga0070675_100002893 3300005354 Bacteria 12939
47 Ga0070675_100061044 3300005354 Bacteria 3112
48 Ga0070675_100140299 3300005354 Bacteria 2065
49 Ga0070671_100020448 3300005355 Bacteria 5399
50 Ga0070671_100067272 3300005355 Bacteria 2987
51 Ga0070671_100069108 3300005355 Bacteria 2946
52 Ga0070671_100084905 3300005355 Bacteria 2648
53 Ga0070674_100155346 3300005356 Bacteria 1731
54 Ga0070674_100334272 3300005356 Bacteria 1218
55 Ga0070673_100000142 3300005364 Bacteria 33978
56 Ga0070673_100017043 3300005364 Bacteria 5154
57 Ga0070673_100022746 3300005364 Bacteria 4568
58 Ga0070688_100017658 3300005365 Bacteria 4098
59 Ga0070688_100133830 3300005365 Bacteria 1676
60 Ga0070659_100013480 3300005366 Bacteria 6085
61 Ga0070659_100071799 3300005366 Bacteria 2753
62 Ga0070659_100247807 3300005366 Bacteria 1476
63 Ga0070659_100322076 3300005366 Bacteria 1292
64 Ga0070667_100073280 3300005367 Bacteria 2920
65 Ga0070667_100762842 3300005367 Bacteria 897
66 Ga0070709_10065443 3300005434 Bacteria 2328
67 Ga0070705_100007496 3300005440 Bacteria 5371
68 Ga0070700_100019922 3300005441 Bacteria 3878
69 Ga0070700_100054987 3300005441 Bacteria 2490
70 Ga0070700_100085329 3300005441 Bacteria 2048
71 Ga0070700_101277955 3300005441 Bacteria 616
72 Ga0070663_100002613 3300005455 Bacteria 10185
73 Ga0070663_100250377 3300005455 Bacteria 1402
74 Ga0070663_101419586 3300005455 Bacteria 615
75 Ga0070678_100008648 3300005456 Bacteria 6105
76 Ga0070678_100262192 3300005456 Bacteria 1454
77 Ga0070678_100289967 3300005456 Bacteria 1387
78 Ga0070662_100000666 3300005457 Bacteria 20905
79 Ga0070662_100001384 3300005457 Bacteria 14914
80 Ga0070662_100009667 3300005457 Bacteria 6309
81 Ga0070662_100445924 3300005457 Bacteria 1074
82 Ga0070662_100615246 3300005457 Bacteria 914
83 Ga0070681_10093093 3300005458 Bacteria 2962
84 Ga0070681_10155997 3300005458 Bacteria 2208
85 Ga0070681_10182172 3300005458 Bacteria 2022
86 Ga0068867_100006998 3300005459 Bacteria 7971
87 Ga0070685_10036070 3300005466 Bacteria 2794
88 Ga0070685_10069229 3300005466 Bacteria 2087
89 Ga0070699_100901665 3300005518 Bacteria 810
90 Ga0070679_100133412 3300005530 Bacteria 2464
91 Ga0070679_100326233 3300005530 Bacteria 1484
92 Ga0070684_100028694 3300005535 Bacteria 4708
93 Ga0070684_100032031 3300005535 Bacteria 4478
94 Ga0070684_100384911 3300005535 Bacteria 1292
95 Ga0068853_100053462 3300005539 Bacteria 3478
96 Ga0068853_100168124 3300005539 Bacteria 1983
97 Ga0068853_100204095 3300005539 Bacteria 1799
98 Ga0068853_100595527 3300005539 Bacteria 1050
99 Ga0068853_100780252 3300005539 Bacteria 914
100 Ga0070672_100002609 3300005543 Bacteria 11517
101 Ga0070672_100002737 3300005543 Bacteria 11286
102 Ga0070672_100543496 3300005543 Bacteria 1008
103 Ga0070672_100852015 3300005543 Bacteria 803
104 Ga0070686_100000792 3300005544 Bacteria 18312
105 Ga0070686_100228369 3300005544 Bacteria 1349
106 Ga0070695_100564636 3300005545 Bacteria 889
107 Ga0070693_100040611 3300005547 Bacteria 2612
108 Ga0070693_100041302 3300005547 Bacteria 2594
109 Ga0070665_100044623 3300005548 Bacteria 4452
110 Ga0070665_101515214 3300005548 Bacteria 679
111 Ga0070704_100312866 3300005549 Bacteria 1313
112 Ga0070704_100470055 3300005549 Bacteria 1086
113 Ga0070704_100757855 3300005549 Bacteria 865
114 Ga0068855_100002321 3300005563 Bacteria 23515
115 Ga0068855_100059887 3300005563 Bacteria 4454
116 Ga0068855_100060110 3300005563 Bacteria 4445
117 Ga0070664_100000474 3300005564 Bacteria 30324
118 Ga0070664_100002371 3300005564 Bacteria 15140
119 Ga0070664_100121533 3300005564 Bacteria 2287
120 Ga0070664_100306169 3300005564 Bacteria 1437
121 Ga0068857_100007890 3300005577 Bacteria 9181
122 Ga0068857_100211110 3300005577 Bacteria 1771
123 Ga0068857_100556833 3300005577 Bacteria 1081
124 Ga0068854_100366662 3300005578 Bacteria 1183
125 Ga0068856_100000299 3300005614 Bacteria 54390
126 Ga0068856_100293443 3300005614 Bacteria 1643
127 Ga0070702_100007570 3300005615 Bacteria 5204
128 Ga0070702_100019349 3300005615 Bacteria 3549
129 Ga0068852_100150767 3300005616 Bacteria 2162
130 Ga0068852_100701489 3300005616 Bacteria 1022
131 Ga0068852_101096614 3300005616 Bacteria 816
132 Ga0068859_100002153 3300005617 Bacteria 20009
133 Ga0068859_100102118 3300005617 Bacteria 2925
134 Ga0068859_101556561 3300005617 Bacteria 730
135 Ga0068864_100002930 3300005618 Bacteria 14105
136 Ga0068864_100034582 3300005618 Bacteria 4299
137 Ga0068864_101517527 3300005618 Bacteria 673
138 Ga0068866_10001851 3300005718 Bacteria 8872
139 Ga0068866_10023114 3300005718 Bacteria 2887
140 Ga0068861_100000680 3300005719 Bacteria 20286
141 Ga0068861_100016763 3300005719 Bacteria 5191
142 Ga0068861_100100768 3300005719 Bacteria 2296
143 Ga0068861_100563901 3300005719 Bacteria 1040
144 Ga0068861_100815332 3300005719 Bacteria 877
145 Ga0068861_101722743 3300005719 Bacteria 620
146 Ga0068851_10004631 3300005834 Bacteria 6209
147 Ga0068851_10043446 3300005834 Bacteria 2266
148 Ga0068851_10225165 3300005834 Bacteria 1055
149 Ga0068870_10007369 3300005840 Bacteria 4900
150 Ga0068870_10270571 3300005840 Bacteria 1061
151 Ga0068863_100002901 3300005841 Bacteria 16986
152 Ga0068863_100919819 3300005841 Bacteria 875
153 Ga0068858_100033008 3300005842 Bacteria 4808
154 Ga0068858_100074620 3300005842 Bacteria 3149
155 Ga0068858_101135808 3300005842 Bacteria 767
156 Ga0068860_100034339 3300005843 Bacteria 4864
157 Ga0068862_100003998 3300005844 Bacteria 12508
158 Ga0068862_100069610 3300005844 Bacteria 3037
159 Ga0068862_100095418 3300005844 Bacteria 2595
160 Ga0068862_100223134 3300005844 Bacteria 1707
161 Ga0081539_10330105 3300005985 Bacteria 646
162 Ga0075365_10330869 3300006038 Bacteria 1073
