F466322

General Info

Members Datasets Scaffolds Average Seq Length
583 439 327 220

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2551306091|2551727294
Length 224
Sequence LPHGRAGQSAPIAPLNIVKTDPESFIRANTDILAPPHVPEIRLHLAGEAHELWLKTEEELERIGLPPPFWAFAWAGGQGXRGRRVIDFASGSGLVAIAAKLAGADEVVAADIDPWSETAARLNAGLNGVSFAFTGDDIVGSERAADVYLAGDVFYDKSFADLLLPWFEALERAGAVVLVGDPGRAYCPRGRMTDLATYEVPVTRALEDSEVKRTTVWRFGTLTG

Samples

Sample ID Description Type Environment
1 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
2 2509276019 Ensifer aridi TW10 Isolate Nodule
3 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
4 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
5 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
8 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
9 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
10 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
14 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
15 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
16 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
21 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
22 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
23 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
24 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
25 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
26 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
27 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
28 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
29 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
30 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
31 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
32 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
33 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
34 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
35 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
36 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
37 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
38 2643221557 Ensifer sp. Root558 Isolate Unclassified
39 2643221610 Ensifer sp. Root74 Isolate Unclassified
40 2643221618 Ensifer sp. Root231 Isolate Unclassified
41 2643221626 Ensifer sp. Root31 Isolate Unclassified
42 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
43 2643221655 Ensifer sp. Root1252 Isolate Unclassified
44 2643221659 Ensifer sp. Root127 Isolate Unclassified
45 2643221668 Ensifer sp. Root423 Isolate Unclassified
46 2643221675 Ensifer sp. Root1298 Isolate Unclassified
47 2643221680 Ensifer sp. Root1312 Isolate Unclassified
48 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
49 2643221698 Ensifer sp. Root142 Isolate Unclassified
50 2643221712 Ensifer sp. Root258 Isolate Unclassified
51 2643221723 Ensifer sp. Root278 Isolate Unclassified
52 2643221726 Ensifer sp. Root954 Isolate Unclassified
53 2718217882 Rhizobium sp. N741 Isolate Nodule
54 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
55 2718218009 Rhizobium sp. N561 Isolate Nodule
56 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
57 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
58 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
59 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
60 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
61 2718218363 Rhizobium sp. N113 Isolate Nodule
62 2718218365 Rhizobium sp. N731 Isolate Nodule
63 2718218366 Rhizobium sp. N621 Isolate Nodule
64 2721755514 Rhizobium sp. N6212 Isolate Nodule
65 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
66 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
67 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
68 2721755810 Rhizobium sp. N871 Isolate Nodule
69 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
70 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
71 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
72 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
73 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
74 2728369365 Rhizobium sp. N1341 Isolate Nodule
75 2728369397 Rhizobium sp. N1314 Isolate Nodule
76 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
77 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
78 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
79 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
80 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
81 2791355264 Rhizobium sp. S9 Isolate Nodule
82 2791355265 Rhizobium sp. H4 Isolate Nodule
83 2791355267 Rhizobium sp. L18 Isolate Nodule
84 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
85 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
86 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
87 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
88 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
89 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
90 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
91 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
92 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
93 2838048938 Rhizobium pisi 27/80 Isolate Nodule
94 2838061910 Rhizobium phaseoli L15 Isolate Nodule
95 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
96 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
97 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
98 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
99 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
100 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
101 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
102 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
103 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
104 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
105 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
106 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
107 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
108 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
109 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
110 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
111 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
112 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
113 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
114 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
115 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
116 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
117 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
118 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
119 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
120 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
121 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
122 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
123 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
124 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
125 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
126 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
127 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
128 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
129 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
130 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
131 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
132 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
133 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
134 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
135 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
136 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
137 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
138 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
139 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
140 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
