F466377
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 278 | 1168 | 113 |
Family's Representative Sequence
| Representative Sequence | 3300035170|Ga0373943_0581262|Ga0373943_0581262_232_603 |
| Length | 123 |
| Sequence | LPAPGAGKVKIEGEGKLLRIFVGESDRWHGKPLYQAIVERVRKEGLAGATVIRGIEGFGADSRLHTARILRLSEDLPVLIEIVDSAEQIERILPVLDEMVGEGMVTVERVEVIAYRGSAEPPA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 2 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 9 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 17 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 46 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 62 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 63 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 87 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 129 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 130 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 131 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 132 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 133 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 135 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 136 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 137 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 138 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 139 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 141 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 142 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 143 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 144 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 145 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 146 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 147 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 148 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 149 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 150 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 152 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 153 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 154 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 156 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 157 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 158 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 159 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 160 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 161 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 163 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 164 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 165 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 170 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 171 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 172 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 173 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 174 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 175 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 176 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 177 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 178 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 179 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 180 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 181 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 182 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 183 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 186 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 187 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 188 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 189 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 190 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 245 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 246 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 249 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 251 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 252 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 253 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 256 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 257 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 278 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.66 |
| Metatranscriptomes | 0.34 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.34 |
| Nodule | 0 |
| Rhizoplane | 8.9 |
| Rhizosphere | 90.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 11.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0373943_0581262 | 3300035170 | Unclassified | 659 |
| 2 | JGI24746J21847_1056351 | 3300001977 | Bacteria | 558 |
| 3 | JGI24739J22299_10081163 | 3300001989 | Bacteria | 996 |
| 4 | JGI24738J21930_10046437 | 3300002075 | Unclassified | 884 |
| 5 | JGI24744J21845_10022103 | 3300002077 | Unclassified | 1250 |
| 6 | JGI24742J22300_10018062 | 3300002244 | Bacteria | 1195 |
| 7 | JGI24751J29686_10067669 | 3300002459 | Unclassified | 735 |
| 8 | rootL2_10222519 | 3300003322 | Unclassified | 1121 |
| 9 | rootH1_10082901 | 3300003323 | Bacteria | 1687 |
| 10 | Ga0070658_10025348 | 3300005327 | Bacteria | 4755 |
| 11 | Ga0070658_10034961 | 3300005327 | Bacteria | 4045 |
| 12 | Ga0070658_10072353 | 3300005327 | Bacteria | 2825 |
| 13 | Ga0070658_11078098 | 3300005327 | Bacteria | 699 |
| 14 | Ga0070676_10340896 | 3300005328 | Bacteria | 1028 |
| 15 | Ga0070683_100020638 | 3300005329 | Bacteria | 5864 |
| 16 | Ga0070683_100056584 | 3300005329 | Bacteria | 3642 |
| 17 | Ga0070683_100279505 | 3300005329 | Bacteria | 1588 |
| 18 | Ga0070683_100282635 | 3300005329 | Bacteria | 1578 |
| 19 | Ga0070683_101411319 | 3300005329 | Bacteria | 669 |
| 20 | Ga0070666_10374062 | 3300005335 | Bacteria | 1022 |
| 21 | Ga0070680_100046229 | 3300005336 | Bacteria | 3540 |
| 22 | Ga0070680_100227411 | 3300005336 | Bacteria | 1575 |
| 23 | Ga0070682_100001777 | 3300005337 | Bacteria | 12023 |
| 24 | Ga0070682_100111523 | 3300005337 | Bacteria | 1824 |
| 25 | Ga0070682_100710191 | 3300005337 | Bacteria | 807 |
| 26 | Ga0068868_101437085 | 3300005338 | Bacteria | 644 |
| 27 | Ga0070660_100001667 | 3300005339 | Bacteria | 15251 |
| 28 | Ga0070660_100048434 | 3300005339 | Bacteria | 3264 |
| 29 | Ga0070691_10030216 | 3300005341 | Bacteria | 2537 |
| 30 | Ga0070691_10132846 | 3300005341 | Bacteria | 1263 |
| 31 | Ga0070661_100005154 | 3300005344 | Bacteria | 8997 |
| 32 | Ga0070661_100145927 | 3300005344 | Bacteria | 1786 |
| 33 | Ga0070669_100529186 | 3300005353 | Bacteria | 981 |
| 34 | Ga0070675_100010398 | 3300005354 | Bacteria | 7268 |
| 35 | Ga0070674_100090866 | 3300005356 | Bacteria | 2203 |
| 36 | Ga0070673_100097751 | 3300005364 | Bacteria | 2411 |
| 37 | Ga0070659_100053595 | 3300005366 | Bacteria | 3175 |
| 38 | Ga0070667_100884313 | 3300005367 | Unclassified | 831 |
| 39 | Ga0070709_10069714 | 3300005434 | Bacteria | 2265 |
| 40 | Ga0070714_100001084 | 3300005435 | Bacteria | 19467 |
| 41 | Ga0070714_100122887 | 3300005435 | Bacteria | 2311 |
| 42 | Ga0070714_100187219 | 3300005435 | Bacteria | 1887 |
| 43 | Ga0070714_100578068 | 3300005435 | Bacteria | 1077 |
| 44 | Ga0070714_100809736 | 3300005435 | Bacteria | 907 |
| 45 | Ga0070713_100068651 | 3300005436 | Bacteria | 2987 |
| 46 | Ga0070713_100174140 | 3300005436 | Bacteria | 1929 |
| 47 | Ga0070713_100191971 | 3300005436 | Bacteria | 1841 |
| 48 | Ga0070710_10002369 | 3300005437 | Bacteria | 8922 |
| 49 | Ga0070710_10010592 | 3300005437 | Bacteria | 4532 |
| 50 | Ga0070710_10561056 | 3300005437 | Bacteria | 790 |