163 Ga0070712_100094282 3300006175 Bacteria 2199
164 Ga0075366_10320677 3300006195 Bacteria 949
165 Ga0097621_100023959 3300006237 Bacteria 4759
166 Ga0097621_100302327 3300006237 Bacteria 1413
167 Ga0097621_100359276 3300006237 Bacteria 1297
168 Ga0097621_101073599 3300006237 Bacteria 755
169 Ga0068871_100112817 3300006358 Bacteria 2288
170 Ga0075428_100006850 3300006844 Bacteria 12665
171 Ga0075428_100009588 3300006844 Bacteria 10751
172 Ga0075428_100026486 3300006844 Bacteria 6418
173 Ga0075430_100020525 3300006846 Bacteria 5620
174 Ga0075430_100039333 3300006846 Bacteria 4005
175 Ga0075430_100048950 3300006846 Bacteria 3568
176 Ga0075430_100306660 3300006846 Bacteria 1313
177 Ga0075431_100002979 3300006847 Bacteria 16390
178 Ga0075431_100004291 3300006847 Bacteria 13976
179 Ga0075431_100284374 3300006847 Bacteria 1674
180 Ga0075431_101155201 3300006847 Bacteria 738
181 Ga0075431_101398925 3300006847 Bacteria 659
182 Ga0075433_10485110 3300006852 Bacteria 1089
183 Ga0075434_100119211 3300006871 Bacteria 2653
184 Ga0075434_100432844 3300006871 Bacteria 1337
185 Ga0075429_100010997 3300006880 Bacteria 7830
186 Ga0075429_100071295 3300006880 Bacteria 3025
187 Ga0075429_100241913 3300006880 Bacteria 1581
188 Ga0075429_100287386 3300006880 Bacteria 1440
189 Ga0068865_100017969 3300006881 Bacteria 4557
190 Ga0068865_100343817 3300006881 Bacteria 1206
191 Ga0075436_100651725 3300006914 Bacteria 778
192 Ga0097620_100002153 3300006931 Bacteria 20009
193 Ga0097620_100102116 3300006931 Bacteria 2925
194 Ga0097620_101556619 3300006931 Bacteria 730
195 Ga0111539_10000131 3300009094 Bacteria 84998
196 Ga0111539_10000516 3300009094 Bacteria 49025
197 Ga0111539_10160450 3300009094 Bacteria 2630
198 Ga0111539_10683235 3300009094 Bacteria 1195
199 Ga0105245_10191375 3300009098 Bacteria 1960
200 Ga0105247_10040924 3300009101 Bacteria 2834
201 Ga0114129_10005366 3300009147 Bacteria 18093
202 Ga0114129_10034218 3300009147 Bacteria 7175
203 Ga0105243_10018179 3300009148 Bacteria 5322
204 Ga0105243_10088349 3300009148 Bacteria 2546
205 Ga0105241_10049207 3300009174 Bacteria 3209
206 Ga0105248_10002201 3300009177 Bacteria 21585
207 Ga0105248_10023045 3300009177 Bacteria 6915
208 Ga0105248_10061680 3300009177 Bacteria 4211
209 Ga0105238_10408451 3300009551 Bacteria 1352
210 Ga0105238_10784725 3300009551 Bacteria 968
211 Ga0105249_10014221 3300009553 Bacteria 7037
212 Ga0105249_10017587 3300009553 Bacteria 6347
213 Ga0105249_11533151 3300009553 Bacteria 739
214 Ga0105239_10328242 3300010375 Bacteria 1726
215 Ga0105239_10408759 3300010375 Bacteria 1537
216 Ga0105239_10668135 3300010375 Bacteria 1187
217 Ga0157373_10071415 3300013100 Bacteria 2452
218 Ga0157373_10101838 3300013100 Bacteria 2020
219 Ga0157373_11109826 3300013100 Unclassified 594
220 Ga0157371_10000210 3300013102 Bacteria 84791
221 Ga0157371_10150340 3300013102 Bacteria 1660
222 Ga0157370_10021596 3300013104 Bacteria 6414
223 Ga0157370_10032315 3300013104 Bacteria 5111
224 Ga0157370_10064941 3300013104 Bacteria 3454
225 Ga0157369_10073508 3300013105 Bacteria 3668
226 Ga0157369_10181293 3300013105 Bacteria 2215
227 Ga0157369_10270490 3300013105 Bacteria 1771
228 Ga0157369_10636833 3300013105 Bacteria 1100
229 Ga0157374_10074510 3300013296 Bacteria 3206
230 Ga0157374_10543297 3300013296 Bacteria 1169
231 Ga0157378_10892728 3300013297 Bacteria 919
232 Ga0163162_10028636 3300013306 Bacteria 5513
233 Ga0163162_10177746 3300013306 Bacteria 2254
234 Ga0163162_10296653 3300013306 Unclassified 1748
235 Ga0163162_10948672 3300013306 Bacteria 971
236 Ga0157372_10020570 3300013307 Bacteria 7121
237 Ga0157372_10175996 3300013307 Bacteria 2476
238 Ga0157372_10220005 3300013307 Bacteria 2201
239 Ga0157372_10222939 3300013307 Bacteria 2186
240 Ga0157375_10037061 3300013308 Bacteria 4669
241 Ga0157375_10504440 3300013308 Bacteria 1374
242 Ga0157375_11603379 3300013308 Bacteria 769
243 Ga0157375_11674222 3300013308 Bacteria 753
244 Ga0163163_10000924 3300014325 Bacteria 24874
245 Ga0163163_10177619 3300014325 Bacteria 2176
246 Ga0157380_10764679 3300014326 Bacteria 979
247 Ga0157380_11067595 3300014326 Bacteria 845
248 Ga0182008_10159829 3300014497 Bacteria 1133
249 Ga0157377_10007755 3300014745 Bacteria 5201
250 Ga0157377_10035504 3300014745 Bacteria 2735
251 Ga0157377_10583554 3300014745 Bacteria 795
252 Ga0157379_10097462 3300014968 Bacteria 2640
253 Ga0157379_10221532 3300014968 Bacteria 1714
254 Ga0157379_10321124 3300014968 Bacteria 1414
255 Ga0157376_10745361 3300014969 Bacteria 988
256 Ga0157376_12306398 3300014969 Bacteria 577
257 Ga0163161_10299124 3300017792 Bacteria 1267
258 Ga0213876_10029156 3300021384 Bacteria 2910
259 Ga0209672_100216 3300025228 Bacteria 45231
260 Ga0209672_100688 3300025228 Bacteria 16973
261 Ga0207427_100021 3300025231 Bacteria 494115
262 Ga0209437_100534 3300025233 Bacteria 26414
263 Ga0209258_100035 3300025242 Bacteria 430864
264 Ga0209258_100088 3300025242 Bacteria 237738
265 Ga0207425_1063453 3300025245 Bacteria 647
266 Ga0209646_1000475 3300025246 Bacteria 20142
267 Ga0209148_1000048 3300025254 Bacteria 430913
268 Ga0209148_1000214 3300025254 Bacteria 99629
269 Ga0209759_1000777 3300025256 Bacteria 26738
270 Ga0209233_1000023 3300025261 Bacteria 738870
271 Ga0209455_1000184 3300025272 Bacteria 99629
272 Ga0209758_1002321 3300025297 Bacteria 19671
273 Ga0209050_1000169 3300025298 Bacteria 151269
274 Ga0209257_1000287 3300025304 Bacteria 111624
275 Ga0207697_10000097 3300025315 Bacteria 39643
276 Ga0207656_10031212 3300025321 Bacteria 2206
277 Ga0207656_10050282 3300025321 Bacteria 1799
278 Ga0207682_10004577 3300025893 Bacteria 5763
279 Ga0207642_10032218 3300025899 Bacteria 2204