141 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
142 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
143 2844163670 Ensifer sp. 1H6 Isolate Unclassified
144 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
145 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
146 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
147 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
148 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
149 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
150 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
151 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
152 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
153 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
154 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
155 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
156 2885342637 Mesorhizobium sp. M4A.F.Ca.ET.050.02.1.1 Isolate Nodule
157 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
158 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
159 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
160 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
161 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
162 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
163 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
164 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
165 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
166 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
167 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
168 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
169 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
170 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
171 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
172 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
173 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
174 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
175 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
176 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
177 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
178 2933599457 Rhizobium phaseoli M3 Isolate Nodule
179 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
180 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
181 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
182 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
183 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
184 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
185 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
186 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
187 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
188 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
189 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
190 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
191 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
192 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
193 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
194 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
195 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
196 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
197 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
198 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
199 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
200 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
201 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
202 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
203 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
204 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
205 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
206 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
207 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
208 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
209 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
210 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
211 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
212 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
213 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
214 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
215 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
216 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
217 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
218 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
219 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
220 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
221 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
222 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
223 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
224 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
225 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
226 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
227 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
228 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
229 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
230 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
231 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
232 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
233 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
234 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
235 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
236 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
237 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
238 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
239 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
240 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
241 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
242 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
243 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
244 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
245 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
246 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
247 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
248 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
249 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
250 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
251 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
252 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
253 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
254 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
255 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
256 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
257 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
258 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
259 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
260 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
261 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
262 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
263 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
264 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
265 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
266 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
267 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
268 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
269 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
270 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
271 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
272 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
273 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
274 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