| 51 | Ga0070701_10132412 | 3300005438 | Bacteria | 1418 |
| 52 | Ga0070711_100629175 | 3300005439 | Unclassified | 898 |
| 53 | Ga0070705_100229287 | 3300005440 | Unclassified | 1291 |
| 54 | Ga0070700_100460341 | 3300005441 | Bacteria | 970 |
| 55 | Ga0070708_100003821 | 3300005445 | Bacteria | 11819 |
| 56 | Ga0070708_100006095 | 3300005445 | Bacteria | 9595 |
| 57 | Ga0070708_100376852 | 3300005445 | Bacteria | 1338 |
| 58 | Ga0070708_100565617 | 3300005445 | Bacteria | 1072 |
| 59 | Ga0070678_100005901 | 3300005456 | Bacteria | 7121 |
| 60 | Ga0070678_101198291 | 3300005456 | Bacteria | 704 |
| 61 | Ga0070662_100027799 | 3300005457 | Bacteria | 3931 |
| 62 | Ga0070681_10105612 | 3300005458 | Bacteria | 2758 |
| 63 | Ga0070706_100003177 | 3300005467 | Bacteria | 16222 |
| 64 | Ga0070706_100048569 | 3300005467 | Bacteria | 3916 |
| 65 | Ga0070706_100092971 | 3300005467 | Bacteria | 2798 |
| 66 | Ga0070706_101522081 | 3300005467 | Unclassified | 611 |
| 67 | Ga0070706_101532232 | 3300005467 | Unclassified | 609 |
| 68 | Ga0070707_100005238 | 3300005468 | Bacteria | 12134 |
| 69 | Ga0070707_100634630 | 3300005468 | Bacteria | 1031 |
| 70 | Ga0070707_101127035 | 3300005468 | Bacteria | 750 |
| 71 | Ga0070698_100559570 | 3300005471 | Bacteria | 1083 |
| 72 | Ga0070699_100042211 | 3300005518 | Bacteria | 3946 |
| 73 | Ga0070679_100260126 | 3300005530 | Bacteria | 1691 |
| 74 | Ga0070679_100301259 | 3300005530 | Bacteria | 1553 |
| 75 | Ga0070679_100340311 | 3300005530 | Bacteria | 1448 |
| 76 | Ga0070684_100018603 | 3300005535 | Bacteria | 5728 |
| 77 | Ga0070684_100021102 | 3300005535 | Bacteria | 5412 |
| 78 | Ga0070684_100192086 | 3300005535 | Unclassified | 1858 |
| 79 | Ga0070684_100934005 | 3300005535 | Bacteria | 813 |
| 80 | Ga0070697_101242417 | 3300005536 | Bacteria | 664 |
| 81 | Ga0068853_100004196 | 3300005539 | Bacteria | 11115 |
| 82 | Ga0068853_102014412 | 3300005539 | Bacteria | 560 |
| 83 | Ga0070695_100932745 | 3300005545 | Bacteria | 703 |
| 84 | Ga0070693_100022228 | 3300005547 | Bacteria | 3369 |
| 85 | Ga0070693_100118814 | 3300005547 | Bacteria | 1637 |
| 86 | Ga0068855_100046564 | 3300005563 | Bacteria | 5126 |
| 87 | Ga0068855_100626506 | 3300005563 | Bacteria | 1158 |
| 88 | Ga0068857_100785189 | 3300005577 | Bacteria | 909 |
| 89 | Ga0068856_100046444 | 3300005614 | Bacteria | 4277 |
| 90 | Ga0068856_100063637 | 3300005614 | Bacteria | 3644 |
| 91 | Ga0068856_100195891 | 3300005614 | Bacteria | 2034 |
| 92 | Ga0070702_100012411 | 3300005615 | Bacteria | 4269 |
| 93 | Ga0070702_100835118 | 3300005615 | Unclassified | 716 |
| 94 | Ga0068852_100218638 | 3300005616 | Bacteria | 1811 |
| 95 | Ga0068864_100708591 | 3300005618 | Bacteria | 984 |
| 96 | Ga0068861_100801923 | 3300005719 | Bacteria | 884 |
| 97 | Ga0068863_100064638 | 3300005841 | Bacteria | 3460 |
| 98 | Ga0070717_10008478 | 3300006028 | Bacteria | 7677 |
| 99 | Ga0070717_10022452 | 3300006028 | Bacteria | 4986 |
| 100 | Ga0070717_10033324 | 3300006028 | Bacteria | 4156 |
| 101 | Ga0070717_11443819 | 3300006028 | Bacteria | 624 |
| 102 | Ga0075364_10060448 | 3300006051 | Bacteria | 2485 |
| 103 | Ga0070716_100166880 | 3300006173 | Bacteria | 1432 |
| 104 | Ga0070712_100071321 | 3300006175 | Bacteria | 2485 |
| 105 | Ga0070712_101219126 | 3300006175 | Bacteria | 655 |
| 106 | Ga0068865_100725637 | 3300006881 | Bacteria | 851 |
| 107 | Ga0075436_100252464 | 3300006914 | Unclassified | 1256 |
| 108 | Ga0075435_100033009 | 3300007076 | Bacteria | 4090 |
| 109 | Ga0075435_101727951 | 3300007076 | Unclassified | 549 |
| 110 | Ga0105240_10047426 | 3300009093 | Bacteria | 5436 |
| 111 | Ga0105240_10286390 | 3300009093 | Bacteria | 1891 |
| 112 | Ga0105240_11415239 | 3300009093 | Bacteria | 731 |
| 113 | Ga0105245_10133547 | 3300009098 | Bacteria | 2330 |
| 114 | Ga0105245_10259688 | 3300009098 | Bacteria | 1690 |
| 115 | Ga0105245_10504591 | 3300009098 | Bacteria | 1226 |
| 116 | Ga0105245_12597904 | 3300009098 | Bacteria | 560 |
| 117 | Ga0105243_11114334 | 3300009148 | Bacteria | 798 |
| 118 | Ga0105242_10002465 | 3300009176 | Bacteria | 14522 |
| 119 | Ga0105248_10139561 | 3300009177 | Bacteria | 2734 |
| 120 | Ga0105237_11343631 | 3300009545 | Bacteria | 721 |
| 121 | Ga0105238_10078199 | 3300009551 | Bacteria | 3299 |
| 122 | Ga0105238_12429870 | 3300009551 | Bacteria | 560 |
| 123 | Ga0105249_11435644 | 3300009553 | Bacteria | 762 |
| 124 | Ga0105239_10049506 | 3300010375 | Bacteria | 4608 |
| 125 | Ga0105239_10362992 | 3300010375 | Bacteria | 1636 |
| 126 | Ga0105246_10220955 | 3300011119 | Bacteria | 1485 |
| 127 | Ga0157371_10003757 | 3300013102 | Bacteria | 13588 |
| 128 | Ga0157370_10064913 | 3300013104 | Bacteria | 3454 |
| 129 | Ga0157370_10175761 | 3300013104 | Bacteria | 1990 |
| 130 | Ga0157370_11602700 | 3300013104 | Bacteria | 585 |
| 131 | Ga0157369_10004049 | 3300013105 | Bacteria | 17368 |
| 132 | Ga0157369_10005636 | 3300013105 | Bacteria | 14546 |
| 133 | Ga0157369_10057858 | 3300013105 | Bacteria | 4181 |
| 134 | Ga0157369_10424013 | 3300013105 | Bacteria | 1379 |
| 135 | Ga0157374_10092619 | 3300013296 | Bacteria | 2884 |
| 136 | Ga0157374_10251669 | 3300013296 | Bacteria | 1739 |
| 137 | Ga0157374_11161348 | 3300013296 | Bacteria | 793 |
| 138 | Ga0157378_10265593 | 3300013297 | Bacteria | 1648 |
| 139 | Ga0157372_10174350 | 3300013307 | Bacteria | 2489 |
| 140 | Ga0157372_10683535 | 3300013307 | Bacteria | 1195 |
| 141 | Ga0163163_10222868 | 3300014325 | Bacteria | 1935 |
| 142 | Ga0163163_10514677 | 3300014325 | Bacteria | 1259 |
| 143 | Ga0157380_11351325 | 3300014326 | Bacteria | 761 |
| 144 | Ga0182008_10240795 | 3300014497 | Bacteria | 931 |
| 145 | Ga0182008_10451297 | 3300014497 | Unclassified | 699 |
| 146 | Ga0157377_10644330 | 3300014745 | Bacteria | 762 |
| 147 | Ga0157376_10100171 | 3300014969 | Bacteria | 2529 |
| 148 | Ga0182007_10215731 | 3300015262 | Bacteria | 676 |
| 149 | Ga0163161_11544454 | 3300017792 | Bacteria | 584 |
| 150 | Ga0206356_11138035 | 3300020070 | Bacteria | 555 |
| 151 | Ga0206353_11109881 | 3300020082 | Bacteria | 1900 |
| 152 | Ga0207692_10006084 | 3300025898 | Bacteria | 4881 |
| 153 | Ga0207692_10094975 | 3300025898 | Bacteria | 1625 |
| 154 | Ga0207692_10135079 | 3300025898 | Bacteria | 1397 |
| 155 | Ga0207680_10513643 | 3300025903 | Bacteria | 854 |
| 156 | Ga0207699_10297779 | 3300025906 | Bacteria | 1126 |
| 157 | Ga0207699_10388100 | 3300025906 | Bacteria | 992 |
| 158 | Ga0207699_10422622 | 3300025906 | Bacteria | 952 |
| 159 | Ga0207705_10051423 | 3300025909 | Bacteria | 2965 |
| 160 | Ga0207705_10194384 | 3300025909 | Bacteria | 1535 |
| 161 | Ga0207705_10255317 | 3300025909 | Bacteria | 1337 |
| 162 | Ga0207705_10334827 | 3300025909 | Bacteria | 1164 |
| 163 | Ga0207684_10003165 | 3300025910 | Bacteria | 16190 |
| 164 | Ga0207684_10871270 | 3300025910 | Bacteria | 758 |
| 165 | Ga0207684_11402588 | 3300025910 | Unclassified | 572 |
| 166 | Ga0207707_10271357 | 3300025912 | Bacteria | 1470 |
| 167 | Ga0207695_11556293 | 3300025913 | Unclassified | 542 |
| 168 | Ga0207693_10008397 | 3300025915 | Bacteria | 8449 |
| 169 | Ga0207663_10013008 | 3300025916 | Bacteria | 4512 |
| 170 | Ga0207660_10183966 | 3300025917 | Bacteria | 1624 |
| 171 | Ga0207660_11441222 | 3300025917 | Bacteria | 557 |
| 172 | Ga0207657_10014505 | 3300025919 | Bacteria | 7685 |
| 173 | Ga0207649_10212791 | 3300025920 | Bacteria | 1372 |
| 174 | Ga0207652_10536487 | 3300025921 | Bacteria | 1052 |
| 175 | Ga0207652_10596123 | 3300025921 | Bacteria | 991 |