280 Ga0207642_10033111 3300025899 Bacteria 2183
281 Ga0207680_10056438 3300025903 Bacteria 2372
282 Ga0207680_10070391 3300025903 Bacteria 2165
283 Ga0207680_10481166 3300025903 Unclassified 883
284 Ga0207645_10001136 3300025907 Bacteria 22026
285 Ga0207645_10067932 3300025907 Bacteria 2278
286 Ga0207643_10000178 3300025908 Bacteria 43423
287 Ga0207643_10045048 3300025908 Bacteria 2491
288 Ga0207707_10243053 3300025912 Bacteria 1565
289 Ga0207707_10468405 3300025912 Bacteria 1077
290 Ga0207695_11305882 3300025913 Unclassified 606
291 Ga0207662_10031336 3300025918 Bacteria 3089
292 Ga0207662_10031354 3300025918 Bacteria 3088
293 Ga0207662_10741441 3300025918 Bacteria 690
294 Ga0207657_10042979 3300025919 Bacteria 3984
295 Ga0207657_10078951 3300025919 Bacteria 2770
296 Ga0207657_10108745 3300025919 Bacteria 2292
297 Ga0207657_11033793 3300025919 Bacteria 629
298 Ga0207649_10031015 3300025920 Bacteria 3173
299 Ga0207649_10057546 3300025920 Bacteria 2431
300 Ga0207649_10099033 3300025920 Bacteria 1925
301 Ga0207649_10694136 3300025920 Bacteria 789
302 Ga0207652_10264943 3300025921 Bacteria 1550
303 Ga0207681_10170661 3300025923 Bacteria 1648
304 Ga0207681_10231130 3300025923 Bacteria 1435
305 Ga0207681_10278797 3300025923 Bacteria 1315
306 Ga0207694_10243604 3300025924 Bacteria 1470
307 Ga0207650_10005398 3300025925 Bacteria 8722
308 Ga0207650_10041589 3300025925 Bacteria 3369
309 Ga0207659_10008487 3300025926 Bacteria 6381
310 Ga0207659_10110410 3300025926 Bacteria 2090
311 Ga0207687_10315277 3300025927 Bacteria 1264
312 Ga0207644_10043720 3300025931 Bacteria 3180
313 Ga0207644_10100002 3300025931 Bacteria 2177
314 Ga0207644_10270185 3300025931 Bacteria 1362
315 Ga0207644_10395766 3300025931 Bacteria 1128
316 Ga0207644_10545779 3300025931 Bacteria 959
317 Ga0207644_11139171 3300025931 Bacteria 656
318 Ga0207690_10147038 3300025932 Bacteria 1743
319 Ga0207690_10314457 3300025932 Bacteria 1229
320 Ga0207690_11189977 3300025932 Bacteria 636
321 Ga0207706_10003504 3300025933 Bacteria 14983
322 Ga0207706_10004967 3300025933 Bacteria 12430
323 Ga0207706_10015561 3300025933 Bacteria 6872
324 Ga0207706_10033685 3300025933 Bacteria 4558
325 Ga0207706_10498924 3300025933 Bacteria 1051
326 Ga0207709_10552411 3300025935 Bacteria 906
327 Ga0207670_10091895 3300025936 Bacteria 2147
328 Ga0207670_10339260 3300025936 Bacteria 1187
329 Ga0207669_10261043 3300025937 Bacteria 1295
330 Ga0207669_10448213 3300025937 Bacteria 1022
331 Ga0207704_10126338 3300025938 Bacteria 1761
332 Ga0207691_10005105 3300025940 Bacteria 12667
333 Ga0207691_10005595 3300025940 Bacteria 12144
334 Ga0207691_10018388 3300025940 Bacteria 6622
335 Ga0207691_10703091 3300025940 Bacteria 852
336 Ga0207711_10014338 3300025941 Bacteria 6582
337 Ga0207689_10029648 3300025942 Bacteria 4567
338 Ga0207689_10090204 3300025942 Bacteria 2518
339 Ga0207661_10058275 3300025944 Bacteria 3108
340 Ga0207661_10291841 3300025944 Bacteria 1460
341 Ga0207679_10001875 3300025945 Bacteria 13072
342 Ga0207679_10009107 3300025945 Bacteria 6345
343 Ga0207679_10242981 3300025945 Bacteria 1526
344 Ga0207667_10028054 3300025949 Bacteria 6116
345 Ga0207667_10340287 3300025949 Bacteria 1531
346 Ga0207651_10034270 3300025960 Bacteria 3286
347 Ga0207651_10055959 3300025960 Bacteria 2712
348 Ga0207651_10061500 3300025960 Bacteria 2612
349 Ga0207651_10305947 3300025960 Bacteria 1323
350 Ga0207712_10049941 3300025961 Bacteria 2918
351 Ga0207712_10376792 3300025961 Bacteria 1186
352 Ga0207668_10009298 3300025972 Bacteria 5883
353 Ga0207668_10467602 3300025972 Bacteria 1079
354 Ga0207668_11369848 3300025972 Bacteria 637
355 Ga0207640_10118601 3300025981 Bacteria 1891
356 Ga0207658_10115651 3300025986 Bacteria 2129
357 Ga0207658_10257708 3300025986 Bacteria 1485
358 Ga0207677_10195176 3300026023 Bacteria 1604
359 Ga0207703_10024206 3300026035 Bacteria 4777
360 Ga0207703_10083203 3300026035 Bacteria 2673
361 Ga0207703_10524616 3300026035 Bacteria 1114
362 Ga0207639_10009656 3300026041 Bacteria 6666
363 Ga0207639_10091524 3300026041 Bacteria 2435
364 Ga0207639_10197170 3300026041 Bacteria 1724
365 Ga0207678_10003036 3300026067 Bacteria 15180
366 Ga0207678_11124101 3300026067 Bacteria 696
367 Ga0207708_10000668 3300026075 Bacteria 26303
368 Ga0207708_10032437 3300026075 Bacteria 3966
369 Ga0207708_10042727 3300026075 Bacteria 3454
370 Ga0207702_10153783 3300026078 Bacteria 2095
371 Ga0207641_10003151 3300026088 Bacteria 14783
372 Ga0207641_10358424 3300026088 Bacteria 1392
373 Ga0207648_10011410 3300026089 Bacteria 8372
374 Ga0207648_10055675 3300026089 Bacteria 3452
375 Ga0207676_10028482 3300026095 Bacteria 4172
376 Ga0207676_10113957 3300026095 Bacteria 2267
377 Ga0207674_10010354 3300026116 Bacteria 10572
378 Ga0207674_10079249 3300026116 Bacteria 3289
379 Ga0207674_10370491 3300026116 Bacteria 1384
380 Ga0207675_100001968 3300026118 Bacteria 20483
381 Ga0207675_100005356 3300026118 Bacteria 12316
382 Ga0207675_100007725 3300026118 Bacteria 10148
383 Ga0207675_100680435 3300026118 Bacteria 1036
384 Ga0207683_10009243 3300026121 Bacteria 8400
385 Ga0207683_10034137 3300026121 Bacteria 4420
386 Ga0207698_10107903 3300026142 Bacteria 2326
387 Ga0207698_11212013 3300026142 Bacteria 769
388 Ga0209983_1007989 3300027665 Bacteria 2164
389 Ga0209971_1005514 3300027682 Bacteria 3002
390 Ga0209971_1024226 3300027682 Bacteria 1449
391 Ga0209998_10015952 3300027717 Bacteria 1578
392 Ga0209974_10009279 3300027876 Bacteria 3340
393 Ga0209974_10017554 3300027876 Bacteria 2373
394 Ga0207428_10039767 3300027907 Bacteria 3818
395 Ga0207428_10089626 3300027907 Bacteria 2390
396 Ga0207428_10142858 3300027907 Bacteria 1826
397 Ga0268266_10041763 3300028379 Bacteria 3915