275 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
276 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
277 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
278 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
279 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
280 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
281 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
282 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
283 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
284 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
287 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
288 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
289 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
290 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
291 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
292 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
293 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
294 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
295 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
297 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
298 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
299 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
300 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
302 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
304 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
305 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
308 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
309 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
310 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
311 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
312 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
314 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
315 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
316 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
317 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
318 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
319 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
320 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
321 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
322 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
323 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
324 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
325 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
326 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
327 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
328 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
329 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
330 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
331 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
332 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
333 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
334 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
335 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
336 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
337 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
338 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
339 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
340 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
341 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
342 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
343 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
344 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
345 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
346 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
347 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
348 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
349 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
350 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
351 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
352 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
353 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
354 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
355 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
356 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
357 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
358 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
359 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
360 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
361 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
362 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
363 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
366 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
367 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
373 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
374 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
375 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
376 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
377 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
378 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
379 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
380 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
381 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
383 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
384 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
387 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
388 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
391 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
392 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
393 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
394 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
395 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
396 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
397 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
398 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
399 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
400 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
401 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
402 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
403 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
404 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
405 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
406 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
407 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
408 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
409 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
410 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
411 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
412 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
413 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
414 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
415 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
416 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
417 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
418 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
419 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
420 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
421 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
422 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
423 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
424 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
425 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
426 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
427 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
428 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