| 176 | Ga0207652_11714794 | 3300025921 | Bacteria | 533 |
| 177 | Ga0207646_10077956 | 3300025922 | Unclassified | 2961 |
| 178 | Ga0207694_10102522 | 3300025924 | Bacteria | 2269 |
| 179 | Ga0207694_10898214 | 3300025924 | Bacteria | 749 |
| 180 | Ga0207687_10029148 | 3300025927 | Bacteria | 3711 |
| 181 | Ga0207700_10005417 | 3300025928 | Bacteria | 7631 |
| 182 | Ga0207700_10040824 | 3300025928 | Bacteria | 3389 |
| 183 | Ga0207664_10034034 | 3300025929 | Bacteria | 3921 |
| 184 | Ga0207664_10192035 | 3300025929 | Bacteria | 1758 |
| 185 | Ga0207664_10266567 | 3300025929 | Bacteria | 1499 |
| 186 | Ga0207664_10393757 | 3300025929 | Bacteria | 1231 |
| 187 | Ga0207690_10013235 | 3300025932 | Bacteria | 4953 |
| 188 | Ga0207690_10066178 | 3300025932 | Bacteria | 2474 |
| 189 | Ga0207706_10005943 | 3300025933 | Bacteria | 11353 |
| 190 | Ga0207686_10010949 | 3300025934 | Bacteria | 4947 |
| 191 | Ga0207709_10148055 | 3300025935 | Bacteria | 1623 |
| 192 | Ga0207669_10338826 | 3300025937 | Bacteria | 1157 |
| 193 | Ga0207704_10399442 | 3300025938 | Bacteria | 1084 |
| 194 | Ga0207665_10081749 | 3300025939 | Bacteria | 2225 |
| 195 | Ga0207711_10430420 | 3300025941 | Bacteria | 1228 |
| 196 | Ga0207689_10119513 | 3300025942 | Bacteria | 2168 |
| 197 | Ga0207661_10021882 | 3300025944 | Bacteria | 4800 |
| 198 | Ga0207661_10085383 | 3300025944 | Bacteria | 2616 |
| 199 | Ga0207661_10099039 | 3300025944 | Bacteria | 2444 |
| 200 | Ga0207661_10357645 | 3300025944 | Bacteria | 1318 |
| 201 | Ga0207661_10490939 | 3300025944 | Bacteria | 1122 |
| 202 | Ga0207679_10734249 | 3300025945 | Bacteria | 897 |
| 203 | Ga0207667_10128179 | 3300025949 | Bacteria | 2614 |
| 204 | Ga0207667_10571068 | 3300025949 | Bacteria | 1142 |
| 205 | Ga0207712_10945270 | 3300025961 | Bacteria | 763 |
| 206 | Ga0207640_10490020 | 3300025981 | Bacteria | 1021 |
| 207 | Ga0207677_11401554 | 3300026023 | Bacteria | 644 |
| 208 | Ga0207639_10146371 | 3300026041 | Bacteria | 1974 |
| 209 | Ga0207708_10292205 | 3300026075 | Bacteria | 1323 |
| 210 | Ga0207702_10092963 | 3300026078 | Bacteria | 2644 |
| 211 | Ga0207648_10147560 | 3300026089 | Bacteria | 2075 |
| 212 | Ga0207674_10319859 | 3300026116 | Bacteria | 1501 |
| 213 | Ga0207683_10013282 | 3300026121 | Bacteria | 7021 |
| 214 | Ga0207698_10109302 | 3300026142 | Bacteria | 2313 |
| 215 | Ga0265337_1003753 | 3300028556 | Bacteria | 6480 |
| 216 | Ga0265337_1013098 | 3300028556 | Bacteria | 2798 |
| 217 | Ga0265326_10000698 | 3300028558 | Bacteria | 12443 |
| 218 | Ga0265326_10007464 | 3300028558 | Bacteria | 3353 |
| 219 | Ga0265326_10027996 | 3300028558 | Bacteria | 1606 |
| 220 | Ga0265319_1000067 | 3300028563 | Bacteria | 82947 |
| 221 | Ga0265319_1000408 | 3300028563 | Bacteria | 30993 |
| 222 | Ga0265319_1002042 | 3300028563 | Bacteria | 11359 |
| 223 | Ga0265319_1012536 | 3300028563 | Bacteria | 3424 |
| 224 | Ga0265319_1053723 | 3300028563 | Bacteria | 1323 |
| 225 | Ga0265319_1256639 | 3300028563 | Bacteria | 532 |
| 226 | Ga0265334_10007750 | 3300028573 | Bacteria | 4598 |
| 227 | Ga0265334_10032888 | 3300028573 | Bacteria | 2066 |
| 228 | Ga0265318_10006922 | 3300028577 | Bacteria | 5170 |
| 229 | Ga0265318_10012770 | 3300028577 | Unclassified | 3563 |
| 230 | Ga0265318_10148189 | 3300028577 | Unclassified | 861 |
| 231 | Ga0265323_10000491 | 3300028653 | Bacteria | 22283 |
| 232 | Ga0265322_10000759 | 3300028654 | Bacteria | 11705 |
| 233 | Ga0265322_10043357 | 3300028654 | Bacteria | 1281 |
| 234 | Ga0265336_10000067 | 3300028666 | Bacteria | 93268 |
| 235 | Ga0265336_10118795 | 3300028666 | Bacteria | 787 |
| 236 | Ga0265338_10000126 | 3300028800 | Bacteria | 140495 |
| 237 | Ga0265338_10009097 | 3300028800 | Bacteria | 11937 |
| 238 | Ga0265338_10009434 | 3300028800 | Bacteria | 11631 |
| 239 | Ga0265338_10011608 | 3300028800 | Bacteria | 10152 |
| 240 | Ga0265338_10014199 | 3300028800 | Bacteria | 8894 |
| 241 | Ga0265338_10024476 | 3300028800 | Bacteria | 6167 |
| 242 | Ga0265338_10518331 | 3300028800 | Unclassified | 838 |
| 243 | Ga0265338_10627927 | 3300028800 | Bacteria | 746 |
| 244 | Ga0265324_10002147 | 3300029957 | Bacteria | 10356 |
| 245 | Ga0265324_10008640 | 3300029957 | Bacteria | 4031 |
| 246 | Ga0265324_10053614 | 3300029957 | Bacteria | 1384 |
| 247 | Ga0265324_10283562 | 3300029957 | Bacteria | 563 |
| 248 | Ga0265330_10000150 | 3300031235 | Bacteria | 56333 |
| 249 | Ga0265332_10000306 | 3300031238 | Bacteria | 37911 |
| 250 | Ga0265328_10008178 | 3300031239 | Bacteria | 4327 |
| 251 | Ga0265320_10000275 | 3300031240 | Bacteria | 42230 |
| 252 | Ga0265320_10005196 | 3300031240 | Bacteria | 8399 |
| 253 | Ga0265320_10193903 | 3300031240 | Unclassified | 908 |
| 254 | Ga0265325_10005197 | 3300031241 | Bacteria | 8087 |
| 255 | Ga0265325_10123670 | 3300031241 | Bacteria | 1244 |
| 256 | Ga0265329_10000181 | 3300031242 | Bacteria | 32113 |
| 257 | Ga0265329_10043569 | 3300031242 | Bacteria | 1435 |
| 258 | Ga0265340_10008924 | 3300031247 | Bacteria | 5401 |
| 259 | Ga0265340_10029483 | 3300031247 | Bacteria | 2755 |
| 260 | Ga0265339_10000097 | 3300031249 | Bacteria | 73931 |
| 261 | Ga0265339_10056040 | 3300031249 | Bacteria | 2136 |
| 262 | Ga0265331_10000322 | 3300031250 | Bacteria | 51785 |
| 263 | Ga0265331_10193979 | 3300031250 | Unclassified | 916 |
| 264 | Ga0265316_10001497 | 3300031344 | Bacteria | 25056 |
| 265 | Ga0265316_10002531 | 3300031344 | Bacteria | 18899 |
| 266 | Ga0265316_10221143 | 3300031344 | Bacteria | 1397 |
| 267 | Ga0265313_10001271 | 3300031595 | Bacteria | 23915 |
| 268 | Ga0265313_10049400 | 3300031595 | Bacteria | 2024 |
| 269 | Ga0265314_10000337 | 3300031711 | Bacteria | 65738 |
| 270 | Ga0265342_10000999 | 3300031712 | Bacteria | 27871 |
| 271 | Ga0265342_10001401 | 3300031712 | Bacteria | 22534 |
| 272 | Ga0316578_10020473 | 3300031728 | Bacteria | 3656 |
| 273 | Ga0316578_10430808 | 3300031728 | Unclassified | 780 |
| 274 | Ga0307415_100242864 | 3300032126 | Bacteria | 1458 |
| 275 | Ga0316580_10290121 | 3300032139 | Unclassified | 508 |
| 276 | Ga0373956_0585789 | 3300035119 | Unclassified | 532 |
| 277 | Ga0373957_0125300 | 3300035120 | Unclassified | 1042 |
| 278 | Ga0373943_0697530 | 3300035170 | Bacteria | 601 |
| 279 | Ga0373955_0584515 | 3300035172 | Bacteria | 684 |
| 280 | Ga0316574_0031411 | 3300035398 | Bacteria | 3222 |
| 281 | Ga0316574_0227821 | 3300035398 | Bacteria | 1193 |
| 282 | Ga0373935_0789371 | 3300035692 | Bacteria | 701 |
| 283 | Ga0373933_0608401 | 3300035724 | Bacteria | 718 |
| 284 | Ga0373933_0625578 | 3300035724 | Bacteria | 707 |
| 285 | Ga0373933_0851959 | 3300035724 | Unclassified | 600 |
| 286 | Ga0373947_1216977 | 3300035725 | Bacteria | 513 |
| 287 | Ga0373937_0020040 | 3300036401 | Bacteria | 5991 |
| 288 | Ga0373937_0917015 | 3300036401 | Bacteria | 825 |
| 289 | Ga0316582_0224388 | 3300036647 | Bacteria | 1285 |
| 290 | Ga0316584_0089118 | 3300036712 | Bacteria | 2310 |
| 291 | Ga0373925_0252810 | 3300037068 | Bacteria | 1414 |
| 292 | Ga0373925_1555015 | 3300037068 | Bacteria | 541 |
| 293 | Ga0373925_1702713 | 3300037068 | Unclassified | 515 |
| 294 | Ga0395899_0352103 | 3300037312 | Bacteria | 985 |
| 295 | Ga0395899_0428366 | 3300037312 | Bacteria | 870 |
| 296 | Ga0395900_0017157 | 3300037418 | Bacteria | 7389 |
| 297 | Ga0395900_0108231 | 3300037418 | Bacteria | 2856 |
| 298 | Ga0395900_1802112 | 3300037418 | Unclassified | 523 |
| 299 | Ga0395898_0252650 | 3300037466 | Bacteria | 1681 |
| 300 | Ga0395898_0565211 | 3300037466 | Bacteria | 1080 |