398 Ga0268266_11176917 3300028379 Bacteria 741
399 Ga0268265_10003377 3300028380 Bacteria 11496
400 Ga0268265_10008122 3300028380 Bacteria 7092
401 Ga0268265_10075924 3300028380 Bacteria 2634
402 Ga0268265_11600631 3300028380 Bacteria 656
403 Ga0268264_10312318 3300028381 Bacteria 1483
404 Ga0265324_10051497 3300029957 Bacteria 1415
405 Ga0307511_10000215 3300030521 Bacteria 58294
406 Ga0265329_10123932 3300031242 Bacteria 830
407 Ga0307509_10001123 3300031507 Bacteria 45912
408 Ga0307509_10256662 3300031507 Bacteria 1527
409 Ga0307408_100006991 3300031548 Bacteria 7466
410 Ga0307408_100012156 3300031548 Bacteria 5699
411 Ga0307408_100087196 3300031548 Bacteria 2347
412 Ga0307408_101193692 3300031548 Bacteria 709
413 Ga0307508_10329733 3300031616 Bacteria 1118
414 Ga0265314_10196780 3300031711 Bacteria 1195
415 Ga0307405_10003739 3300031731 Bacteria 7067
416 Ga0307405_10919634 3300031731 Bacteria 741
417 Ga0307405_10975794 3300031731 Bacteria 721
418 Ga0307413_10009306 3300031824 Bacteria 4695
419 Ga0307413_10116196 3300031824 Bacteria 1802
420 Ga0307413_10958666 3300031824 Bacteria 730
421 Ga0307410_10781789 3300031852 Bacteria 810
422 Ga0307406_10037271 3300031901 Bacteria 3002
423 Ga0307406_10046066 3300031901 Bacteria 2742
424 Ga0307406_10094119 3300031901 Bacteria 2024
425 Ga0307406_10682116 3300031901 Bacteria 856
426 Ga0307407_10005388 3300031903 Bacteria 5548
427 Ga0307407_10208747 3300031903 Bacteria 1313
428 Ga0307407_10392100 3300031903 Bacteria 994
429 Ga0307412_10011455 3300031911 Bacteria 5140
430 Ga0307412_10280994 3300031911 Bacteria 1307
431 Ga0307412_10966146 3300031911 Bacteria 751
432 Ga0307409_100001205 3300031995 Bacteria 12423
433 Ga0307409_100336253 3300031995 Bacteria 1419
434 Ga0307409_100526217 3300031995 Bacteria 1156
435 Ga0307416_100004040 3300032002 Bacteria 8764
436 Ga0307416_100073979 3300032002 Bacteria 2844
437 Ga0307416_100406893 3300032002 Bacteria 1400
438 Ga0307416_101243291 3300032002 Bacteria 850
439 Ga0307416_101619709 3300032002 Bacteria 752
440 Ga0307416_102049440 3300032002 Bacteria 674
441 Ga0307414_10142336 3300032004 Bacteria 1879
442 Ga0307414_10270978 3300032004 Bacteria 1422
443 Ga0307414_10274192 3300032004 Bacteria 1414
444 Ga0307411_10006818 3300032005 Bacteria 5753
445 Ga0307411_10064656 3300032005 Bacteria 2450
446 Ga0307411_10070295 3300032005 Bacteria 2368
447 Ga0307411_10193262 3300032005 Bacteria 1556
448 Ga0307411_10353085 3300032005 Bacteria 1199
449 Ga0307415_100047452 3300032126 Bacteria 2891
450 Ga0307415_100053902 3300032126 Bacteria 2743
451 Ga0307415_100270351 3300032126 Bacteria 1392
452 Ga0307415_100454445 3300032126 Bacteria 1108
453 Ga0307415_101353309 3300032126 Bacteria 676
454 Ga0316593_10008463 3300032168 Bacteria 2871
455 Ga0316593_10024772 3300032168 Bacteria 1905
456 Ga0316593_10107335 3300032168 Bacteria 995
457 Ga0373930_0026503 3300034816 Bacteria 1169
458 Ga0373959_0198019 3300034820 Bacteria 529
459 Ga0373934_0302577 3300035086 Bacteria 663
460 Ga0373923_0041732 3300035111 Bacteria 1893
461 Ga0373939_0108354 3300035114 Bacteria 964
462 Ga0373945_0030708 3300035116 Bacteria 1895
463 Ga0373953_0135941 3300035117 Unclassified 1050
464 Ga0373960_0352613 3300035121 Bacteria 558
465 Ga0373943_0421890 3300035170 Bacteria 772
466 Ga0373946_0071800 3300035171 Bacteria 1497
467 Ga0373961_0049328 3300035241 Bacteria 1244
468 Ga0373962_0027562 3300035242 Bacteria 1538
469 Ga0373924_0444762 3300035410 Bacteria 581
470 Ga0373931_0046699 3300035691 Bacteria 2290
471 Ga0373931_0526772 3300035691 Bacteria 765
472 Ga0373933_0264708 3300035724 Bacteria 1109
473 Ga0373933_0641429 3300035724 Unclassified 698
474 Ga0373933_1112097 3300035724 Bacteria 521
475 Ga0373937_0158018 3300036401 Bacteria 2125
476 Ga0316582_0852382 3300036647 Bacteria 624
477 Ga0373925_0048586 3300037068 Bacteria 3162
478 Ga0395905_0212601 3300037471 Bacteria 1812
479 Ga0436364_0354709 3300037853 Bacteria 1060
480 Ga0436365_0110123 3300039437 Bacteria 1474
481 Ga0451853_1279690 3300041512 Bacteria 1088
482 Ga0439442_009291 3300042002 Bacteria 1990
483 Ga0439448_0036230 3300042005 Bacteria 1582
484 Ga0439444_0089287 3300042437 Bacteria 685
485 Ga0439459_0232802 3300042438 Bacteria 514
486 Ga0451577_0089506 3300042876 Bacteria 2747
487 Ga0451577_0325974 3300042876 Bacteria 1393
488 Ga0439440_0036711 3300042993 Bacteria 1180
489 Ga0466969_0378037 3300044656 Bacteria 642
490 Ga0466966_0027827 3300044684 Bacteria 3685
491 Ga0453684_0254771 3300044712 Bacteria 2014
492 Ga0466957_0000290 3300044842 Bacteria 24588
493 Ga0466957_0124796 3300044842 Bacteria 1644
494 Ga0466959_0541202 3300045049 Bacteria 786
495 Ga0451576_0072193 3300045051 Bacteria 3592
496 Ga0451576_0173030 3300045051 Bacteria 2254
497 Ga0466958_0018261 3300045836 Bacteria 4068
498 Ga0466958_0442578 3300045836 Bacteria 841
499 Ga0495603_0342507 3300046455 Bacteria 858
500 Ga0495638_0032636 3300046460 Bacteria 3336
501 Ga0495632_0184381 3300046519 Bacteria 955
502 Ga0495598_0113519 3300046537 Bacteria 911
503 Ga0495621_0002750 3300046539 Bacteria 4775
504 Ga0495661_0000671 3300046665 Bacteria 34227
505 Ga0495669_0452935 3300046684 Bacteria 623
506 Ga0496100_0223288 3300048903 Bacteria 1383
507 Ga0496100_0460194 3300048903 Bacteria 976
508 Ga0496101_0199699 3300048904 Bacteria 1545
509 Ga0496101_0364687 3300048904 Bacteria 1136
510 Ga0496101_0622213 3300048904 Bacteria 853
511 Ga0496102_0002506 3300048905 Bacteria 15672
512 Ga0496102_0800346 3300048905 Bacteria 865
513 Ga0496103_0096220 3300048906 Bacteria 1871
514 Ga0496104_0768320 3300048907 Unclassified 870
515 Ga0496105_0034590 3300048908 Bacteria 4157
516 Ga0496106_0005497 3300048909 Bacteria 9369