429 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
430 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
431 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
432 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
433 8018176218 Rhizobium sp. N122 Isolate Nodule
434 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
435 8024501048 Rhizobium sp. H4 Isolate Nodule
436 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
437 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
438 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
439 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 56.09
Metatranscriptomes 0
Isolates 43.91

Biome Distribution

Category Percentage (%)
Aerial Root 0.69
Bulb 0
Endosphere 24.01
Nodule 38.59
Rhizoplane 1.2
Rhizosphere 17.84
Stem 0
Stem Tuber 0
Unclassified 17.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000102 3300002705 Bacteria 62463
2 JGI25162J39368_1000879 3300002737 Bacteria 19691
3 JGI25154J39366_1000184 3300002738 Bacteria 48243
4 JGI25158J39367_1000526 3300002739 Bacteria 7697
5 JGI25157J39369_1000009 3300002741 Bacteria 207868
6 JGI25152J39213_1001245 3300002773 Bacteria 11620
7 JGI25152J39213_1008129 3300002773 Bacteria 2634
8 JGI25159J45721_1000053 3300002987 Bacteria 56912
9 JGI25159J45721_1000262 3300002987 Bacteria 24623
10 JGI25151J46595_10010648 3300003187 Bacteria 4259
11 JGI25151J46595_10014524 3300003187 Bacteria 3504
12 JGI25151J46595_10076496 3300003187 Bacteria 988
13 JGI25165J46597_1001977 3300003214 Bacteria 7923
14 JGI25153J46596_10001485 3300003215 Bacteria 13976
15 JGI25153J46596_10019108 3300003215 Bacteria 2634
16 JGI25153J46596_10019385 3300003215 Bacteria 2609
17 JGI25153J46596_10025490 3300003215 Bacteria 2112
18 JGI25160J50197_1000168 3300003354 Bacteria 56596
19 JGI25160J50197_1000235 3300003354 Bacteria 43030
20 JGI25160J50197_1001817 3300003354 Bacteria 10303
21 JGI25161J50226_1000137 3300003374 Bacteria 50627
22 JGI25161J50226_1000175 3300003374 Bacteria 43039
23 JGI25161J50226_1001177 3300003374 Bacteria 8615
24 Ga0055526_1002546 3300003771 Bacteria 12243
25 Ga0055526_1002794 3300003771 Bacteria 11559
26 Ga0055526_1017168 3300003771 Bacteria 2784
27 Ga0055524_1002053 3300003775 Bacteria 10695
28 Ga0055536_1002743 3300003781 Bacteria 9744
29 Ga0055528_1005279 3300003790 Bacteria 6051
30 Ga0055540_1038734 3300003792 Bacteria 1043
31 Ga0055531_10003576 3300003794 Bacteria 9857
32 Ga0058692_1006673 3300003856 Bacteria 3141
33 Ga0058692_1007029 3300003856 Bacteria 3026
34 Ga0055543_1000226 3300004625 Bacteria 44983
35 Ga0055543_1000321 3300004625 Bacteria 33172
36 Ga0055543_1000412 3300004625 Bacteria 26967
37 Ga0055543_1002493 3300004625 Bacteria 6044
38 Ga0065165_1000133 3300005262 Bacteria 128540
39 Ga0065165_1002250 3300005262 Bacteria 17103
40 Ga0070670_100000183 3300005331 Bacteria 57446
41 Ga0070682_100160508 3300005337 Bacteria 1552
42 Ga0070665_100118172 3300005548 Bacteria 2653
43 Ga0068856_100014117 3300005614 Bacteria 7725
44 Ga0075365_10022037 3300006038 Bacteria 3984
45 Ga0075365_10540550 3300006038 Bacteria 824
46 Ga0075368_10000370 3300006042 Bacteria 13204
47 Ga0075362_10005758 3300006177 Bacteria 4564
48 Ga0075362_10041266 3300006177 Bacteria 2035
49 Ga0075367_10214809 3300006178 Bacteria 1203
50 Ga0075369_10007006 3300006186 Bacteria 4280
51 Ga0075369_10009744 3300006186 Bacteria 3741
52 Ga0075366_10015737 3300006195 Bacteria 4342
53 Ga0075370_10000923 3300006353 Bacteria 12065
54 Ga0075370_10036562 3300006353 Bacteria 2758
55 Ga0079104_1019653 3300006946 Bacteria 1881
56 Ga0099826_10030104 3300006948 Bacteria 3947
57 Ga0105243_10018422 3300009148 Bacteria 5289
58 Ga0157373_10007612 3300013100 Bacteria 8048
59 Ga0157371_10000108 3300013102 Bacteria 126288
60 Ga0157370_10000720 3300013104 Bacteria 41451
61 Ga0157369_10054912 3300013105 Bacteria 4300
62 Ga0171463_1004 3300013249 Bacteria 437207
63 Ga0183363_1208 3300015690 Bacteria 11915
64 Ga0214544_1000024 3300021320 Bacteria 163562
65 Ga0214542_1000008 3300021321 Bacteria 278895
66 Ga0214542_1034512 3300021321 Bacteria 1630
67 Ga0214543_1000031 3300021327 Bacteria 206436
68 Ga0214543_1000053 3300021327 Bacteria 141797
69 Ga0228711_1000050 3300022739 Bacteria 81399
70 Ga0228710_1000063 3300022740 Bacteria 81399
71 Ga0209435_100009 3300025206 Bacteria 476614
72 Ga0209436_100299 3300025208 Bacteria 22971
73 Ga0209436_101476 3300025208 Bacteria 8154
74 Ga0209672_104990 3300025228 Bacteria 2350
75 Ga0209563_102664 3300025230 Bacteria 3946
76 Ga0209437_100057 3300025233 Bacteria 362922
77 Ga0209437_100107 3300025233 Bacteria 218656
78 Ga0207425_1001864 3300025245 Bacteria 8100
79 Ga0209646_1000018 3300025246 Bacteria 476716
80 Ga0209646_1010312 3300025246 Bacteria 1465
81 Ga0209026_1000068 3300025250 Bacteria 207601
82 Ga0209759_1000007 3300025256 Bacteria 476614
83 Ga0209759_1027110 3300025256 Bacteria 1188
84 Ga0209129_1001411 3300025258 Bacteria 13452
85 Ga0209129_1002128 3300025258 Bacteria 10070
86 Ga0209129_1002320 3300025258 Bacteria 9438
87 Ga0209129_1007959 3300025258 Bacteria 3035
88 Ga0209233_1000072 3300025261 Bacteria 363074
89 Ga0209233_1000134 3300025261 Bacteria 202535
90 Ga0209673_1000052 3300025273 Bacteria 279795
91 Ga0209673_1000459 3300025273 Bacteria 68727
92 Ga0209673_1024436 3300025273 Bacteria 2030
93 Ga0209130_1000009 3300025284 Bacteria 498952
94 Ga0209130_1000027 3300025284 Bacteria 327700
95 Ga0209130_1000132 3300025284 Bacteria 119765
96 Ga0209130_1032805 3300025284 Bacteria 1056
97 Ga0209676_1001384 3300025292 Bacteria 23645
98 Ga0209025_1000042 3300025294 Bacteria 370577
99 Ga0209025_1000241 3300025294 Bacteria 128329
100 Ga0209025_1001035 3300025294 Bacteria 40774
101 Ga0209025_1017322 3300025294 Bacteria 4169
102 Ga0209025_1020286 3300025294 Bacteria 3644
103 Ga0209025_1068563 3300025294 Bacteria 1273
104 Ga0209025_1068620 3300025294 Bacteria 1272
105 Ga0209564_1000111 3300025295 Bacteria 212210
106 Ga0209564_1000569 3300025295 Bacteria 58592
107 Ga0209564_1006046 3300025295 Bacteria 6668
108 Ga0209758_1002002 3300025297 Bacteria 21937
109 Ga0209758_1005244 3300025297 Bacteria 10149
110 Ga0209758_1014392 3300025297 Bacteria 4211
111 Ga0209758_1019160 3300025297 Bacteria 3315
112 Ga0209758_1028111 3300025297 Bacteria 2387
113 Ga0209758_1043029 3300025297 Bacteria 1668
114 Ga0209758_1057280 3300025297 Bacteria 1311
115 Ga0209050_1008253 3300025298 Bacteria 5613
116 Ga0209256_1000132 3300025299 Bacteria 160806
117 Ga0209256_1000361 3300025299 Bacteria 73723
118 Ga0209256_1002153 3300025299 Bacteria 16996
119 Ga0209256_1002711 3300025299 Bacteria 13805
120 Ga0209256_1011367 3300025299 Bacteria 3571
121 Ga0209256_1019551 3300025299 Bacteria 2150
122 Ga0209256_1019624 3300025299 Bacteria 2144
123 Ga0207426_1000041 3300025302 Bacteria 433536
124 Ga0207426_1000072 3300025302 Bacteria 327700
125 Ga0207426_1000246 3300025302 Bacteria 119765
126 Ga0207426_1000723 3300025302 Bacteria 38116
127 Ga0209051_1003573 3300025303 Bacteria 10112
128 Ga0209051_1013102 3300025303 Bacteria 3965
129 Ga0209051_1018700 3300025303 Bacteria 3056
130 Ga0209257_1001613 3300025304 Bacteria 25850
131 Ga0209257_1031551 3300025304 Bacteria 1693
132 Ga0209257_1060092 3300025304 Bacteria 1035
133 Ga0207650_10000151 3300025925 Bacteria 83229
134 Ga0207709_10143847 3300025935 Bacteria 1643
135 Ga0207678_10016101 3300026067 Bacteria 6566
136 Ga0207702_10014459 3300026078 Bacteria 6553
137 Ga0209281_1000030 3300027111 Bacteria 425931
138 Ga0209281_1000840 3300027111 Bacteria 27410
139 Ga0209371_1000037 3300027312 Bacteria 367074
140 Ga0209371_1001857 3300027312 Bacteria 12997
141 Ga0209371_1008497 3300027312 Bacteria 3402
142 Ga0209282_1000004 3300027666 Bacteria 425931
143 Ga0209282_1000283 3300027666 Bacteria 25146
144 Ga0209282_1039116 3300027666 Bacteria 2833