| 301 | Ga0395898_1529388 | 3300037466 | Bacteria | 593 |
| 302 | Ga0395905_0645554 | 3300037471 | Bacteria | 960 |
| 303 | Ga0395901_0010671 | 3300038443 | Bacteria | 9312 |
| 304 | Ga0395901_0059057 | 3300038443 | Bacteria | 3990 |
| 305 | Ga0395901_1493945 | 3300038443 | Bacteria | 632 |
| 306 | Ga0451791_0561320 | 3300041451 | Bacteria | 720 |
| 307 | Ga0451807_0123002 | 3300041486 | Bacteria | 730 |
| 308 | Ga0451807_1286079 | 3300041486 | Bacteria | 1838 |
| 309 | Ga0451839_1262289 | 3300041496 | Bacteria | 500 |
| 310 | Ga0451853_1143151 | 3300041512 | Bacteria | 615 |
| 311 | Ga0466972_0056516 | 3300044658 | Bacteria | 1887 |
| 312 | Ga0466965_0015015 | 3300044683 | Bacteria | 3674 |
| 313 | Ga0466965_0135246 | 3300044683 | Bacteria | 1280 |
| 314 | Ga0466966_0662914 | 3300044684 | Bacteria | 629 |
| 315 | Ga0466961_0265145 | 3300044693 | Bacteria | 1053 |
| 316 | Ga0466961_0314462 | 3300044693 | Bacteria | 955 |
| 317 | Ga0466963_0000430 | 3300044694 | Bacteria | 19359 |
| 318 | Ga0466963_0008450 | 3300044694 | Bacteria | 6170 |
| 319 | Ga0466963_0008744 | 3300044694 | Bacteria | 6080 |
| 320 | Ga0466963_0010043 | 3300044694 | Bacteria | 5723 |
| 321 | Ga0466963_0012753 | 3300044694 | Bacteria | 5148 |
| 322 | Ga0466963_0040503 | 3300044694 | Bacteria | 3053 |
| 323 | Ga0466963_0051773 | 3300044694 | Bacteria | 2722 |
| 324 | Ga0466963_0111939 | 3300044694 | Unclassified | 1874 |
| 325 | Ga0466963_0737618 | 3300044694 | Bacteria | 695 |
| 326 | Ga0466964_0006969 | 3300044706 | Bacteria | 4225 |
| 327 | Ga0466964_0023847 | 3300044706 | Unclassified | 2381 |
| 328 | Ga0466964_0107014 | 3300044706 | Bacteria | 1242 |
| 329 | Ga0466964_0119350 | 3300044706 | Bacteria | 1187 |
| 330 | Ga0466964_0121091 | 3300044706 | Bacteria | 1180 |
| 331 | Ga0466964_0122446 | 3300044706 | Bacteria | 1174 |
| 332 | Ga0466964_0156318 | 3300044706 | Bacteria | 1062 |
| 333 | Ga0466964_0207970 | 3300044706 | Bacteria | 943 |
| 334 | Ga0466964_0735132 | 3300044706 | Bacteria | 553 |
| 335 | Ga0466964_0842852 | 3300044706 | Bacteria | 521 |
| 336 | Ga0453684_1161235 | 3300044712 | Bacteria | 813 |
| 337 | Ga0466971_0000571 | 3300044719 | Bacteria | 14575 |
| 338 | Ga0466971_0015039 | 3300044719 | Bacteria | 3404 |
| 339 | Ga0466971_0089392 | 3300044719 | Bacteria | 1410 |
| 340 | Ga0466971_0134837 | 3300044719 | Bacteria | 1148 |
| 341 | Ga0466968_0001271 | 3300044735 | Bacteria | 8983 |
| 342 | Ga0466968_0014588 | 3300044735 | Bacteria | 3106 |
| 343 | Ga0466968_0059896 | 3300044735 | Archaea | 1640 |
| 344 | Ga0466968_0124558 | 3300044735 | Unclassified | 1168 |
| 345 | Ga0466968_0661833 | 3300044735 | Bacteria | 531 |
| 346 | Ga0466970_0041403 | 3300044765 | Bacteria | 2448 |
| 347 | Ga0466970_0046352 | 3300044765 | Bacteria | 2315 |
| 348 | Ga0466957_0001386 | 3300044842 | Bacteria | 12643 |
| 349 | Ga0466957_0024346 | 3300044842 | Bacteria | 3582 |
| 350 | Ga0466957_0066360 | 3300044842 | Bacteria | 2224 |
| 351 | Ga0466957_0241166 | 3300044842 | Bacteria | 1199 |
| 352 | Ga0466957_0799746 | 3300044842 | Unclassified | 670 |
| 353 | Ga0466960_0005128 | 3300044901 | Bacteria | 5184 |
| 354 | Ga0466960_0093661 | 3300044901 | Bacteria | 1536 |
| 355 | Ga0466959_0004364 | 3300045049 | Bacteria | 9464 |
| 356 | Ga0466959_0085927 | 3300045049 | Bacteria | 2263 |
| 357 | Ga0466959_0447148 | 3300045049 | Unclassified | 876 |
| 358 | Ga0451576_1302310 | 3300045051 | Bacteria | 757 |
| 359 | Ga0466958_0007198 | 3300045836 | Bacteria | 6099 |
| 360 | Ga0466958_0022021 | 3300045836 | Unclassified | 3728 |
| 361 | Ga0466958_0065326 | 3300045836 | Bacteria | 2220 |
| 362 | Ga0466958_0089702 | 3300045836 | Bacteria | 1901 |
| 363 | Ga0466958_0093100 | 3300045836 | Bacteria | 1866 |
| 364 | Ga0466958_0103337 | 3300045836 | Bacteria | 1774 |
| 365 | Ga0466958_0246419 | 3300045836 | Bacteria | 1142 |
| 366 | Ga0466967_0006144 | 3300045976 | Bacteria | 8454 |
| 367 | Ga0466967_0016339 | 3300045976 | Bacteria | 5850 |
| 368 | Ga0466967_0019641 | 3300045976 | Bacteria | 5439 |
| 369 | Ga0466967_0022601 | 3300045976 | Bacteria | 5135 |
| 370 | Ga0466967_0041398 | 3300045976 | Bacteria | 3971 |
| 371 | Ga0466967_0066749 | 3300045976 | Bacteria | 3206 |
| 372 | Ga0466967_0096844 | 3300045976 | Bacteria | 2692 |
| 373 | Ga0466967_0180391 | 3300045976 | Bacteria | 1991 |
| 374 | Ga0466967_0198086 | 3300045976 | Bacteria | 1901 |
| 375 | Ga0466967_0283617 | 3300045976 | Bacteria | 1590 |
| 376 | Ga0466967_0311815 | 3300045976 | Bacteria | 1515 |
| 377 | Ga0466967_0503714 | 3300045976 | Bacteria | 1188 |
| 378 | Ga0466967_0900358 | 3300045976 | Bacteria | 880 |
| 379 | Ga0466967_1703025 | 3300045976 | Bacteria | 628 |
| 380 | Ga0495592_0000125 | 3300046454 | Bacteria | 68045 |
| 381 | Ga0495592_0070954 | 3300046454 | Unclassified | 2536 |
| 382 | Ga0495592_0171381 | 3300046454 | Bacteria | 1486 |
| 383 | Ga0495603_0005954 | 3300046455 | Bacteria | 7290 |
| 384 | Ga0495603_0153756 | 3300046455 | Bacteria | 1336 |
| 385 | Ga0495641_0016970 | 3300046461 | Bacteria | 3813 |
| 386 | Ga0495641_0042670 | 3300046461 | Bacteria | 2100 |
| 387 | Ga0495641_0142598 | 3300046461 | Unclassified | 1070 |
| 388 | Ga0495641_0368857 | 3300046461 | Bacteria | 650 |
| 389 | Ga0495651_0000104 | 3300046462 | Bacteria | 61716 |
| 390 | Ga0495651_0002454 | 3300046462 | Bacteria | 14323 |
| 391 | Ga0495653_0004604 | 3300046463 | Bacteria | 11155 |
| 392 | Ga0495653_0005005 | 3300046463 | Bacteria | 10755 |
| 393 | Ga0495653_0575691 | 3300046463 | Bacteria | 694 |
| 394 | Ga0495653_0692850 | 3300046463 | Bacteria | 619 |
| 395 | Ga0495582_0086405 | 3300046473 | Bacteria | 1745 |
| 396 | Ga0495582_0215053 | 3300046473 | Bacteria | 1099 |
| 397 | Ga0495582_0325359 | 3300046473 | Unclassified | 885 |
| 398 | Ga0495582_0758769 | 3300046473 | Unclassified | 561 |
| 399 | Ga0495605_0018697 | 3300046474 | Bacteria | 3709 |
| 400 | Ga0495662_0111343 | 3300046476 | Unclassified | 1342 |
| 401 | Ga0495664_0205705 | 3300046477 | Bacteria | 1192 |
| 402 | Ga0495664_0282007 | 3300046477 | Bacteria | 1004 |
| 403 | Ga0495664_0534164 | 3300046477 | Bacteria | 699 |
| 404 | Ga0495585_0400382 | 3300046492 | Bacteria | 661 |
| 405 | Ga0495594_0346948 | 3300046499 | Bacteria | 845 |
| 406 | Ga0495596_0053900 | 3300046500 | Bacteria | 1573 |
| 407 | Ga0495607_0019154 | 3300046501 | Bacteria | 4352 |
| 408 | Ga0495608_0000595 | 3300046511 | Bacteria | 24865 |
| 409 | Ga0495608_0017819 | 3300046511 | Bacteria | 4909 |
| 410 | Ga0495608_0055966 | 3300046511 | Unclassified | 2606 |
| 411 | Ga0495618_0006629 | 3300046514 | Bacteria | 7016 |
| 412 | Ga0495618_0161361 | 3300046514 | Unclassified | 1429 |
| 413 | Ga0495628_0000040 | 3300046516 | Bacteria | 104506 |
| 414 | Ga0495628_0000132 | 3300046516 | Bacteria | 63426 |
| 415 | Ga0495628_0040955 | 3300046516 | Bacteria | 3698 |
| 416 | Ga0495628_0312062 | 3300046516 | Unclassified | 1162 |
| 417 | Ga0495630_0028971 | 3300046517 | Bacteria | 4115 |
| 418 | Ga0495630_0080084 | 3300046517 | Bacteria | 2464 |
| 419 | Ga0495630_0223759 | 3300046517 | Unclassified | 1437 |
| 420 | Ga0495630_0226861 | 3300046517 | Bacteria | 1426 |
| 421 | Ga0495631_0128527 | 3300046518 | Bacteria | 1089 |
| 422 | Ga0495637_0262360 | 3300046520 | Bacteria | 620 |
| 423 | Ga0495644_0003396 | 3300046523 | Bacteria | 6296 |
| 424 | Ga0495652_0000298 | 3300046529 | Bacteria | 59074 |
| 425 | Ga0495652_0051510 | 3300046529 | Unclassified | 3515 |
| 426 | Ga0495652_0126873 | 3300046529 | Bacteria | 2026 |