517 Ga0496106_0021551 3300048909 Bacteria 4785
518 Ga0496107_0010705 3300048910 Bacteria 6379
519 Ga0496107_0246365 3300048910 Bacteria 1330
520 Ga0496108_0072047 3300048911 Bacteria 2916
521 Ga0496108_0763146 3300048911 Bacteria 836
522 Ga0496109_0029023 3300048912 Bacteria 4952
523 Ga0496109_0106653 3300048912 Bacteria 2602
524 Ga0496109_0322034 3300048912 Bacteria 1459
525 Ga0496110_0019891 3300048913 Bacteria 5658
526 Ga0496110_1253729 3300048913 Bacteria 650
527 Ga0496111_0081515 3300048914 Bacteria 2362
528 Ga0496111_0706374 3300048914 Bacteria 733
529 Ga0496112_0161583 3300048915 Bacteria 2207
530 Ga0496112_0208761 3300048915 Bacteria 1910
531 Ga0496113_0098884 3300048916 Bacteria 2259
532 Ga0496114_0008463 3300048917 Bacteria 8151
533 Ga0496122_0001749 3300048925 Bacteria 33464
534 Ga0496123_0001412 3300048926 Bacteria 33573
535 Ga0496124_0000218 3300048927 Bacteria 112156
536 Ga0496125_0002537 3300048928 Bacteria 23538
537 Ga0501047_0282057 3300049581 Bacteria 1506
538 Ga0501072_0206598 3300049588 Bacteria 1566
539 Ga0501076_0914736 3300049592 Bacteria 723
540 Ga0501076_1491172 3300049592 Bacteria 555
541 Ga0501227_111680 3300049665 Bacteria 733
542 nmdc:mga05p37_195_c1 3300050507 Bacteria 60494
543 nmdc:mga05p37_21481_c1 3300050507 Bacteria 7818
544 nmdc:mga09592_13316_c1 3300050508 Bacteria 6717
545 nmdc:mga09592_154360_c1 3300050508 Bacteria 1982
546 nmdc:mga09592_181419_c1 3300050508 Bacteria 1821
547 nmdc:mga09592_499426_c1 3300050508 Bacteria 1047
548 nmdc:mga09592_82321_c1 3300050508 Bacteria 2743
549 nmdc:mga0qj67_248940_c1 3300050509 Bacteria 1442
550 nmdc:mga0qj67_2724_c1 3300050509 Bacteria 12669
551 nmdc:mga0qj67_397394_c1 3300050509 Bacteria 1112
552 nmdc:mga0qj67_45835_c1 3300050509 Bacteria 3450
553 nmdc:mga0qj67_61473_c1 3300050509 Bacteria 2982
554 nmdc:mga06r32_1545_c1 3300050510 Bacteria 20733
555 nmdc:mga06r32_33031_c1 3300050510 Bacteria 4873
556 nmdc:mga06r32_695400_c1 3300050510 Bacteria 983
557 nmdc:mga08y16_151183_c1 3300050511 Bacteria 2413
558 nmdc:mga08y16_234383_c1 3300050511 Bacteria 1898
559 nmdc:mga08y16_38176_c1 3300050511 Bacteria 5044
560 nmdc:mga08y16_42234_c1 3300050511 Bacteria 4776
561 nmdc:mga08y16_5351_c1 3300050511 Bacteria 13426
562 nmdc:mga0n895_99754_c1 3300050512 Bacteria 2912
563 nmdc:mga08x19_603814_c1 3300050514 Bacteria 778
564 nmdc:mga0a205_206532_c1 3300050515 Bacteria 1853
565 Ga0500646_0000487 3300053090 Bacteria 11657
566 Ga0500583_0003501 3300053092 Bacteria 4946
567 Ga0500583_0064471 3300053092 Bacteria 1737
568 Ga0500650_0070809 3300053098 Bacteria 1630
569 Ga0500642_0045720 3300053130 Bacteria 1912
570 Ga0500642_0134031 3300053130 Bacteria 1161
571 Ga0500652_110326 3300053131 Bacteria 1150
572 Ga0500658_0047232 3300053134 Bacteria 1747
573 Ga0500604_0004422 3300053151 Bacteria 3732
574 Ga0500627_0160582 3300053158 Bacteria 1014
575 Ga0500637_0168960 3300053178 Bacteria 1258
576 Ga0500637_0408108 3300053178 Bacteria 703
577 2515627930 2515154112 Bacteria 8294334
578 2824619208 2824617872 Bacteria 8814715
579 2824628143 2824626560 Bacteria 8813858
580 2824636895 2824635225 Bacteria 8785348
581 2824645721 2824644064 Bacteria 8743947
582 2824715900 2824714736 Bacteria 8717648
583 2824725358 2824723954 Bacteria 8758240
584 2842783269 2842780639 Bacteria 4337790
585 nmdc:mga0k408_356950_c1
586 MBSR1b_contig_9428239
587 JGI25162J39368_1000386
588 JGI25154J39366_1019018
589 JGI25164J39214_1000230
590 JGI25165J46597_1000365
591 Ga0055535_1000890
592 Ga0055535_1004708
593 Ga0055542_1000262
594 Ga0055542_1000335
595 Ga0055529_1000357
596 Ga0055531_10011650
597 Ga0065712_10070808
598 Ga0065715_10113979
599 Ga0065715_10134094
600 Ga0070676_10024865
601 Ga0070676_10050309
602 Ga0070683_100063172
603 Ga0070683_100117852
604 Ga0070690_100000419
605 Ga0070670_100031655
606 Ga0070670_100797746
607 Ga0068869_100050012
608 Ga0068869_100141074
609 Ga0068869_101848146
610 Ga0070666_10056041
611 Ga0070680_100199511
612 Ga0070682_100087163
613 Ga0070682_100284157
614 Ga0068868_100013601
615 Ga0070660_100007435
616 Ga0070660_100040705
617 Ga0070689_100082534
618 Ga0070689_100610960
619 Ga0070691_10089590
620 Ga0070687_100022946
621 Ga0070687_100113130
622 Ga0070687_100292142
623 Ga0070661_100039136
624 Ga0070661_100120159
625 Ga0070668_100004280
626 Ga0070668_100304772
627 Ga0070668_101419435
628 Ga0070669_100028720
629 Ga0070669_100134027
630 Ga0070675_100002893
631 Ga0070675_100061044
632 Ga0070675_100140299
633 Ga0070671_100020448
634 Ga0070671_100067272
635 Ga0070671_100069108
636 Ga0070671_100084905
637 Ga0070674_100155346
638 Ga0070674_100334272
639 Ga0070673_100000142
640 Ga0070673_100017043
641 Ga0070673_100022746
642 Ga0070688_100017658
643 Ga0070688_100133830
644 Ga0070659_100013480
645 Ga0070659_100071799
646 Ga0070659_100247807
647 Ga0070659_100322076
648 Ga0070667_100073280
649 Ga0070667_100762842
650 Ga0070709_10065443
651 Ga0070705_100007496
652 Ga0070700_100019922
653 Ga0070700_100054987
654 Ga0070700_100085329
655 Ga0070700_101277955
656 Ga0070663_100002613
657 Ga0070663_100250377
658 Ga0070663_101419586
659 Ga0070678_100008648
660 Ga0070678_100262192
661 Ga0070678_100289967
662 Ga0070662_100000666
663 Ga0070662_100001384
664 Ga0070662_100009667
665 Ga0070662_100445924
666 Ga0070662_100615246
667 Ga0070681_10093093
668 Ga0070681_10155997
669 Ga0070681_10182172
670 Ga0068867_100006998
671 Ga0070685_10036070
672 Ga0070685_10069229
673 Ga0070699_100901665
674 Ga0070679_100133412
675 Ga0070679_100326233
676 Ga0070684_100028694
677 Ga0070684_100032031
678 Ga0070684_100384911
679 Ga0068853_100053462
680 Ga0068853_100168124
681 Ga0068853_100204095
682 Ga0068853_100595527
683 Ga0068853_100780252
684 Ga0070672_100002609