145 Ga0209813_10000828 3300027866 Bacteria 7008
146 Ga0268265_10652163 3300028380 Bacteria 1012
147 Ga0307515_10000377 3300028794 Bacteria 109082
148 Ga0307515_10016274 3300028794 Bacteria 13625
149 Ga0307515_10033701 3300028794 Bacteria 8418
150 Ga0307515_10458804 3300028794 Bacteria 889
151 Ga0268256_1000039 3300030500 Bacteria 354969
152 Ga0268256_1002298 3300030500 Bacteria 9905
153 Ga0268256_1008786 3300030500 Bacteria 3431
154 Ga0307513_10001888 3300031456 Bacteria 29770
155 Ga0307413_10664400 3300031824 Bacteria 861
156 Ga0307410_10188008 3300031852 Bacteria 1569
157 Ga0307410_10469622 3300031852 Bacteria 1030
158 Ga0315914_1000001 3300031967 Bacteria 416633
159 Ga0315913_1000024 3300033430 Bacteria 90863
160 Ga0315915_1000002 3300033464 Bacteria 425854
161 Ga0373923_0263581 3300035111 Bacteria 809
162 Ga0373927_0000135 3300035695 Bacteria 56787
163 Ga0373925_0001135 3300037068 Bacteria 23635
164 Ga0395900_0092735 3300037418 Bacteria 3103
165 Ga0395905_0001126 3300037471 Bacteria 33477
166 Ga0395905_0136682 3300037471 Bacteria 2306
167 Ga0395901_0320823 3300038443 Bacteria 1603
168 Ga0400488_01324 3300038741 Bacteria 1034
169 Ga0439438_044942 3300041405 Bacteria 1137
170 Ga0439447_043642 3300041407 Bacteria 1086
171 Ga0439465_0008566 3300041413 Bacteria 3227
172 Ga0439465_0085351 3300041413 Bacteria 1075
173 Ga0451787_328280 3300041441 Bacteria 1979
174 Ga0451849_0612694 3300041505 Bacteria 1022
175 Ga0451853_1929787 3300041512 Bacteria 1682
176 Ga0439433_0094624 3300041999 Bacteria 737
177 Ga0439449_0031021 3300042007 Bacteria 1992
178 Ga0439462_0017774 3300042015 Bacteria 1843
179 Ga0450906_008285 3300042145 Bacteria 2017
180 Ga0450907_012720 3300042146 Bacteria 1401
181 Ga0439434_0110972 3300042435 Bacteria 888
182 Ga0466963_0057534 3300044694 Bacteria 2589
183 Ga0466970_0023346 3300044765 Bacteria 3229
184 Ga0466957_0252803 3300044842 Bacteria 1172
185 Ga0466958_0031431 3300045836 Bacteria 3155
186 Ga0466967_0177688 3300045976 Bacteria 2006
187 Ga0495590_0008145 3300046457 Bacteria 4013
188 Ga0495605_0259809 3300046474 Bacteria 741
189 Ga0495607_0278492 3300046501 Bacteria 794
190 Ga0495583_0100666 3300046506 Bacteria 1234
191 Ga0495606_0011138 3300046507 Bacteria 7371
192 Ga0495610_0023092 3300046512 Bacteria 3389
193 Ga0495610_0135631 3300046512 Bacteria 1064
194 Ga0495616_0002338 3300046513 Bacteria 12653
195 Ga0495620_0017309 3300046515 Bacteria 3596
196 Ga0495632_0026520 3300046519 Bacteria 3049
197 Ga0495609_0012502 3300046538 Bacteria 4027
198 Ga0495609_0070523 3300046538 Bacteria 1536
199 Ga0495597_0077195 3300046542 Bacteria 1428
200 Ga0495633_0053812 3300046558 Bacteria 1894
201 Ga0495668_0025481 3300046616 Bacteria 3360
202 Ga0495625_0014610 3300046660 Bacteria 6256
203 Ga0495625_0059406 3300046660 Bacteria 2713
204 Ga0495625_0328812 3300046660 Bacteria 971
205 Ga0495670_0138369 3300046691 Bacteria 1272
206 Ga0495649_0034639 3300046694 Bacteria 2778
207 Ga0495660_0015869 3300046810 Bacteria 4346
208 Ga0495636_0029106 3300047318 Bacteria 2254
209 Ga0495687_115828 3300047443 Bacteria 976
210 Ga0495686_0045229 3300047472 Bacteria 2785
211 Ga0495686_0126052 3300047472 Bacteria 1522
212 Ga0495626_0064869 3300048091 Bacteria 1654
213 Ga0496104_0070681 3300048907 Bacteria 3319
214 Ga0496106_0002113 3300048909 Bacteria 14850
215 Ga0496106_0227374 3300048909 Bacteria 1489
216 Ga0496116_0016742 3300048919 Bacteria 5722
217 Ga0496116_0020118 3300048919 Bacteria 5079
218 Ga0496116_0134532 3300048919 Bacteria 1402
219 Ga0496117_0000031 3300048920 Bacteria 381048
220 Ga0496117_0004678 3300048920 Bacteria 14866
221 Ga0496117_0017870 3300048920 Bacteria 5908
222 Ga0496117_0120834 3300048920 Bacteria 1609
223 Ga0496117_0176067 3300048920 Bacteria 1236
224 Ga0496117_0259116 3300048920 Bacteria 944
225 Ga0496118_0001884 3300048921 Bacteria 29940
226 Ga0496118_0004259 3300048921 Bacteria 17116
227 Ga0496118_0017624 3300048921 Bacteria 6488
228 Ga0496118_0208467 3300048921 Bacteria 1149
229 Ga0496119_0036562 3300048922 Bacteria 3203
230 Ga0496119_0058927 3300048922 Bacteria 2310
231 Ga0496119_0059077 3300048922 Bacteria 2306
232 Ga0496119_0060203 3300048922 Bacteria 2275
233 Ga0496119_0091575 3300048922 Bacteria 1726
234 Ga0496120_0001817 3300048923 Bacteria 23874
235 Ga0496120_0014950 3300048923 Bacteria 5143
236 Ga0496120_0056595 3300048923 Bacteria 2212
237 Ga0496120_0280621 3300048923 Bacteria 770
238 Ga0496121_0000034 3300048924 Bacteria 377095
239 Ga0496121_0275544 3300048924 Bacteria 1154
240 Ga0496122_0000023 3300048925 Bacteria 381035
241 Ga0496122_0002284 3300048925 Bacteria 27720
242 Ga0496122_0125444 3300048925 Bacteria 1644
243 Ga0496122_0173935 3300048925 Bacteria 1293
244 Ga0496122_0271258 3300048925 Bacteria 934
245 Ga0496123_0000027 3300048926 Bacteria 306773
246 Ga0496123_0000290 3300048926 Bacteria 98053
247 Ga0496123_0031088 3300048926 Bacteria 3892
248 Ga0496123_0044983 3300048926 Bacteria 3012
249 Ga0496123_0053721 3300048926 Bacteria 2660
250 Ga0496123_0079503 3300048926 Bacteria 2003
251 Ga0496124_0008017 3300048927 Bacteria 11111
252 Ga0496124_0009644 3300048927 Bacteria 9889
253 Ga0496124_0271971 3300048927 Bacteria 1240
254 Ga0496125_0000030 3300048928 Bacteria 375023
255 Ga0496125_0003346 3300048928 Bacteria 19530
256 Ga0496125_0014218 3300048928 Bacteria 7760
257 Ga0496125_0133085 3300048928 Bacteria 1746
258 Ga0496125_0216734 3300048928 Bacteria 1237
259 Ga0496125_0248521 3300048928 Bacteria 1124
260 Ga0496125_0288152 3300048928 Bacteria 1013
261 Ga0496126_0002222 3300048929 Bacteria 26858
262 Ga0496126_0004878 3300048929 Bacteria 15705
263 Ga0496126_0009461 3300048929 Bacteria 10344
264 Ga0496126_0034327 3300048929 Bacteria 4764
265 Ga0496126_0192147 3300048929 Bacteria 1728
266 Ga0496126_0251933 3300048929 Bacteria 1471
267 Ga0496126_0253787 3300048929 Bacteria 1464
268 Ga0495678_016669 3300049459 Bacteria 3352
269 Ga0495682_0007963 3300049460 Bacteria 4190
270 Ga0501031_0027698 3300049568 Bacteria 3694
271 Ga0501033_0000518 3300049570 Bacteria 36156
272 Ga0501033_0077311 3300049570 Bacteria 2442
273 Ga0501033_0314726 3300049570 Bacteria 1100
274 Ga0501034_0251782 3300049571 Bacteria 1711
275 Ga0501034_0486126 3300049571 Bacteria 1149
276 Ga0501036_0115040 3300049572 Bacteria 2273
277 Ga0501037_0056639 3300049573 Bacteria 2862
278 Ga0501039_0058415 3300049575 Bacteria 2988
279 Ga0501043_0161588 3300049579 Bacteria 1750
280 Ga0501043_0165230 3300049579 Bacteria 1728
281 Ga0501047_0078900 3300049581 Bacteria 3166
282 Ga0501047_0174214 3300049581 Bacteria 2020
283 Ga0501048_0047427 3300049582 Bacteria 3066
284 Ga0501083_0040593 3300049744 Bacteria 3158
285 Ga0501035_0000316 3300049822 Bacteria 55833
286 Ga0501035_0167364 3300049822 Bacteria 1900
287 nmdc:mga03683_10202_c1 3300050489 Bacteria 3364
288 nmdc:mga03n38_74528_c1 3300050490 Bacteria 1579
289 nmdc:mga03n38_84582_c1 3300050490 Bacteria 1498
290 nmdc:mga00v17_229530_c1 3300050491 Bacteria 1203
291 nmdc:mga00v17_360_c1 3300050491 Bacteria 25745
292 nmdc:mga0yw44_10819_c2 3300050492 Bacteria 2203
293 nmdc:mga0yw44_1402_c1 3300050492 Bacteria 9555
294 nmdc:mga0yw44_257407_c1 3300050492 Bacteria 1163
295 nmdc:mga0yw44_48194_c1 3300050492 Bacteria 2569
296 nmdc:mga0k408_68217_c1 3300050493 Bacteria 2074
297 nmdc:mga06z11_137765_c1 3300050494 Bacteria 1377
298 nmdc:mga06z11_60498_c1 3300050494 Bacteria 1972
299 nmdc:mga06z11_7031_c1 3300050494 Bacteria 4614
300 nmdc:mga07m45_139912_c1 3300050496 Bacteria 1402
301 nmdc:mga07m45_211356_c1 3300050496 Bacteria 1129
302 nmdc:mga07m45_2146_c1 3300050496 Bacteria 2716
303 nmdc:mga0sz30_1057_c1 3300050516 Bacteria 9929
304 Ga0500651_0350323 3300053093 Bacteria 838
305 Ga0500560_000732 3300053107 Bacteria 4959
306 Ga0500569_021327 3300053109 Bacteria 1711
307 Ga0500569_094345 3300053109 Bacteria 973