| 427 | Ga0495652_0150585 | 3300046529 | Bacteria | 1818 |
| 428 | Ga0495640_0044854 | 3300046533 | Bacteria | 3071 |
| 429 | Ga0495640_0400325 | 3300046533 | Bacteria | 843 |
| 430 | Ga0495586_0028540 | 3300046535 | Bacteria | 2985 |
| 431 | Ga0495586_0144077 | 3300046535 | Unclassified | 1338 |
| 432 | Ga0495587_0000212 | 3300046536 | Bacteria | 43340 |
| 433 | Ga0495587_0039869 | 3300046536 | Unclassified | 2809 |
| 434 | Ga0495645_0000035 | 3300046543 | Bacteria | 102305 |
| 435 | Ga0495645_0240680 | 3300046543 | Bacteria | 1207 |
| 436 | Ga0495645_0403540 | 3300046543 | Unclassified | 870 |
| 437 | Ga0495633_0085483 | 3300046558 | Bacteria | 1467 |
| 438 | Ga0495667_0084109 | 3300046559 | Bacteria | 2066 |
| 439 | Ga0495667_0151715 | 3300046559 | Unclassified | 1492 |
| 440 | Ga0495667_0279664 | 3300046559 | Unclassified | 1059 |
| 441 | Ga0495656_0003461 | 3300046615 | Bacteria | 5338 |
| 442 | Ga0495634_0093851 | 3300046642 | Bacteria | 1945 |
| 443 | Ga0495611_0219422 | 3300046648 | Bacteria | 885 |
| 444 | Ga0495635_0039927 | 3300046663 | Unclassified | 3245 |
| 445 | Ga0495635_0246121 | 3300046663 | Bacteria | 1206 |
| 446 | Ga0495659_0011040 | 3300046664 | Bacteria | 2909 |
| 447 | Ga0495657_0002891 | 3300046675 | Bacteria | 14255 |
| 448 | Ga0495657_0046888 | 3300046675 | Unclassified | 2924 |
| 449 | Ga0495657_0060447 | 3300046675 | Bacteria | 2510 |
| 450 | Ga0495657_0122223 | 3300046675 | Bacteria | 1639 |
| 451 | Ga0495657_0145568 | 3300046675 | Bacteria | 1474 |
| 452 | Ga0495599_0000009 | 3300046678 | Bacteria | 217299 |
| 453 | Ga0495599_0007227 | 3300046678 | Bacteria | 6728 |
| 454 | Ga0495599_0520074 | 3300046678 | Bacteria | 699 |
| 455 | Ga0495623_0001465 | 3300046679 | Bacteria | 15981 |
| 456 | Ga0495623_0216639 | 3300046679 | Bacteria | 1093 |
| 457 | Ga0495646_0006560 | 3300046680 | Bacteria | 7385 |
| 458 | Ga0495646_0342497 | 3300046680 | Bacteria | 784 |
| 459 | Ga0495647_0042402 | 3300046681 | Bacteria | 1737 |
| 460 | Ga0495647_0088988 | 3300046681 | Bacteria | 1263 |
| 461 | Ga0495658_0012076 | 3300046683 | Bacteria | 4363 |
| 462 | Ga0495658_0111163 | 3300046683 | Bacteria | 1648 |
| 463 | Ga0495669_0562664 | 3300046684 | Bacteria | 555 |
| 464 | Ga0495613_0017635 | 3300046689 | Bacteria | 5316 |
| 465 | Ga0495613_0084261 | 3300046689 | Bacteria | 2308 |
| 466 | Ga0495624_0024201 | 3300046690 | Bacteria | 3997 |
| 467 | Ga0495589_0229501 | 3300046794 | Bacteria | 871 |
| 468 | Ga0495600_0459409 | 3300046809 | Bacteria | 786 |
| 469 | Ga0495581_0015527 | 3300047315 | Bacteria | 4421 |
| 470 | Ga0495604_0000120 | 3300047317 | Bacteria | 66462 |
| 471 | Ga0495604_0254492 | 3300047317 | Bacteria | 1196 |
| 472 | Ga0495604_0985894 | 3300047317 | Bacteria | 522 |
| 473 | Ga0495674_0087891 | 3300047319 | Bacteria | 2659 |
| 474 | Ga0495674_0113279 | 3300047319 | Unclassified | 2297 |
| 475 | Ga0495674_0399764 | 3300047319 | Unclassified | 1109 |
| 476 | Ga0495676_0066924 | 3300047321 | Bacteria | 2781 |
| 477 | Ga0495676_0333475 | 3300047321 | Unclassified | 1017 |
| 478 | Ga0495676_0589648 | 3300047321 | Bacteria | 724 |
| 479 | Ga0495676_0856271 | 3300047321 | Bacteria | 583 |
| 480 | Ga0495676_0935647 | 3300047321 | Bacteria | 554 |
| 481 | Ga0495676_0936631 | 3300047321 | Bacteria | 554 |
| 482 | Ga0495680_0008617 | 3300047322 | Bacteria | 9258 |
| 483 | Ga0495680_0013033 | 3300047322 | Bacteria | 7272 |
| 484 | Ga0495680_0014726 | 3300047322 | Bacteria | 6761 |
| 485 | Ga0495683_0309248 | 3300047323 | Bacteria | 677 |
| 486 | Ga0495675_0000137 | 3300047444 | Bacteria | 50947 |
| 487 | Ga0495684_0018258 | 3300047471 | Bacteria | 5405 |
| 488 | Ga0495684_0917614 | 3300047471 | Bacteria | 563 |
| 489 | Ga0495593_0220071 | 3300047673 | Bacteria | 953 |
| 490 | Ga0495602_0001635 | 3300048088 | Bacteria | 22289 |
| 491 | Ga0495602_0055163 | 3300048088 | Unclassified | 3501 |
| 492 | Ga0496101_0115934 | 3300048904 | Unclassified | 2021 |
| 493 | Ga0496101_0122749 | 3300048904 | Bacteria | 1965 |
| 494 | Ga0496101_0173891 | 3300048904 | Bacteria | 1656 |
| 495 | Ga0496101_0561989 | 3300048904 | Bacteria | 902 |
| 496 | Ga0496102_0382910 | 3300048905 | Bacteria | 1324 |
| 497 | Ga0496104_0008275 | 3300048907 | Bacteria | 9236 |
| 498 | Ga0496104_0012649 | 3300048907 | Bacteria | 7598 |
| 499 | Ga0496104_0127077 | 3300048907 | Bacteria | 2448 |
| 500 | Ga0496104_0157469 | 3300048907 | Bacteria | 2179 |
| 501 | Ga0496105_0004281 | 3300048908 | Bacteria | 10741 |
| 502 | Ga0496105_0004966 | 3300048908 | Bacteria | 10056 |
| 503 | Ga0496105_0021299 | 3300048908 | Bacteria | 5245 |
| 504 | Ga0496105_0086357 | 3300048908 | Bacteria | 2593 |
| 505 | Ga0496106_0184562 | 3300048909 | Unclassified | 1657 |
| 506 | Ga0496106_0396019 | 3300048909 | Bacteria | 1110 |
| 507 | Ga0496107_0056669 | 3300048910 | Bacteria | 2832 |
| 508 | Ga0496107_0089025 | 3300048910 | Bacteria | 2254 |
| 509 | Ga0496107_0190218 | 3300048910 | Bacteria | 1525 |
| 510 | Ga0496108_0005783 | 3300048911 | Bacteria | 10018 |
| 511 | Ga0496108_0008784 | 3300048911 | Bacteria | 8191 |
| 512 | Ga0496108_0356810 | 3300048911 | Bacteria | 1276 |
| 513 | Ga0496108_0411891 | 3300048911 | Bacteria | 1180 |
| 514 | Ga0496109_0012652 | 3300048912 | Bacteria | 7289 |
| 515 | Ga0496109_0055216 | 3300048912 | Bacteria | 3623 |
| 516 | Ga0496109_0068252 | 3300048912 | Bacteria | 3259 |
| 517 | Ga0496109_0280886 | 3300048912 | Bacteria | 1569 |
| 518 | Ga0496109_0424163 | 3300048912 | Bacteria | 1256 |
| 519 | Ga0496109_0550347 | 3300048912 | Bacteria | 1088 |
| 520 | Ga0496109_0833664 | 3300048912 | Unclassified | 860 |
| 521 | Ga0496109_0840038 | 3300048912 | Bacteria | 856 |
| 522 | Ga0496110_0208367 | 3300048913 | Bacteria | 1777 |
| 523 | Ga0496110_0666786 | 3300048913 | Bacteria | 940 |
| 524 | Ga0496111_0049379 | 3300048914 | Bacteria | 3034 |
| 525 | Ga0496111_0067617 | 3300048914 | Bacteria | 2596 |
| 526 | Ga0496111_0982622 | 3300048914 | Bacteria | 605 |
| 527 | Ga0496112_0176334 | 3300048915 | Bacteria | 2102 |
| 528 | Ga0496112_0296151 | 3300048915 | Bacteria | 1564 |
| 529 | Ga0496112_0598514 | 3300048915 | Bacteria | 1034 |
| 530 | Ga0496113_0019636 | 3300048916 | Bacteria | 4731 |
| 531 | Ga0496113_0120797 | 3300048916 | Bacteria | 2048 |
| 532 | Ga0496113_0153644 | 3300048916 | Bacteria | 1817 |
| 533 | Ga0496113_0386660 | 3300048916 | Bacteria | 1123 |
| 534 | Ga0496113_0783262 | 3300048916 | Bacteria | 758 |
| 535 | Ga0496114_0122336 | 3300048917 | Bacteria | 2239 |
| 536 | Ga0496114_0231967 | 3300048917 | Bacteria | 1622 |
| 537 | Ga0496115_0035995 | 3300048918 | Bacteria | 3918 |
| 538 | Ga0496115_0041338 | 3300048918 | Bacteria | 3669 |
| 539 | Ga0496115_0088486 | 3300048918 | Bacteria | 2528 |
| 540 | Ga0496115_0478835 | 3300048918 | Bacteria | 1003 |
| 541 | Ga0501040_0375131 | 3300049576 | Bacteria | 1020 |
| 542 | Ga0501040_1054099 | 3300049576 | Bacteria | 590 |
| 543 | Ga0501047_0073280 | 3300049581 | Bacteria | 3297 |
| 544 | Ga0501067_0002687 | 3300049583 | Bacteria | 9820 |
| 545 | Ga0501067_0020950 | 3300049583 | Bacteria | 3617 |
| 546 | Ga0501067_0031748 | 3300049583 | Bacteria | 2931 |
| 547 | Ga0501067_0060497 | 3300049583 | Unclassified | 2096 |
| 548 | Ga0501068_0018353 | 3300049584 | Bacteria | 4051 |
| 549 | Ga0501068_0328462 | 3300049584 | Bacteria | 981 |
| 550 | Ga0501069_0001737 | 3300049585 | Bacteria | 10870 |
| 551 | Ga0501069_0009778 | 3300049585 | Bacteria | 5069 |
| 552 | Ga0501069_0065803 | 3300049585 | Bacteria | 2027 |
| 553 | Ga0501070_0138846 | 3300049586 | Bacteria | 2007 |