685 Ga0070672_100002737
686 Ga0070672_100543496
687 Ga0070672_100852015
688 Ga0070686_100000792
689 Ga0070686_100228369
690 Ga0070695_100564636
691 Ga0070693_100040611
692 Ga0070693_100041302
693 Ga0070665_100044623
694 Ga0070665_101515214
695 Ga0070704_100312866
696 Ga0070704_100470055
697 Ga0070704_100757855
698 Ga0068855_100002321
699 Ga0068855_100059887
700 Ga0068855_100060110
701 Ga0070664_100000474
702 Ga0070664_100002371
703 Ga0070664_100121533
704 Ga0070664_100306169
705 Ga0068857_100007890
706 Ga0068857_100211110
707 Ga0068857_100556833
708 Ga0068854_100366662
709 Ga0068856_100000299
710 Ga0068856_100293443
711 Ga0070702_100007570
712 Ga0070702_100019349
713 Ga0068852_100150767
714 Ga0068852_100701489
715 Ga0068852_101096614
716 Ga0068859_100002153
717 Ga0068859_100102118
718 Ga0068859_101556561
719 Ga0068864_100002930
720 Ga0068864_100034582
721 Ga0068864_101517527
722 Ga0068866_10001851
723 Ga0068866_10023114
724 Ga0068861_100000680
725 Ga0068861_100016763
726 Ga0068861_100100768
727 Ga0068861_100563901
728 Ga0068861_100815332
729 Ga0068861_101722743
730 Ga0068851_10004631
731 Ga0068851_10043446
732 Ga0068851_10225165
733 Ga0068870_10007369
734 Ga0068870_10270571
735 Ga0068863_100002901
736 Ga0068863_100919819
737 Ga0068858_100033008
738 Ga0068858_100074620
739 Ga0068858_101135808
740 Ga0068860_100034339
741 Ga0068862_100003998
742 Ga0068862_100069610
743 Ga0068862_100095418
744 Ga0068862_100223134
745 Ga0081539_10330105
746 Ga0075365_10330869
747 Ga0070712_100094282
748 Ga0075366_10320677
749 Ga0097621_100023959
750 Ga0097621_100302327
751 Ga0097621_100359276
752 Ga0097621_101073599
753 Ga0068871_100112817
754 Ga0075428_100006850
755 Ga0075428_100009588
756 Ga0075428_100026486
757 Ga0075430_100020525
758 Ga0075430_100039333
759 Ga0075430_100048950
760 Ga0075430_100306660
761 Ga0075431_100002979
762 Ga0075431_100004291
763 Ga0075431_100284374
764 Ga0075431_101155201
765 Ga0075431_101398925
766 Ga0075433_10485110
767 Ga0075434_100119211
768 Ga0075434_100432844
769 Ga0075429_100010997
770 Ga0075429_100071295
771 Ga0075429_100241913
772 Ga0075429_100287386
773 Ga0068865_100017969
774 Ga0068865_100343817
775 Ga0075436_100651725
776 Ga0097620_100002153
777 Ga0097620_100102116
778 Ga0097620_101556619
779 Ga0111539_10000131
780 Ga0111539_10000516
781 Ga0111539_10160450
782 Ga0111539_10683235
783 Ga0105245_10191375
784 Ga0105247_10040924
785 Ga0114129_10005366
786 Ga0114129_10034218
787 Ga0105243_10018179
788 Ga0105243_10088349
789 Ga0105241_10049207
790 Ga0105248_10002201
791 Ga0105248_10023045
792 Ga0105248_10061680
793 Ga0105238_10408451
794 Ga0105238_10784725
795 Ga0105249_10014221
796 Ga0105249_10017587
797 Ga0105249_11533151
798 Ga0105239_10328242
799 Ga0105239_10408759
800 Ga0105239_10668135
801 Ga0157373_10071415
802 Ga0157373_10101838
803 Ga0157373_11109826
804 Ga0157371_10000210
805 Ga0157371_10150340
806 Ga0157370_10021596
807 Ga0157370_10032315
808 Ga0157370_10064941
809 Ga0157369_10073508
810 Ga0157369_10181293
811 Ga0157369_10270490
812 Ga0157369_10636833
813 Ga0157374_10074510
814 Ga0157374_10543297
815 Ga0157378_10892728
816 Ga0163162_10028636
817 Ga0163162_10177746
818 Ga0163162_10296653
819 Ga0163162_10948672
820 Ga0157372_10020570
821 Ga0157372_10175996
822 Ga0157372_10220005
823 Ga0157372_10222939
824 Ga0157375_10037061
825 Ga0157375_10504440
826 Ga0157375_11603379
827 Ga0157375_11674222
828 Ga0163163_10000924
829 Ga0163163_10177619
830 Ga0157380_10764679
831 Ga0157380_11067595
832 Ga0182008_10159829
833 Ga0157377_10007755
834 Ga0157377_10035504
835 Ga0157377_10583554
836 Ga0157379_10097462
837 Ga0157379_10221532
838 Ga0157379_10321124
839 Ga0157376_10745361
840 Ga0157376_12306398
841 Ga0163161_10299124
842 Ga0213876_10029156
843 Ga0209672_100216
844 Ga0209672_100688
845 Ga0207427_100021
846 Ga0209437_100534
847 Ga0209258_100035
848 Ga0209258_100088
849 Ga0207425_1063453
850 Ga0209646_1000475
851 Ga0209148_1000048
852 Ga0209148_1000214
853 Ga0209759_1000777
854 Ga0209233_1000023
855 Ga0209455_1000184
856 Ga0209758_1002321
857 Ga0209050_1000169
858 Ga0209257_1000287
859 Ga0207697_10000097
860 Ga0207656_10031212
861 Ga0207656_10050282
862 Ga0207682_10004577
863 Ga0207642_10032218
864 Ga0207642_10033111
865 Ga0207680_10056438
866 Ga0207680_10070391
867 Ga0207680_10481166
868 Ga0207645_10001136
869 Ga0207645_10067932
870 Ga0207643_10000178
871 Ga0207643_10045048
872 Ga0207707_10243053
873 Ga0207707_10468405
874 Ga0207695_11305882
875 Ga0207662_10031336
876 Ga0207662_10031354
877 Ga0207662_10741441
878 Ga0207657_10042979
879 Ga0207657_10078951
880 Ga0207657_10108745
881 Ga0207657_11033793
882 Ga0207649_10031015
883 Ga0207649_10057546
884 Ga0207649_10099033
885 Ga0207649_10694136
886 Ga0207652_10264943
887 Ga0207681_10170661
888 Ga0207681_10231130
889 Ga0207681_10278797
890 Ga0207694_10243604
891 Ga0207650_10005398
892 Ga0207650_10041589
893 Ga0207659_10008487
894 Ga0207659_10110410
895 Ga0207687_10315277
896 Ga0207644_10043720
897 Ga0207644_10100002
898 Ga0207644_10270185
899 Ga0207644_10395766
900 Ga0207644_10545779
901 Ga0207644_11139171
902 Ga0207690_10147038
903 Ga0207690_10314457
904 Ga0207690_11189977
905 Ga0207706_10003504
906 Ga0207706_10004967
907 Ga0207706_10015561
908 Ga0207706_10033685
909 Ga0207706_10498924
910 Ga0207709_10552411
911 Ga0207670_10091895
912 Ga0207670_10339260
913 Ga0207669_10261043
914 Ga0207669_10448213
915 Ga0207704_10126338
916 Ga0207691_10005105
917 Ga0207691_10005595
918 Ga0207691_10018388
919 Ga0207691_10703091
920 Ga0207711_10014338
921 Ga0207689_10029648
922 Ga0207689_10090204
923 Ga0207661_10058275
924 Ga0207661_10291841
925 Ga0207679_10001875
926 Ga0207679_10009107
927 Ga0207679_10242981