308 Ga0500572_003603 3300053111 Bacteria 3525
309 Ga0500594_0001734 3300053118 Bacteria 4745
310 Ga0500618_003034 3300053125 Bacteria 5964
311 Ga0500658_0000112 3300053134 Bacteria 38407
312 Ga0500658_0136052 3300053134 Bacteria 1099
313 Ga0500659_0101648 3300053135 Bacteria 1489
314 Ga0500559_0002392 3300053136 Bacteria 9741
315 Ga0500561_0000170 3300053137 Bacteria 12023
316 Ga0500568_0011712 3300053139 Bacteria 4054
317 Ga0500604_0016781 3300053151 Bacteria 2019
318 Ga0500604_0041820 3300053151 Bacteria 1387
319 Ga0500616_0048868 3300053153 Bacteria 2241
320 Ga0500616_0226166 3300053153 Bacteria 813
321 Ga0500620_000075 3300053155 Bacteria 19025
322 Ga0500622_0001966 3300053156 Bacteria 15471
323 Ga0500633_0005614 3300053160 Bacteria 2999
324 Ga0500636_0000025 3300053177 Bacteria 86697
325 Ga0501084_0242070 3300054114 Bacteria 1523
326 Ga0501082_0055900 3300060353 Bacteria 3399
327 Ga0501082_0647102 3300060353 Bacteria 925

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2515154134 2515741527 210
2 iso_pu_bacteria 2516653085 2517078250 210
3 iso_pu_bacteria 2724679232 2725947472 210
4 iso_pu_bacteria 2765235942 2766064337 210
5 iso_pu_bacteria 2838686498 2838690214 210
6 iso_pu_bacteria 2838729681 2838731989 210
7 iso_pu_bacteria 2838742623 2838744885 210
8 iso_pu_bacteria 2841851746 2841855942 210
9 iso_pu_bacteria 2842110456 2842116925 210
10 iso_pu_bacteria 2842156927 2842161112 210
11 iso_pu_bacteria 2842163707 2842166630 210
12 iso_pu_bacteria 2842180545 2842184728 210
13 iso_pu_bacteria 2842229732 2842232311 210
14 iso_pu_bacteria 2842243621 2842246726 210
15 iso_pu_bacteria 2842257432 2842261172 210
16 iso_pu_bacteria 2842271015 2842274234 210
17 iso_pu_bacteria 2842304105 2842305919 210
18 iso_pu_bacteria 2844454524 2844457088 210
19 iso_pu_bacteria 2857516855 2857519502 210
20 iso_pu_bacteria 2933570622 2933572424 210
21 iso_pu_bacteria 2933586486 2933593071 210
22 iso_pu_bacteria 2935901341 2935903698 210
23 iso_pu_bacteria 8005307578 8005313635 210
24 iso_pu_bacteria 8023680758 8023686473 210
25 iso_pu_bacteria 2582581866 2585396005 211
26 iso_pu_bacteria 2885318864 2885324478 211
27 iso_pu_bacteria 2885342637 2885344913 211
28 iso_pu_bacteria 2885350715 2885357740 211
29 iso_pu_bacteria 2508501122 2509109488 212
30 iso_pu_bacteria 2509276019 2509378202 212
31 iso_pu_bacteria 2512047086 2512534496 212
32 iso_pu_bacteria 2512875026 2512973693 212
33 iso_pu_bacteria 2513237085 2513578601 212
34 iso_pu_bacteria 2513237089 2513601789 212
35 iso_pu_bacteria 2513237156 2513984064 212
36 iso_pu_bacteria 2513237160 2514003627 212
37 iso_pu_bacteria 2517487022 2517571304 212
38 iso_pu_bacteria 2524023207 2524450552 212
39 iso_pu_bacteria 2529292951 2530647410 212
40 iso_pu_bacteria 2558860100 2558867312 212
41 iso_pu_bacteria 2582581865 2585387910 212
42 iso_pu_bacteria 2599185352 2600193463 212
43 iso_pu_bacteria 2643221557 2643808154 212
44 iso_pu_bacteria 2643221610 2644068657 212
45 iso_pu_bacteria 2643221618 2644110062 212
46 iso_pu_bacteria 2643221626 2644150338 212
47 iso_pu_bacteria 2643221655 2644312942 212
48 iso_pu_bacteria 2643221659 2644336490 212
49 iso_pu_bacteria 2643221668 2644379588 212
50 iso_pu_bacteria 2643221675 2644419726 212
51 iso_pu_bacteria 2643221680 2644453083 212
52 iso_pu_bacteria 2643221698 2644546136 212
53 iso_pu_bacteria 2643221712 2644618672 212
54 iso_pu_bacteria 2643221723 2644677182 212
55 iso_pu_bacteria 2643221726 2644688888 212
56 iso_pu_bacteria 2718217882 2719182902 212
57 iso_pu_bacteria 2718217997 2719667245 212
58 iso_pu_bacteria 2718218009 2719733619 212
59 iso_pu_bacteria 2718218199 2720493665 212
60 iso_pu_bacteria 2718218232 2720615120 212
61 iso_pu_bacteria 2718218233 2720621913 212
62 iso_pu_bacteria 2718218235 2720633263 212
63 iso_pu_bacteria 2718218269 2720776962 212
64 iso_pu_bacteria 2718218363 2721149014 212
65 iso_pu_bacteria 2718218365 2721160412 212
66 iso_pu_bacteria 2718218366 2721165827 212
67 iso_pu_bacteria 2721755514 2722841997 212
68 iso_pu_bacteria 2721755556 2723028561 212
69 iso_pu_bacteria 2721755684 2723562163 212
70 iso_pu_bacteria 2721755685 2723568866 212
71 iso_pu_bacteria 2721755810 2724046375 212
72 iso_pu_bacteria 2721755819 2724091569 212
73 iso_pu_bacteria 2721755822 2724106131 212
74 iso_pu_bacteria 2721755823 2724111936 212
75 iso_pu_bacteria 2728369352 2730109497 212
76 iso_pu_bacteria 2728369365 2730166137 212
77 iso_pu_bacteria 2728369397 2730300044 212
78 iso_pu_bacteria 2751185821 2753463723 212
79 iso_pu_bacteria 2791355082 2792582136 212
80 iso_pu_bacteria 2791355094 2792641332 212
81 iso_pu_bacteria 2791355253 2793281108 212
82 iso_pu_bacteria 2791355264 2793346539 212
83 iso_pu_bacteria 2791355265 2793353926 212
84 iso_pu_bacteria 2802428858 2802717329 212
85 iso_pu_bacteria 2802428859 2802724682 212
86 iso_pu_bacteria 2802428860 2802729434 212
87 iso_pu_bacteria 2802428861 2802736779 212
88 iso_pu_bacteria 2802428862 2802743185 212
89 iso_pu_bacteria 2802428863 2802749689 212
90 iso_pu_bacteria 2802429605 2805926147 212
91 iso_pu_bacteria 2838016132 2838018396 212
92 iso_pu_bacteria 2838048938 2838050742 212
93 iso_pu_bacteria 2838061910 2838062507 212
94 iso_pu_bacteria 2838068647 2838072059 212
95 iso_pu_bacteria 2838074704 2838078267 212
96 iso_pu_bacteria 2838680041 2838683956 212
97 iso_pu_bacteria 2838694306 2838698485 212
98 iso_pu_bacteria 2838701080 2838705640 212
99 iso_pu_bacteria 2838707686 2838711600 212
100 iso_pu_bacteria 2841864319 2841867823 212
101 iso_pu_bacteria 2842077413 2842081401 212
102 iso_pu_bacteria 2842118031 2842121822 212
103 iso_pu_bacteria 2842146304 2842149970 212
104 iso_pu_bacteria 2842192696 2842194951 212
105 iso_pu_bacteria 2842237096 2842240837 212
106 iso_pu_bacteria 2842250916 2842255320 212
107 iso_pu_bacteria 2842264693 2842269573 212
108 iso_pu_bacteria 2842285085 2842288448 212
109 iso_pu_bacteria 2842291075 2842295058 212
110 iso_pu_bacteria 2842311132 2842311346 212
111 iso_pu_bacteria 2842317721 2842321042 212
112 iso_pu_bacteria 2842363717 2842366337 212
113 iso_pu_bacteria 2842370503 2842374924 212
114 iso_pu_bacteria 2842377471 2842381457 212
115 iso_pu_bacteria 2842384541 2842388527 212
116 iso_pu_bacteria 2842402390 2842406206 212
117 iso_pu_bacteria 2842409023 2842412791 212
118 iso_pu_bacteria 2842415677 2842419330 212
119 iso_pu_bacteria 2842422224 2842425691 212
120 iso_pu_bacteria 2842428310 2842433531 212
121 iso_pu_bacteria 2842434925 2842439859 212
122 iso_pu_bacteria 2842441272 2842446488 212
123 iso_pu_bacteria 2842447887 2842448845 212
124 iso_pu_bacteria 2842462802 2842467838 212
125 iso_pu_bacteria 2842469257 2842474468 212
126 iso_pu_bacteria 2842489311 2842491095 212
127 iso_pu_bacteria 2842495871 2842498432 212
128 iso_pu_bacteria 2844163670 2844164261 212
129 iso_pu_bacteria 2850079185 2850082548 212
130 iso_pu_bacteria 2855825444 2855827282 212
131 iso_pu_bacteria 2855839649 2855842664 212
132 iso_pu_bacteria 2858800743 2858803475 212
133 iso_pu_bacteria 2891373044 2891373844 212
134 iso_pu_bacteria 2913295892 2913300074 212
135 iso_pu_bacteria 2915980308 2915982544 212
136 iso_pu_bacteria 2916028427 2916031236 212
137 iso_pu_bacteria 2920760137 2920760448 212
138 iso_pu_bacteria 2920822456 2920825843 212
139 iso_pu_bacteria 2921201388 2921205898 212
140 iso_pu_bacteria 2921257292 2921257702 212
141 iso_pu_bacteria 2924158325 2924161153 212
142 iso_pu_bacteria 2924165586 2924169926 212
143 iso_pu_bacteria 2924172951 2924173347 212
144 iso_pu_bacteria 2924193448 2924193693 212
145 iso_pu_bacteria 2924207177 2924209343 212
146 iso_pu_bacteria 2933599457 2933603087 212
147 iso_pu_bacteria 2935894831 2935897866 212
148 iso_pu_bacteria 2937036028 2937036097 212
149 iso_pu_bacteria 2941499720 2941501258 212
150 iso_pu_bacteria 2970143518 2970143717 212
151 iso_pu_bacteria 2989349275 2989354836 212