| 554 | Ga0501070_1391165 | 3300049586 | Unclassified | 533 |
| 555 | Ga0501071_1019015 | 3300049587 | Bacteria | 639 |
| 556 | Ga0501072_0255024 | 3300049588 | Bacteria | 1397 |
| 557 | Ga0501073_1278461 | 3300049589 | Bacteria | 503 |
| 558 | Ga0501075_0288237 | 3300049591 | Bacteria | 1251 |
| 559 | Ga0501076_0182966 | 3300049592 | Bacteria | 1709 |
| 560 | Ga0501080_0589336 | 3300049742 | Bacteria | 988 |
| 561 | Ga0501080_1692176 | 3300049742 | Unclassified | 534 |
| 562 | nmdc:mga00v17_51010_c1 | 3300050491 | Bacteria | 2515 |
| 563 | nmdc:mga0rr50_505101_c1 | 3300050513 | Bacteria | 1028 |
| 564 | Ga0495601_0000983 | 3300053077 | Bacteria | 15574 |
| 565 | Ga0495601_0104266 | 3300053077 | Bacteria | 1833 |
| 566 | Ga0495601_0106827 | 3300053077 | Unclassified | 1810 |
| 567 | Ga0495601_0398422 | 3300053077 | Bacteria | 892 |
| 568 | Ga0495612_0084162 | 3300053078 | Bacteria | 1339 |
| 569 | Ga0495612_0358996 | 3300053078 | Bacteria | 658 |
| 570 | Ga0495595_0002532 | 3300053084 | Bacteria | 7168 |
| 571 | Ga0495595_0008406 | 3300053084 | Bacteria | 4233 |
| 572 | Ga0495619_0003772 | 3300053085 | Bacteria | 9744 |
| 573 | Ga0495619_0025735 | 3300053085 | Bacteria | 3781 |
| 574 | Ga0495619_0443274 | 3300053085 | Bacteria | 895 |
| 575 | Ga0495619_0651618 | 3300053085 | Bacteria | 718 |
| 576 | Ga0495619_0879457 | 3300053085 | Unclassified | 603 |
| 577 | Ga0495619_0915616 | 3300053085 | Bacteria | 589 |
| 578 | Ga0501084_1303273 | 3300054114 | Bacteria | 609 |
| 579 | Ga0501082_1692672 | 3300060353 | Unclassified | 552 |
| 580 | Ga0466962_0004435 | 3300061719 | Bacteria | 6725 |
| 581 | Ga0466962_0626642 | 3300061719 | Bacteria | 549 |
| 582 | Ga0530510_0015632 | 3300061734 | Bacteria | 5363 |
| 583 | Ga0530510_0183466 | 3300061734 | Bacteria | 1552 |
| 584 | Ga0530510_0405787 | 3300061734 | Bacteria | 1028 |
| 585 | Ga0373943_0581262 | |||
| 586 | JGI24746J21847_1056351 | |||
| 587 | JGI24739J22299_10081163 | |||
| 588 | JGI24738J21930_10046437 | |||
| 589 | JGI24744J21845_10022103 | |||
| 590 | JGI24742J22300_10018062 | |||
| 591 | JGI24751J29686_10067669 | |||
| 592 | rootL2_10222519 | |||
| 593 | rootH1_10082901 | |||
| 594 | Ga0070658_10025348 | |||
| 595 | Ga0070658_10034961 | |||
| 596 | Ga0070658_10072353 | |||
| 597 | Ga0070658_11078098 | |||
| 598 | Ga0070676_10340896 | |||
| 599 | Ga0070683_100020638 | |||
| 600 | Ga0070683_100056584 | |||
| 601 | Ga0070683_100279505 | |||
| 602 | Ga0070683_100282635 | |||
| 603 | Ga0070683_101411319 | |||
| 604 | Ga0070666_10374062 | |||
| 605 | Ga0070680_100046229 | |||
| 606 | Ga0070680_100227411 | |||
| 607 | Ga0070682_100001777 | |||
| 608 | Ga0070682_100111523 | |||
| 609 | Ga0070682_100710191 | |||
| 610 | Ga0068868_101437085 | |||
| 611 | Ga0070660_100001667 | |||
| 612 | Ga0070660_100048434 | |||
| 613 | Ga0070691_10030216 | |||
| 614 | Ga0070691_10132846 | |||
| 615 | Ga0070661_100005154 | |||
| 616 | Ga0070661_100145927 | |||
| 617 | Ga0070669_100529186 | |||
| 618 | Ga0070675_100010398 | |||
| 619 | Ga0070674_100090866 | |||
| 620 | Ga0070673_100097751 | |||
| 621 | Ga0070659_100053595 | |||
| 622 | Ga0070667_100884313 | |||
| 623 | Ga0070709_10069714 | |||
| 624 | Ga0070714_100001084 | |||
| 625 | Ga0070714_100122887 | |||
| 626 | Ga0070714_100187219 | |||
| 627 | Ga0070714_100578068 | |||
| 628 | Ga0070714_100809736 | |||
| 629 | Ga0070713_100068651 | |||
| 630 | Ga0070713_100174140 | |||
| 631 | Ga0070713_100191971 | |||
| 632 | Ga0070710_10002369 | |||
| 633 | Ga0070710_10010592 | |||
| 634 | Ga0070710_10561056 | |||
| 635 | Ga0070701_10132412 | |||
| 636 | Ga0070711_100629175 | |||
| 637 | Ga0070705_100229287 | |||
| 638 | Ga0070700_100460341 | |||
| 639 | Ga0070708_100003821 | |||
| 640 | Ga0070708_100006095 | |||
| 641 | Ga0070708_100376852 | |||
| 642 | Ga0070708_100565617 | |||
| 643 | Ga0070678_100005901 | |||
| 644 | Ga0070678_101198291 | |||
| 645 | Ga0070662_100027799 | |||
| 646 | Ga0070681_10105612 | |||
| 647 | Ga0070706_100003177 | |||
| 648 | Ga0070706_100048569 | |||
| 649 | Ga0070706_100092971 | |||
| 650 | Ga0070706_101522081 | |||
| 651 | Ga0070706_101532232 | |||
| 652 | Ga0070707_100005238 | |||
| 653 | Ga0070707_100634630 | |||
| 654 | Ga0070707_101127035 | |||
| 655 | Ga0070698_100559570 | |||
| 656 | Ga0070699_100042211 | |||
| 657 | Ga0070679_100260126 | |||
| 658 | Ga0070679_100301259 | |||
| 659 | Ga0070679_100340311 | |||
| 660 | Ga0070684_100018603 | |||
| 661 | Ga0070684_100021102 | |||
| 662 | Ga0070684_100192086 | |||
| 663 | Ga0070684_100934005 | |||
| 664 | Ga0070697_101242417 | |||
| 665 | Ga0068853_100004196 | |||
| 666 | Ga0068853_102014412 | |||
| 667 | Ga0070695_100932745 | |||
| 668 | Ga0070693_100022228 | |||
| 669 | Ga0070693_100118814 | |||
| 670 | Ga0068855_100046564 | |||
| 671 | Ga0068855_100626506 | |||
| 672 | Ga0068857_100785189 | |||
| 673 | Ga0068856_100046444 | |||
| 674 | Ga0068856_100063637 | |||
| 675 | Ga0068856_100195891 | |||
| 676 | Ga0070702_100012411 | |||
| 677 | Ga0070702_100835118 | |||
| 678 | Ga0068852_100218638 | |||
| 679 | Ga0068864_100708591 | |||
| 680 | Ga0068861_100801923 | |||
| 681 | Ga0068863_100064638 | |||
| 682 | Ga0070717_10008478 | |||
| 683 | Ga0070717_10022452 | |||
| 684 | Ga0070717_10033324 | |||
| 685 | Ga0070717_11443819 | |||
| 686 | Ga0075364_10060448 | |||
| 687 | Ga0070716_100166880 | |||
| 688 | Ga0070712_100071321 | |||
| 689 | Ga0070712_101219126 | |||
| 690 | Ga0068865_100725637 | |||
| 691 | Ga0075436_100252464 | |||
| 692 | Ga0075435_100033009 | |||
| 693 | Ga0075435_101727951 | |||
| 694 | Ga0105240_10047426 | |||
| 695 | Ga0105240_10286390 | |||
| 696 | Ga0105240_11415239 | |||
| 697 | Ga0105245_10133547 | |||
| 698 | Ga0105245_10259688 | |||
| 699 | Ga0105245_10504591 | |||
| 700 | Ga0105245_12597904 | |||
| 701 | Ga0105243_11114334 | |||
| 702 | Ga0105242_10002465 | |||
| 703 | Ga0105248_10139561 | |||
| 704 | Ga0105237_11343631 | |||
| 705 | Ga0105238_10078199 | |||
| 706 | Ga0105238_12429870 | |||
| 707 | Ga0105249_11435644 | |||
| 708 | Ga0105239_10049506 | |||
| 709 | Ga0105239_10362992 | |||
| 710 | Ga0105246_10220955 | |||
| 711 | Ga0157371_10003757 | |||
| 712 | Ga0157370_10064913 | |||
| 713 | Ga0157370_10175761 | |||
| 714 | Ga0157370_11602700 | |||
| 715 | Ga0157369_10004049 | |||
| 716 | Ga0157369_10005636 | |||
| 717 | Ga0157369_10057858 | |||
| 718 | Ga0157369_10424013 | |||
| 719 | Ga0157374_10092619 | |||
| 720 | Ga0157374_10251669 | |||
| 721 | Ga0157374_11161348 | |||
| 722 | Ga0157378_10265593 | |||
| 723 | Ga0157372_10174350 | |||
| 724 | Ga0157372_10683535 | |||
| 725 | Ga0163163_10222868 | |||
| 726 | Ga0163163_10514677 | |||
| 727 | Ga0157380_11351325 | |||
| 728 | Ga0182008_10240795 | |||
| 729 | Ga0182008_10451297 | |||
| 730 | Ga0157377_10644330 | |||
| 731 | Ga0157376_10100171 | |||
| 732 | Ga0182007_10215731 | |||
| 733 | Ga0163161_11544454 | |||
| 734 | Ga0206356_11138035 | |||
| 735 | Ga0206353_11109881 | |||
| 736 | Ga0207692_10006084 | |||
| 737 | Ga0207692_10094975 | |||
| 738 | Ga0207692_10135079 | |||
| 739 | Ga0207680_10513643 | |||
| 740 | Ga0207699_10297779 | |||
| 741 | Ga0207699_10388100 | |||
| 742 | Ga0207699_10422622 | |||
| 743 | Ga0207705_10051423 | |||
| 744 | Ga0207705_10194384 | |||
| 745 | Ga0207705_10255317 | |||
| 746 | Ga0207705_10334827 | |||
| 747 | Ga0207684_10003165 | |||
| 748 | Ga0207684_10871270 | |||
| 749 | Ga0207684_11402588 | |||
| 750 | Ga0207707_10271357 | |||
| 751 | Ga0207695_11556293 | |||
| 752 | Ga0207693_10008397 | |||