928 Ga0207667_10028054
929 Ga0207667_10340287
930 Ga0207651_10034270
931 Ga0207651_10055959
932 Ga0207651_10061500
933 Ga0207651_10305947
934 Ga0207712_10049941
935 Ga0207712_10376792
936 Ga0207668_10009298
937 Ga0207668_10467602
938 Ga0207668_11369848
939 Ga0207640_10118601
940 Ga0207658_10115651
941 Ga0207658_10257708
942 Ga0207677_10195176
943 Ga0207703_10024206
944 Ga0207703_10083203
945 Ga0207703_10524616
946 Ga0207639_10009656
947 Ga0207639_10091524
948 Ga0207639_10197170
949 Ga0207678_10003036
950 Ga0207678_11124101
951 Ga0207708_10000668
952 Ga0207708_10032437
953 Ga0207708_10042727
954 Ga0207702_10153783
955 Ga0207641_10003151
956 Ga0207641_10358424
957 Ga0207648_10011410
958 Ga0207648_10055675
959 Ga0207676_10028482
960 Ga0207676_10113957
961 Ga0207674_10010354
962 Ga0207674_10079249
963 Ga0207674_10370491
964 Ga0207675_100001968
965 Ga0207675_100005356
966 Ga0207675_100007725
967 Ga0207675_100680435
968 Ga0207683_10009243
969 Ga0207683_10034137
970 Ga0207698_10107903
971 Ga0207698_11212013
972 Ga0209983_1007989
973 Ga0209971_1005514
974 Ga0209971_1024226
975 Ga0209998_10015952
976 Ga0209974_10009279
977 Ga0209974_10017554
978 Ga0207428_10039767
979 Ga0207428_10089626
980 Ga0207428_10142858
981 Ga0268266_10041763
982 Ga0268266_11176917
983 Ga0268265_10003377
984 Ga0268265_10008122
985 Ga0268265_10075924
986 Ga0268265_11600631
987 Ga0268264_10312318
988 Ga0265324_10051497
989 Ga0307511_10000215
990 Ga0265329_10123932
991 Ga0307509_10001123
992 Ga0307509_10256662
993 Ga0307408_100006991
994 Ga0307408_100012156
995 Ga0307408_100087196
996 Ga0307408_101193692
997 Ga0307508_10329733
998 Ga0265314_10196780
999 Ga0307405_10003739
1000 Ga0307405_10919634
1001 Ga0307405_10975794
1002 Ga0307413_10009306
1003 Ga0307413_10116196
1004 Ga0307413_10958666
1005 Ga0307410_10781789
1006 Ga0307406_10037271
1007 Ga0307406_10046066
1008 Ga0307406_10094119
1009 Ga0307406_10682116
1010 Ga0307407_10005388
1011 Ga0307407_10208747
1012 Ga0307407_10392100
1013 Ga0307412_10011455
1014 Ga0307412_10280994
1015 Ga0307412_10966146
1016 Ga0307409_100001205
1017 Ga0307409_100336253
1018 Ga0307409_100526217
1019 Ga0307416_100004040
1020 Ga0307416_100073979
1021 Ga0307416_100406893
1022 Ga0307416_101243291
1023 Ga0307416_101619709
1024 Ga0307416_102049440
1025 Ga0307414_10142336
1026 Ga0307414_10270978
1027 Ga0307414_10274192
1028 Ga0307411_10006818
1029 Ga0307411_10064656
1030 Ga0307411_10070295
1031 Ga0307411_10193262
1032 Ga0307411_10353085
1033 Ga0307415_100047452
1034 Ga0307415_100053902
1035 Ga0307415_100270351
1036 Ga0307415_100454445
1037 Ga0307415_101353309
1038 Ga0316593_10008463
1039 Ga0316593_10024772
1040 Ga0316593_10107335
1041 Ga0373930_0026503
1042 Ga0373959_0198019
1043 Ga0373934_0302577
1044 Ga0373923_0041732
1045 Ga0373939_0108354
1046 Ga0373945_0030708
1047 Ga0373953_0135941
1048 Ga0373960_0352613
1049 Ga0373943_0421890
1050 Ga0373946_0071800
1051 Ga0373961_0049328
1052 Ga0373962_0027562
1053 Ga0373924_0444762
1054 Ga0373931_0046699
1055 Ga0373931_0526772
1056 Ga0373933_0264708
1057 Ga0373933_0641429
1058 Ga0373933_1112097
1059 Ga0373937_0158018
1060 Ga0316582_0852382
1061 Ga0373925_0048586
1062 Ga0395905_0212601
1063 Ga0436364_0354709
1064 Ga0436365_0110123
1065 Ga0451853_1279690
1066 Ga0439442_009291
1067 Ga0439448_0036230
1068 Ga0439444_0089287
1069 Ga0439459_0232802
1070 Ga0451577_0089506
1071 Ga0451577_0325974
1072 Ga0439440_0036711
1073 Ga0466969_0378037
1074 Ga0466966_0027827
1075 Ga0453684_0254771
1076 Ga0466957_0000290
1077 Ga0466957_0124796
1078 Ga0466959_0541202
1079 Ga0451576_0072193
1080 Ga0451576_0173030
1081 Ga0466958_0018261
1082 Ga0466958_0442578
1083 Ga0495603_0342507
1084 Ga0495638_0032636
1085 Ga0495632_0184381
1086 Ga0495598_0113519
1087 Ga0495621_0002750
1088 Ga0495661_0000671
1089 Ga0495669_0452935
1090 Ga0496100_0223288
1091 Ga0496100_0460194
1092 Ga0496101_0199699
1093 Ga0496101_0364687
1094 Ga0496101_0622213
1095 Ga0496102_0002506
1096 Ga0496102_0800346
1097 Ga0496103_0096220
1098 Ga0496104_0768320
1099 Ga0496105_0034590
1100 Ga0496106_0005497
1101 Ga0496106_0021551
1102 Ga0496107_0010705
1103 Ga0496107_0246365
1104 Ga0496108_0072047
1105 Ga0496108_0763146
1106 Ga0496109_0029023
1107 Ga0496109_0106653
1108 Ga0496109_0322034
1109 Ga0496110_0019891
1110 Ga0496110_1253729
1111 Ga0496111_0081515
1112 Ga0496111_0706374
1113 Ga0496112_0161583
1114 Ga0496112_0208761
1115 Ga0496113_0098884
1116 Ga0496114_0008463
1117 Ga0496122_0001749
1118 Ga0496123_0001412
1119 Ga0496124_0000218
1120 Ga0496125_0002537
1121 Ga0501047_0282057
1122 Ga0501072_0206598
1123 Ga0501076_0914736
1124 Ga0501076_1491172
1125 Ga0501227_111680
1126 nmdc:mga05p37_195_c1
1127 nmdc:mga05p37_21481_c1
1128 nmdc:mga09592_13316_c1
1129 nmdc:mga09592_154360_c1
1130 nmdc:mga09592_181419_c1
1131 nmdc:mga09592_499426_c1
1132 nmdc:mga09592_82321_c1
1133 nmdc:mga0qj67_248940_c1
1134 nmdc:mga0qj67_2724_c1
1135 nmdc:mga0qj67_397394_c1
1136 nmdc:mga0qj67_45835_c1
1137 nmdc:mga0qj67_61473_c1
1138 nmdc:mga06r32_1545_c1
1139 nmdc:mga06r32_33031_c1
1140 nmdc:mga06r32_695400_c1
1141 nmdc:mga08y16_151183_c1
1142 nmdc:mga08y16_234383_c1
1143 nmdc:mga08y16_38176_c1
1144 nmdc:mga08y16_42234_c1
1145 nmdc:mga08y16_5351_c1
1146 nmdc:mga0n895_99754_c1
1147 nmdc:mga08x19_603814_c1
1148 nmdc:mga0a205_206532_c1
1149 Ga0500646_0000487
1150 Ga0500583_0003501
1151 Ga0500583_0064471
1152 Ga0500650_0070809
1153 Ga0500642_0045720
1154 Ga0500642_0134031
1155 Ga0500652_110326
1156 Ga0500658_0047232
1157 Ga0500604_0004422
1158 Ga0500627_0160582
1159 Ga0500637_0168960
1160 Ga0500637_0408108
1161 2515627930
1162 2824619208
1163 2824628143
1164 2824636895
1165 2824645721
1166 2824715900
1167 2824725358
1168 2842783269