152 iso_pu_bacteria 8005282627 8005286813 212
153 iso_pu_bacteria 8005430974 8005431040 212
154 iso_pu_bacteria 8005497431 8005497609 212
155 iso_pu_bacteria 8005563573 8005565729 212
156 iso_pu_bacteria 8005619151 8005623343 212
157 iso_pu_bacteria 8005626139 8005631077 212
158 iso_pu_bacteria 8005668836 8005669014 212
159 iso_pu_bacteria 8024501048 8024502394 212
160 iso_pu_bacteria 8049293176 8049296165 212
161 iso_pu_bacteria 2847670302 2847673806 213
162 iso_pu_bacteria 2856314179 2856320543 213
163 iso_pu_bacteria 2878035449 2878038958 213
164 iso_pu_bacteria 2906414383 2906421322 213
165 iso_pu_bacteria 8055431914 8055435632 213
166 3300003215 JGI25153J46596_10019385 JGI25153J46596_100193852 214
167 3300003354 JGI25160J50197_1001817 JGI25160J50197_10018172 214
168 3300003771 Ga0055526_1017168 Ga0055526_10171684 214
169 3300003790 Ga0055528_1005279 Ga0055528_10052792 214
170 3300003856 Ga0058692_1006673 Ga0058692_10066735 214
171 3300004625 Ga0055543_1002493 Ga0055543_10024936 214
172 3300006038 Ga0075365_10022037 Ga0075365_100220375 214
173 3300006042 Ga0075368_10000370 Ga0075368_100003706 214
174 3300006177 Ga0075362_10005758 Ga0075362_100057584 214
175 3300006177 Ga0075362_10041266 Ga0075362_100412664 214
176 3300006186 Ga0075369_10009744 Ga0075369_100097444 214
177 3300006195 Ga0075366_10015737 Ga0075366_100157376 214
178 3300006353 Ga0075370_10000923 Ga0075370_100009238 214
179 3300009148 Ga0105243_10018422 Ga0105243_100184226 214
180 3300013100 Ga0157373_10007612 Ga0157373_100076126 214
181 3300013102 Ga0157371_10000108 Ga0157371_1000010824 214
182 3300013104 Ga0157370_10000720 Ga0157370_1000072017 214
183 3300013105 Ga0157369_10054912 Ga0157369_100549126 214
184 3300025258 Ga0209129_1001411 Ga0209129_10014116 214
185 3300025273 Ga0209673_1000052 Ga0209673_100005292 214
186 3300025273 Ga0209673_1000459 Ga0209673_10004597 214
187 3300025294 Ga0209025_1001035 Ga0209025_100103527 214
188 3300025294 Ga0209025_1068563 Ga0209025_10685632 214
189 3300025295 Ga0209564_1000569 Ga0209564_100056953 214
190 3300025297 Ga0209758_1002002 Ga0209758_10020026 214
191 3300025297 Ga0209758_1019160 Ga0209758_10191603 214
192 3300025299 Ga0209256_1002711 Ga0209256_10027112 214
193 3300025299 Ga0209256_1011367 Ga0209256_10113672 214
194 3300025299 Ga0209256_1019551 Ga0209256_10195514 214
195 3300025302 Ga0207426_1000723 Ga0207426_10007235 214
196 3300025303 Ga0209051_1018700 Ga0209051_10187002 214
197 3300025304 Ga0209257_1031551 Ga0209257_10315511 214
198 3300025935 Ga0207709_10143847 Ga0207709_101438474 214
199 3300027312 Ga0209371_1001857 Ga0209371_10018578 214
200 3300027866 Ga0209813_10000828 Ga0209813_100008282 214
201 3300028794 Ga0307515_10458804 Ga0307515_104588042 214
202 3300030500 Ga0268256_1008786 Ga0268256_10087865 214
203 3300035111 Ga0373923_0263581 Ga0373923_0263581_113_757 214
204 3300035695 Ga0373927_0000135 Ga0373927_0000135_35514_36158 214
205 3300037068 Ga0373925_0001135 Ga0373925_0001135_11483_12127 214
206 3300037471 Ga0395905_0001126 Ga0395905_0001126_22753_23397 214
207 3300038443 Ga0395901_0320823 Ga0395901_0320823_332_976 214
208 3300038741 Ga0400488_01324 Ga0400488_01324_175_819 214
209 3300041441 Ga0451787_328280 Ga0451787_328280_1202_1849 214
210 3300046474 Ga0495605_0259809 Ga0495605_0259809_16_663 214
211 3300046501 Ga0495607_0278492 Ga0495607_0278492_27_710 214
212 3300046506 Ga0495583_0100666 Ga0495583_0100666_465_1148 214
213 3300046507 Ga0495606_0011138 Ga0495606_0011138_1293_1976 214
214 3300046512 Ga0495610_0023092 Ga0495610_0023092_1149_1832 214
215 3300046515 Ga0495620_0017309 Ga0495620_0017309_1594_2277 214
216 3300046519 Ga0495632_0026520 Ga0495632_0026520_715_1398 214
217 3300046538 Ga0495609_0070523 Ga0495609_0070523_20_703 214
218 3300046542 Ga0495597_0077195 Ga0495597_0077195_592_1275 214
219 3300046558 Ga0495633_0053812 Ga0495633_0053812_51_698 214
220 3300046660 Ga0495625_0014610 Ga0495625_0014610_5198_5881 214
221 3300046660 Ga0495625_0059406 Ga0495625_0059406_247_894 214
222 3300046660 Ga0495625_0328812 Ga0495625_0328812_197_874 214
223 3300046691 Ga0495670_0138369 Ga0495670_0138369_345_1028 214
224 3300046694 Ga0495649_0034639 Ga0495649_0034639_946_1629 214
225 3300046810 Ga0495660_0015869 Ga0495660_0015869_1948_2631 214
226 3300047318 Ga0495636_0029106 Ga0495636_0029106_1479_2162 214
227 3300047443 Ga0495687_115828 Ga0495687_115828_82_765 214
228 3300047472 Ga0495686_0045229 Ga0495686_0045229_2005_2688 214
229 3300048091 Ga0495626_0064869 Ga0495626_0064869_338_1021 214
230 3300048907 Ga0496104_0070681 Ga0496104_0070681_382_1026 214
231 3300048909 Ga0496106_0227374 Ga0496106_0227374_529_1173 214
232 3300048919 Ga0496116_0020118 Ga0496116_0020118_493_1137 214
233 3300048920 Ga0496117_0000031 Ga0496117_0000031_113278_113922 214
234 3300048920 Ga0496117_0017870 Ga0496117_0017870_2163_2807 214
235 3300048920 Ga0496117_0120834 Ga0496117_0120834_404_1048 214
236 3300048920 Ga0496117_0176067 Ga0496117_0176067_157_801 214
237 3300048921 Ga0496118_0001884 Ga0496118_0001884_25584_26228 214
238 3300048921 Ga0496118_0004259 Ga0496118_0004259_14486_15133 214
239 3300048921 Ga0496118_0017624 Ga0496118_0017624_5176_5820 214
240 3300048922 Ga0496119_0036562 Ga0496119_0036562_1805_2449 214
241 3300048922 Ga0496119_0058927 Ga0496119_0058927_1521_2165 214
242 3300048922 Ga0496119_0091575 Ga0496119_0091575_191_835 214
243 3300048923 Ga0496120_0001817 Ga0496120_0001817_19674_20318 214
244 3300048923 Ga0496120_0014950 Ga0496120_0014950_3371_4015 214
245 3300048923 Ga0496120_0056595 Ga0496120_0056595_927_1571 214
246 3300048924 Ga0496121_0000034 Ga0496121_0000034_277230_277874 214
247 3300048924 Ga0496121_0275544 Ga0496121_0275544_237_881 214
248 3300048925 Ga0496122_0000023 Ga0496122_0000023_113278_113922 214
249 3300048925 Ga0496122_0173935 Ga0496122_0173935_230_874 214
250 3300048926 Ga0496123_0000027 Ga0496123_0000027_267114_267758 214
251 3300048926 Ga0496123_0044983 Ga0496123_0044983_1196_1840 214
252 3300048926 Ga0496123_0079503 Ga0496123_0079503_92_736 214
253 3300048927 Ga0496124_0009644 Ga0496124_0009644_4180_4824 214
254 3300048928 Ga0496125_0000030 Ga0496125_0000030_96645_97289 214
255 3300048928 Ga0496125_0014218 Ga0496125_0014218_4189_4833 214
256 3300048928 Ga0496125_0216734 Ga0496125_0216734_193_837 214
257 3300048929 Ga0496126_0002222 Ga0496126_0002222_23235_23879 214
258 3300048929 Ga0496126_0034327 Ga0496126_0034327_3991_4635 214
259 3300048929 Ga0496126_0192147 Ga0496126_0192147_563_1207 214
260 3300048929 Ga0496126_0253787 Ga0496126_0253787_563_1207 214
261 3300049459 Ga0495678_016669 Ga0495678_016669_836_1519 214
262 3300050489 nmdc:mga03683_10202_c1 nmdc:mga03683_10202_c1_290_937 214
263 3300050490 nmdc:mga03n38_74528_c1 nmdc:mga03n38_74528_c1_130_774 214
264 3300050490 nmdc:mga03n38_84582_c1 nmdc:mga03n38_84582_c1_314_961 214
265 3300050491 nmdc:mga00v17_229530_c1 nmdc:mga00v17_229530_c1_506_1150 214
266 3300050491 nmdc:mga00v17_360_c1 nmdc:mga00v17_360_c1_15855_16499 214
267 3300050492 nmdc:mga0yw44_10819_c2 nmdc:mga0yw44_10819_c2_1280_1927 214
268 3300050492 nmdc:mga0yw44_257407_c1 nmdc:mga0yw44_257407_c1_487_1131 214
269 3300050492 nmdc:mga0yw44_48194_c1 nmdc:mga0yw44_48194_c1_1893_2537 214
270 3300050493 nmdc:mga0k408_68217_c1 nmdc:mga0k408_68217_c1_458_1105 214
271 3300050494 nmdc:mga06z11_137765_c1 nmdc:mga06z11_137765_c1_557_1201 214
272 3300050494 nmdc:mga06z11_60498_c1 nmdc:mga06z11_60498_c1_1171_1815 214
273 3300050494 nmdc:mga06z11_7031_c1 nmdc:mga06z11_7031_c1_756_1403 214
274 3300050496 nmdc:mga07m45_139912_c1 nmdc:mga07m45_139912_c1_171_815 214
275 3300050496 nmdc:mga07m45_211356_c1 nmdc:mga07m45_211356_c1_115_759 214
276 3300050496 nmdc:mga07m45_2146_c1 nmdc:mga07m45_2146_c1_863_1510 214
277 3300050516 nmdc:mga0sz30_1057_c1 nmdc:mga0sz30_1057_c1_6686_7330 214