| 753 | Ga0207663_10013008 | |||
| 754 | Ga0207660_10183966 | |||
| 755 | Ga0207660_11441222 | |||
| 756 | Ga0207657_10014505 | |||
| 757 | Ga0207649_10212791 | |||
| 758 | Ga0207652_10536487 | |||
| 759 | Ga0207652_10596123 | |||
| 760 | Ga0207652_11714794 | |||
| 761 | Ga0207646_10077956 | |||
| 762 | Ga0207694_10102522 | |||
| 763 | Ga0207694_10898214 | |||
| 764 | Ga0207687_10029148 | |||
| 765 | Ga0207700_10005417 | |||
| 766 | Ga0207700_10040824 | |||
| 767 | Ga0207664_10034034 | |||
| 768 | Ga0207664_10192035 | |||
| 769 | Ga0207664_10266567 | |||
| 770 | Ga0207664_10393757 | |||
| 771 | Ga0207690_10013235 | |||
| 772 | Ga0207690_10066178 | |||
| 773 | Ga0207706_10005943 | |||
| 774 | Ga0207686_10010949 | |||
| 775 | Ga0207709_10148055 | |||
| 776 | Ga0207669_10338826 | |||
| 777 | Ga0207704_10399442 | |||
| 778 | Ga0207665_10081749 | |||
| 779 | Ga0207711_10430420 | |||
| 780 | Ga0207689_10119513 | |||
| 781 | Ga0207661_10021882 | |||
| 782 | Ga0207661_10085383 | |||
| 783 | Ga0207661_10099039 | |||
| 784 | Ga0207661_10357645 | |||
| 785 | Ga0207661_10490939 | |||
| 786 | Ga0207679_10734249 | |||
| 787 | Ga0207667_10128179 | |||
| 788 | Ga0207667_10571068 | |||
| 789 | Ga0207712_10945270 | |||
| 790 | Ga0207640_10490020 | |||
| 791 | Ga0207677_11401554 | |||
| 792 | Ga0207639_10146371 | |||
| 793 | Ga0207708_10292205 | |||
| 794 | Ga0207702_10092963 | |||
| 795 | Ga0207648_10147560 | |||
| 796 | Ga0207674_10319859 | |||
| 797 | Ga0207683_10013282 | |||
| 798 | Ga0207698_10109302 | |||
| 799 | Ga0265337_1003753 | |||
| 800 | Ga0265337_1013098 | |||
| 801 | Ga0265326_10000698 | |||
| 802 | Ga0265326_10007464 | |||
| 803 | Ga0265326_10027996 | |||
| 804 | Ga0265319_1000067 | |||
| 805 | Ga0265319_1000408 | |||
| 806 | Ga0265319_1002042 | |||
| 807 | Ga0265319_1012536 | |||
| 808 | Ga0265319_1053723 | |||
| 809 | Ga0265319_1256639 | |||
| 810 | Ga0265334_10007750 | |||
| 811 | Ga0265334_10032888 | |||
| 812 | Ga0265318_10006922 | |||
| 813 | Ga0265318_10012770 | |||
| 814 | Ga0265318_10148189 | |||
| 815 | Ga0265323_10000491 | |||
| 816 | Ga0265322_10000759 | |||
| 817 | Ga0265322_10043357 | |||
| 818 | Ga0265336_10000067 | |||
| 819 | Ga0265336_10118795 | |||
| 820 | Ga0265338_10000126 | |||
| 821 | Ga0265338_10009097 | |||
| 822 | Ga0265338_10009434 | |||
| 823 | Ga0265338_10011608 | |||
| 824 | Ga0265338_10014199 | |||
| 825 | Ga0265338_10024476 | |||
| 826 | Ga0265338_10518331 | |||
| 827 | Ga0265338_10627927 | |||
| 828 | Ga0265324_10002147 | |||
| 829 | Ga0265324_10008640 | |||
| 830 | Ga0265324_10053614 | |||
| 831 | Ga0265324_10283562 | |||
| 832 | Ga0265330_10000150 | |||
| 833 | Ga0265332_10000306 | |||
| 834 | Ga0265328_10008178 | |||
| 835 | Ga0265320_10000275 | |||
| 836 | Ga0265320_10005196 | |||
| 837 | Ga0265320_10193903 | |||
| 838 | Ga0265325_10005197 | |||
| 839 | Ga0265325_10123670 | |||
| 840 | Ga0265329_10000181 | |||
| 841 | Ga0265329_10043569 | |||
| 842 | Ga0265340_10008924 | |||
| 843 | Ga0265340_10029483 | |||
| 844 | Ga0265339_10000097 | |||
| 845 | Ga0265339_10056040 | |||
| 846 | Ga0265331_10000322 | |||
| 847 | Ga0265331_10193979 | |||
| 848 | Ga0265316_10001497 | |||
| 849 | Ga0265316_10002531 | |||
| 850 | Ga0265316_10221143 | |||
| 851 | Ga0265313_10001271 | |||
| 852 | Ga0265313_10049400 | |||
| 853 | Ga0265314_10000337 | |||
| 854 | Ga0265342_10000999 | |||
| 855 | Ga0265342_10001401 | |||
| 856 | Ga0316578_10020473 | |||
| 857 | Ga0316578_10430808 | |||
| 858 | Ga0307415_100242864 | |||
| 859 | Ga0316580_10290121 | |||
| 860 | Ga0373956_0585789 | |||
| 861 | Ga0373957_0125300 | |||
| 862 | Ga0373943_0697530 | |||
| 863 | Ga0373955_0584515 | |||
| 864 | Ga0316574_0031411 | |||
| 865 | Ga0316574_0227821 | |||
| 866 | Ga0373935_0789371 | |||
| 867 | Ga0373933_0608401 | |||
| 868 | Ga0373933_0625578 | |||
| 869 | Ga0373933_0851959 | |||
| 870 | Ga0373947_1216977 | |||
| 871 | Ga0373937_0020040 | |||
| 872 | Ga0373937_0917015 | |||
| 873 | Ga0316582_0224388 | |||
| 874 | Ga0316584_0089118 | |||
| 875 | Ga0373925_0252810 | |||
| 876 | Ga0373925_1555015 | |||
| 877 | Ga0373925_1702713 | |||
| 878 | Ga0395899_0352103 | |||
| 879 | Ga0395899_0428366 | |||
| 880 | Ga0395900_0017157 | |||
| 881 | Ga0395900_0108231 | |||
| 882 | Ga0395900_1802112 | |||
| 883 | Ga0395898_0252650 | |||
| 884 | Ga0395898_0565211 | |||
| 885 | Ga0395898_1529388 | |||
| 886 | Ga0395905_0645554 | |||
| 887 | Ga0395901_0010671 | |||
| 888 | Ga0395901_0059057 | |||
| 889 | Ga0395901_1493945 | |||
| 890 | Ga0451791_0561320 | |||
| 891 | Ga0451807_0123002 | |||
| 892 | Ga0451807_1286079 | |||
| 893 | Ga0451839_1262289 | |||
| 894 | Ga0451853_1143151 | |||
| 895 | Ga0466972_0056516 | |||
| 896 | Ga0466965_0015015 | |||
| 897 | Ga0466965_0135246 | |||
| 898 | Ga0466966_0662914 | |||
| 899 | Ga0466961_0265145 | |||
| 900 | Ga0466961_0314462 | |||
| 901 | Ga0466963_0000430 | |||
| 902 | Ga0466963_0008450 | |||
| 903 | Ga0466963_0008744 | |||
| 904 | Ga0466963_0010043 | |||
| 905 | Ga0466963_0012753 | |||
| 906 | Ga0466963_0040503 | |||
| 907 | Ga0466963_0051773 | |||
| 908 | Ga0466963_0111939 | |||
| 909 | Ga0466963_0737618 | |||
| 910 | Ga0466964_0006969 | |||
| 911 | Ga0466964_0023847 | |||
| 912 | Ga0466964_0107014 | |||
| 913 | Ga0466964_0119350 | |||
| 914 | Ga0466964_0121091 | |||
| 915 | Ga0466964_0122446 | |||
| 916 | Ga0466964_0156318 | |||
| 917 | Ga0466964_0207970 | |||
| 918 | Ga0466964_0735132 | |||
| 919 | Ga0466964_0842852 | |||
| 920 | Ga0453684_1161235 | |||
| 921 | Ga0466971_0000571 | |||
| 922 | Ga0466971_0015039 | |||
| 923 | Ga0466971_0089392 | |||
| 924 | Ga0466971_0134837 | |||
| 925 | Ga0466968_0001271 | |||
| 926 | Ga0466968_0014588 | |||
| 927 | Ga0466968_0059896 | |||
| 928 | Ga0466968_0124558 | |||
| 929 | Ga0466968_0661833 | |||
| 930 | Ga0466970_0041403 | |||
| 931 | Ga0466970_0046352 | |||
| 932 | Ga0466957_0001386 | |||
| 933 | Ga0466957_0024346 | |||
| 934 | Ga0466957_0066360 | |||
| 935 | Ga0466957_0241166 | |||
| 936 | Ga0466957_0799746 | |||
| 937 | Ga0466960_0005128 | |||
| 938 | Ga0466960_0093661 | |||
| 939 | Ga0466959_0004364 | |||
| 940 | Ga0466959_0085927 | |||
| 941 | Ga0466959_0447148 | |||
| 942 | Ga0451576_1302310 | |||
| 943 | Ga0466958_0007198 | |||
| 944 | Ga0466958_0022021 | |||
| 945 | Ga0466958_0065326 | |||
| 946 | Ga0466958_0089702 | |||
| 947 | Ga0466958_0093100 | |||
| 948 | Ga0466958_0103337 | |||
| 949 | Ga0466958_0246419 | |||
| 950 | Ga0466967_0006144 | |||
| 951 | Ga0466967_0016339 | |||
| 952 | Ga0466967_0019641 | |||
| 953 | Ga0466967_0022601 | |||
| 954 | Ga0466967_0041398 | |||
| 955 | Ga0466967_0066749 | |||
| 956 | Ga0466967_0096844 | |||
| 957 | Ga0466967_0180391 | |||
| 958 | Ga0466967_0198086 | |||
| 959 | Ga0466967_0283617 | |||
| 960 | Ga0466967_0311815 | |||
| 961 | Ga0466967_0503714 | |||
| 962 | Ga0466967_0900358 | |||
| 963 | Ga0466967_1703025 | |||
| 964 | Ga0495592_0000125 | |||
| 965 | Ga0495592_0070954 | |||
| 966 | Ga0495592_0171381 | |||
| 967 | Ga0495603_0005954 | |||
| 968 | Ga0495603_0153756 | |||
| 969 | Ga0495641_0016970 | |||
| 970 | Ga0495641_0042670 | |||
| 971 | Ga0495641_0142598 | |||
| 972 | Ga0495641_0368857 | |||
| 973 | Ga0495651_0000104 | |||
| 974 | Ga0495651_0002454 | |||
| 975 | Ga0495653_0004604 | |||
| 976 | Ga0495653_0005005 | |||
| 977 | Ga0495653_0575691 | |||
| 978 | Ga0495653_0692850 | |||
| 979 | Ga0495582_0086405 | |||
| 980 | Ga0495582_0215053 | |||
| 981 | Ga0495582_0325359 | |||
| 982 | Ga0495582_0758769 | |||
| 983 | Ga0495605_0018697 | |||
| 984 | Ga0495662_0111343 | |||