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00085

Thioredoxin

Thioredoxin

66

168

0.97

PF21352

Thio2_N

Thioredoxin 2, N-terminal

34

60

0.96

PF13098

Thioredoxin_2

Thioredoxin-like domain

79

166

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hd5-assembly1.cif.gz_B crystal structure of a thiol:disulfide interchange protein dsba from bordetella parapertussis 0.9707 80 117
4xhm-assembly2.cif.gz_B archaeoglobus fulgidus thioredoxin 3 m60h 0.9633 63 165
7ool-assembly2.cif.gz_B crystal structure of a candidatus photodesmus katoptron thioredoxin chimera containing an ancestral loop 0.9625 64 165
5hr1-assembly7.cif.gz_G crystal structure of thioredoxin l107a mutant 0.9615 88 162
1nw2-assembly2.cif.gz_F the crystal structure of the mutant r82e of thioredoxin from alicyclobacillus acidocaldarius 0.9614 65 165
ID Description Score Start End Superfamily
2pptB01 Mainly Beta;Roll;SH3 type barrels.;Zn-finger domain of Sec23/24 0.9783 27 60 2.30.30.380
5hr1G00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9615 88 162 3.40.30.10
af_Q8LD49_56_177_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9606 63 165 3.40.30.10
3hd5C01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.959 80 117 3.40.30.10
2pptB02 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9577 64 165 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A2W4K671-F1-model_v4 Thioredoxin 0.9852 30 165 GO:0005829
GO:0015035
GO:0045454
AF-A0A7S8FAN9-F1-model_v4 Thioredoxin 0.9847 28 165 GO:0005829
GO:0015035
GO:0045454
AF-A0A661E3I6-F1-model_v4 Thioredoxin 0.9838 27 166 GO:0005829
GO:0015035
GO:0045454
AF-A0A1I5U9X3-F1-model_v4 Thioredoxin 0.9838 61 165 GO:0005829
GO:0015035
GO:0045454
AF-A0A1F4D8I7-F1-model_v4 Thioredoxin 0.9825 26 167 GO:0005829
GO:0015035
GO:0045454

Map