| 985 | Ga0495664_0205705 | |||
| 986 | Ga0495664_0282007 | |||
| 987 | Ga0495664_0534164 | |||
| 988 | Ga0495585_0400382 | |||
| 989 | Ga0495594_0346948 | |||
| 990 | Ga0495596_0053900 | |||
| 991 | Ga0495607_0019154 | |||
| 992 | Ga0495608_0000595 | |||
| 993 | Ga0495608_0017819 | |||
| 994 | Ga0495608_0055966 | |||
| 995 | Ga0495618_0006629 | |||
| 996 | Ga0495618_0161361 | |||
| 997 | Ga0495628_0000040 | |||
| 998 | Ga0495628_0000132 | |||
| 999 | Ga0495628_0040955 | |||
| 1000 | Ga0495628_0312062 | |||
| 1001 | Ga0495630_0028971 | |||
| 1002 | Ga0495630_0080084 | |||
| 1003 | Ga0495630_0223759 | |||
| 1004 | Ga0495630_0226861 | |||
| 1005 | Ga0495631_0128527 | |||
| 1006 | Ga0495637_0262360 | |||
| 1007 | Ga0495644_0003396 | |||
| 1008 | Ga0495652_0000298 | |||
| 1009 | Ga0495652_0051510 | |||
| 1010 | Ga0495652_0126873 | |||
| 1011 | Ga0495652_0150585 | |||
| 1012 | Ga0495640_0044854 | |||
| 1013 | Ga0495640_0400325 | |||
| 1014 | Ga0495586_0028540 | |||
| 1015 | Ga0495586_0144077 | |||
| 1016 | Ga0495587_0000212 | |||
| 1017 | Ga0495587_0039869 | |||
| 1018 | Ga0495645_0000035 | |||
| 1019 | Ga0495645_0240680 | |||
| 1020 | Ga0495645_0403540 | |||
| 1021 | Ga0495633_0085483 | |||
| 1022 | Ga0495667_0084109 | |||
| 1023 | Ga0495667_0151715 | |||
| 1024 | Ga0495667_0279664 | |||
| 1025 | Ga0495656_0003461 | |||
| 1026 | Ga0495634_0093851 | |||
| 1027 | Ga0495611_0219422 | |||
| 1028 | Ga0495635_0039927 | |||
| 1029 | Ga0495635_0246121 | |||
| 1030 | Ga0495659_0011040 | |||
| 1031 | Ga0495657_0002891 | |||
| 1032 | Ga0495657_0046888 | |||
| 1033 | Ga0495657_0060447 | |||
| 1034 | Ga0495657_0122223 | |||
| 1035 | Ga0495657_0145568 | |||
| 1036 | Ga0495599_0000009 | |||
| 1037 | Ga0495599_0007227 | |||
| 1038 | Ga0495599_0520074 | |||
| 1039 | Ga0495623_0001465 | |||
| 1040 | Ga0495623_0216639 | |||
| 1041 | Ga0495646_0006560 | |||
| 1042 | Ga0495646_0342497 | |||
| 1043 | Ga0495647_0042402 | |||
| 1044 | Ga0495647_0088988 | |||
| 1045 | Ga0495658_0012076 | |||
| 1046 | Ga0495658_0111163 | |||
| 1047 | Ga0495669_0562664 | |||
| 1048 | Ga0495613_0017635 | |||
| 1049 | Ga0495613_0084261 | |||
| 1050 | Ga0495624_0024201 | |||
| 1051 | Ga0495589_0229501 | |||
| 1052 | Ga0495600_0459409 | |||
| 1053 | Ga0495581_0015527 | |||
| 1054 | Ga0495604_0000120 | |||
| 1055 | Ga0495604_0254492 | |||
| 1056 | Ga0495604_0985894 | |||
| 1057 | Ga0495674_0087891 | |||
| 1058 | Ga0495674_0113279 | |||
| 1059 | Ga0495674_0399764 | |||
| 1060 | Ga0495676_0066924 | |||
| 1061 | Ga0495676_0333475 | |||
| 1062 | Ga0495676_0589648 | |||
| 1063 | Ga0495676_0856271 | |||
| 1064 | Ga0495676_0935647 | |||
| 1065 | Ga0495676_0936631 | |||
| 1066 | Ga0495680_0008617 | |||
| 1067 | Ga0495680_0013033 | |||
| 1068 | Ga0495680_0014726 | |||
| 1069 | Ga0495683_0309248 | |||
| 1070 | Ga0495675_0000137 | |||
| 1071 | Ga0495684_0018258 | |||
| 1072 | Ga0495684_0917614 | |||
| 1073 | Ga0495593_0220071 | |||
| 1074 | Ga0495602_0001635 | |||
| 1075 | Ga0495602_0055163 | |||
| 1076 | Ga0496101_0115934 | |||
| 1077 | Ga0496101_0122749 | |||
| 1078 | Ga0496101_0173891 | |||
| 1079 | Ga0496101_0561989 | |||
| 1080 | Ga0496102_0382910 | |||
| 1081 | Ga0496104_0008275 | |||
| 1082 | Ga0496104_0012649 | |||
| 1083 | Ga0496104_0127077 | |||
| 1084 | Ga0496104_0157469 | |||
| 1085 | Ga0496105_0004281 | |||
| 1086 | Ga0496105_0004966 | |||
| 1087 | Ga0496105_0021299 | |||
| 1088 | Ga0496105_0086357 | |||
| 1089 | Ga0496106_0184562 | |||
| 1090 | Ga0496106_0396019 | |||
| 1091 | Ga0496107_0056669 | |||
| 1092 | Ga0496107_0089025 | |||
| 1093 | Ga0496107_0190218 | |||
| 1094 | Ga0496108_0005783 | |||
| 1095 | Ga0496108_0008784 | |||
| 1096 | Ga0496108_0356810 | |||
| 1097 | Ga0496108_0411891 | |||
| 1098 | Ga0496109_0012652 | |||
| 1099 | Ga0496109_0055216 | |||
| 1100 | Ga0496109_0068252 | |||
| 1101 | Ga0496109_0280886 | |||
| 1102 | Ga0496109_0424163 | |||
| 1103 | Ga0496109_0550347 | |||
| 1104 | Ga0496109_0833664 | |||
| 1105 | Ga0496109_0840038 | |||
| 1106 | Ga0496110_0208367 | |||
| 1107 | Ga0496110_0666786 | |||
| 1108 | Ga0496111_0049379 | |||
| 1109 | Ga0496111_0067617 | |||
| 1110 | Ga0496111_0982622 | |||
| 1111 | Ga0496112_0176334 | |||
| 1112 | Ga0496112_0296151 | |||
| 1113 | Ga0496112_0598514 | |||
| 1114 | Ga0496113_0019636 | |||
| 1115 | Ga0496113_0120797 | |||
| 1116 | Ga0496113_0153644 | |||
| 1117 | Ga0496113_0386660 | |||
| 1118 | Ga0496113_0783262 | |||
| 1119 | Ga0496114_0122336 | |||
| 1120 | Ga0496114_0231967 | |||
| 1121 | Ga0496115_0035995 | |||
| 1122 | Ga0496115_0041338 | |||
| 1123 | Ga0496115_0088486 | |||
| 1124 | Ga0496115_0478835 | |||
| 1125 | Ga0501040_0375131 | |||
| 1126 | Ga0501040_1054099 | |||
| 1127 | Ga0501047_0073280 | |||
| 1128 | Ga0501067_0002687 | |||
| 1129 | Ga0501067_0020950 | |||
| 1130 | Ga0501067_0031748 | |||
| 1131 | Ga0501067_0060497 | |||
| 1132 | Ga0501068_0018353 | |||
| 1133 | Ga0501068_0328462 | |||
| 1134 | Ga0501069_0001737 | |||
| 1135 | Ga0501069_0009778 | |||
| 1136 | Ga0501069_0065803 | |||
| 1137 | Ga0501070_0138846 | |||
| 1138 | Ga0501070_1391165 | |||
| 1139 | Ga0501071_1019015 | |||
| 1140 | Ga0501072_0255024 | |||
| 1141 | Ga0501073_1278461 | |||
| 1142 | Ga0501075_0288237 | |||
| 1143 | Ga0501076_0182966 | |||
| 1144 | Ga0501080_0589336 | |||
| 1145 | Ga0501080_1692176 | |||
| 1146 | nmdc:mga00v17_51010_c1 | |||
| 1147 | nmdc:mga0rr50_505101_c1 | |||
| 1148 | Ga0495601_0000983 | |||
| 1149 | Ga0495601_0104266 | |||
| 1150 | Ga0495601_0106827 | |||
| 1151 | Ga0495601_0398422 | |||
| 1152 | Ga0495612_0084162 | |||
| 1153 | Ga0495612_0358996 | |||
| 1154 | Ga0495595_0002532 | |||
| 1155 | Ga0495595_0008406 | |||
| 1156 | Ga0495619_0003772 | |||
| 1157 | Ga0495619_0025735 | |||
| 1158 | Ga0495619_0443274 | |||
| 1159 | Ga0495619_0651618 | |||
| 1160 | Ga0495619_0879457 | |||
| 1161 | Ga0495619_0915616 | |||
| 1162 | Ga0501084_1303273 | |||
| 1163 | Ga0501082_1692672 | |||
| 1164 | Ga0466962_0004435 | |||
| 1165 | Ga0466962_0626642 | |||
| 1166 | Ga0530510_0015632 | |||
| 1167 | Ga0530510_0183466 | |||
| 1168 | Ga0530510_0405787 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.9583 | 6 | 105 |
| 1o51-assembly1.cif.gz_A | crystal structure of a putative pii-like signaling protein (tm0021) from thermotoga maritima at 2.50 a resolution | 0.9271 | 6 | 105 |
| 2dcl-assembly1.cif.gz_C-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.897 | 3 | 105 |
| 2dcl-assembly1.cif.gz_B-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8952 | 3 | 105 |
| 2dcl-assembly1.cif.gz_C-2 | structure of ph1503 protein from pyrococcus horikoshii ot3 | 0.8881 | 3 | 105 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9503 | 7 | 105 | 3.30.70.120 |
| 1o51A00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.9185 | 7 | 105 | 3.30.70.120 |
| 2dclC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.897 | 3 | 105 | 3.30.70.120 |
| 2dclC00 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8882 | 3 | 105 | 3.30.70.120 |
| af_Q58919_1_108_3.30.70.120 | Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; | 0.8366 | 6 | 113 | 3.30.70.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A660V0E6-F1-model_v4 | DUF190 domain-containing protein | 0.9369 | 1 | 111 |
|
| AF-A0A645A900-F1-model_v4 | Uncharacterized protein | 0.9365 | 4 | 110 |
|
| AF-A0A2H0LUP4-F1-model_v4 | Uncharacterized protein | 0.9319 | 1 | 109 |
|
| AF-A0A2H0M287-F1-model_v4 | Uncharacterized protein | 0.9308 | 1 | 109 |
|
| AF-A0A4R5BGI5-F1-model_v4 | DUF190 domain-containing protein | 0.9301 | 1 | 114 |
|