278 3300053107 Ga0500560_000732 Ga0500560_000732_3092_3736 214
279 3300053109 Ga0500569_021327 Ga0500569_021327_909_1592 214
280 3300053111 Ga0500572_003603 Ga0500572_003603_2593_3237 214
281 3300053125 Ga0500618_003034 Ga0500618_003034_2846_3490 214
282 3300053134 Ga0500658_0000112 Ga0500658_0000112_10044_10727 214
283 3300053135 Ga0500659_0101648 Ga0500659_0101648_240_923 214
284 3300053136 Ga0500559_0002392 Ga0500559_0002392_2082_2726 214
285 3300053137 Ga0500561_0000170 Ga0500561_0000170_3755_4399 214
286 3300053151 Ga0500604_0041820 Ga0500604_0041820_91_735 214
287 3300053153 Ga0500616_0048868 Ga0500616_0048868_86_730 214
288 3300053177 Ga0500636_0000025 Ga0500636_0000025_25558_26202 214
289 iso_pu_bacteria 2643221636 2644201464 214
290 iso_pu_bacteria 2643221686 2644484432 214
291 3300002773 JGI25152J39213_1001245 JGI25152J39213_100124514 215
292 3300002773 JGI25152J39213_1008129 JGI25152J39213_10081293 215
293 3300002987 JGI25159J45721_1000262 JGI25159J45721_100026218 215
294 3300003187 JGI25151J46595_10076496 JGI25151J46595_100764962 215
295 3300003215 JGI25153J46596_10001485 JGI25153J46596_100014852 215
296 3300003215 JGI25153J46596_10019108 JGI25153J46596_100191083 215
297 3300003215 JGI25153J46596_10025490 JGI25153J46596_100254903 215
298 3300003374 JGI25161J50226_1000137 JGI25161J50226_100013742 215
299 3300003771 Ga0055526_1002794 Ga0055526_100279412 215
300 3300004625 Ga0055543_1000321 Ga0055543_10003215 215
301 3300005337 Ga0070682_100160508 Ga0070682_1001605082 215
302 3300005548 Ga0070665_100118172 Ga0070665_1001181724 215
303 3300025208 Ga0209436_100299 Ga0209436_10029917 215
304 3300025230 Ga0209563_102664 Ga0209563_1026644 215
305 3300025245 Ga0207425_1001864 Ga0207425_10018649 215
306 3300025258 Ga0209129_1002128 Ga0209129_10021285 215
307 3300025258 Ga0209129_1002320 Ga0209129_100232010 215
308 3300025258 Ga0209129_1007959 Ga0209129_10079593 215
309 3300025273 Ga0209673_1024436 Ga0209673_10244362 215
310 3300025284 Ga0209130_1000009 Ga0209130_1000009325 215
311 3300025294 Ga0209025_1017322 Ga0209025_10173221 215
312 3300025294 Ga0209025_1020286 Ga0209025_10202865 215
313 3300025294 Ga0209025_1068620 Ga0209025_10686201 215
314 3300025295 Ga0209564_1006046 Ga0209564_10060467 215
315 3300025297 Ga0209758_1005244 Ga0209758_10052449 215
316 3300025297 Ga0209758_1014392 Ga0209758_10143923 215
317 3300025297 Ga0209758_1028111 Ga0209758_10281112 215
318 3300025297 Ga0209758_1043029 Ga0209758_10430293 215
319 3300025299 Ga0209256_1002153 Ga0209256_100215314 215
320 3300025302 Ga0207426_1000041 Ga0207426_1000041263 215
321 3300025303 Ga0209051_1013102 Ga0209051_10131023 215
322 3300025304 Ga0209257_1060092 Ga0209257_10600921 215
323 3300026067 Ga0207678_10016101 Ga0207678_100161015 215
324 3300028380 Ga0268265_10652163 Ga0268265_106521631 215
325 3300028794 Ga0307515_10000377 Ga0307515_1000037727 215
326 3300028794 Ga0307515_10033701 Ga0307515_100337019 215
327 3300031456 Ga0307513_10001888 Ga0307513_1000188821 215
328 3300037418 Ga0395900_0092735 Ga0395900_0092735_170_826 215
329 3300037471 Ga0395905_0136682 Ga0395905_0136682_752_1408 215
330 3300041405 Ga0439438_044942 Ga0439438_044942_39_686 215
331 3300041407 Ga0439447_043642 Ga0439447_043642_197_844 215
332 3300041413 Ga0439465_0008566 Ga0439465_0008566_263_910 215
333 3300041505 Ga0451849_0612694 Ga0451849_0612694_131_778 215
334 3300041512 Ga0451853_1929787 Ga0451853_1929787_616_1263 215
335 3300041999 Ga0439433_0094624 Ga0439433_0094624_69_716 215
336 3300042145 Ga0450906_008285 Ga0450906_008285_179_826 215
337 3300042146 Ga0450907_012720 Ga0450907_012720_556_1203 215
338 3300042435 Ga0439434_0110972 Ga0439434_0110972_119_766 215
339 3300046457 Ga0495590_0008145 Ga0495590_0008145_370_1017 215
340 3300046512 Ga0495610_0135631 Ga0495610_0135631_125_772 215
341 3300047472 Ga0495686_0126052 Ga0495686_0126052_380_1027 215
342 3300048909 Ga0496106_0002113 Ga0496106_0002113_12970_13617 215
343 3300048919 Ga0496116_0016742 Ga0496116_0016742_2530_3177 215
344 3300048919 Ga0496116_0134532 Ga0496116_0134532_117_764 215
345 3300048920 Ga0496117_0259116 Ga0496117_0259116_240_887 215
346 3300048921 Ga0496118_0208467 Ga0496118_0208467_177_824 215
347 3300048925 Ga0496122_0271258 Ga0496122_0271258_192_839 215
348 3300048926 Ga0496123_0053721 Ga0496123_0053721_542_1189 215
349 3300048928 Ga0496125_0288152 Ga0496125_0288152_274_921 215
350 3300048929 Ga0496126_0009461 Ga0496126_0009461_6931_7578 215
351 3300048929 Ga0496126_0251933 Ga0496126_0251933_732_1388 215
352 3300049570 Ga0501033_0000518 Ga0501033_0000518_8835_9482 215
353 3300049571 Ga0501034_0486126 Ga0501034_0486126_157_813 215
354 3300049822 Ga0501035_0000316 Ga0501035_0000316_27804_28451 215
355 3300050492 nmdc:mga0yw44_1402_c1 nmdc:mga0yw44_1402_c1_4629_5276 215
356 3300053093 Ga0500651_0350323 Ga0500651_0350323_101_748 215
357 3300053134 Ga0500658_0136052 Ga0500658_0136052_424_1071 215
358 3300053139 Ga0500568_0011712 Ga0500568_0011712_2261_2908 215
359 3300053151 Ga0500604_0016781 Ga0500604_0016781_1124_1771 215
360 3300053155 Ga0500620_000075 Ga0500620_000075_10306_10962 215
361 3300053156 Ga0500622_0001966 Ga0500622_0001966_2436_3083 215
362 3300053160 Ga0500633_0005614 Ga0500633_0005614_2280_2927 215
363 iso_pu_bacteria 8018150411 8018155121 215
364 3300002737 JGI25162J39368_1000879 JGI25162J39368_100087920 216
365 3300002739 JGI25158J39367_1000526 JGI25158J39367_10005269 216
366 3300002987 JGI25159J45721_1000053 JGI25159J45721_100005334 216
367 3300003187 JGI25151J46595_10010648 JGI25151J46595_100106483 216
368 3300003187 JGI25151J46595_10014524 JGI25151J46595_100145244 216
369 3300003214 JGI25165J46597_1001977 JGI25165J46597_10019775 216
370 3300003354 JGI25160J50197_1000168 JGI25160J50197_100016834 216
371 3300003354 JGI25160J50197_1000235 JGI25160J50197_100023545 216
372 3300003374 JGI25161J50226_1000175 JGI25161J50226_100017545 216
373 3300003374 JGI25161J50226_1001177 JGI25161J50226_10011777 216
374 3300003771 Ga0055526_1002546 Ga0055526_100254612 216
375 3300003775 Ga0055524_1002053 Ga0055524_10020535 216
376 3300003781 Ga0055536_1002743 Ga0055536_10027436 216
377 3300003792 Ga0055540_1038734 Ga0055540_10387341 216
378 3300003794 Ga0055531_10003576 Ga0055531_100035768 216
379 3300004625 Ga0055543_1000226 Ga0055543_100022648 216
380 3300004625 Ga0055543_1000412 Ga0055543_100041218 216
381 3300005262 Ga0065165_1000133 Ga0065165_100013391 216
382 3300005262 Ga0065165_1002250 Ga0065165_100225019 216
383 3300005614 Ga0068856_100014117 Ga0068856_1000141174 216
384 3300006038 Ga0075365_10540550 Ga0075365_105405501 216
385 3300006946 Ga0079104_1019653 Ga0079104_10196534 216
386 3300013249 Ga0171463_1004 Ga0171463_1004109 216
387 3300015690 Ga0183363_1208 Ga0183363_12088 216
388 3300021320 Ga0214544_1000024 Ga0214544_10000242 216
389 3300021321 Ga0214542_1000008 Ga0214542_1000008190 216
390 3300021321 Ga0214542_1034512 Ga0214542_10345122 216
391 3300021327 Ga0214543_1000031 Ga0214543_1000031121 216
392 3300021327 Ga0214543_1000053 Ga0214543_100005395 216
393 3300022739 Ga0228711_1000050 Ga0228711_100005012 216
394 3300022740 Ga0228710_1000063 Ga0228710_100006312 216
395 3300025208 Ga0209436_101476 Ga0209436_1014769 216
396 3300025228 Ga0209672_104990 Ga0209672_1049905 216
397 3300025233 Ga0209437_100057 Ga0209437_100057156 216
398 3300025233 Ga0209437_100107 Ga0209437_100107121 216
399 3300025246 Ga0209646_1010312 Ga0209646_10103123 216
400 3300025256 Ga0209759_1027110 Ga0209759_10271102 216
401 3300025261 Ga0209233_1000072 Ga0209233_100007247 216
402 3300025261 Ga0209233_1000134 Ga0209233_1000134156 216
403 3300025284 Ga0209130_1000027 Ga0209130_1000027109 216
404 3300025284 Ga0209130_1000132 Ga0209130_100013248 216
405 3300025284 Ga0209130_1032805 Ga0209130_10328052 216
406 3300025292 Ga0209676_1001384 Ga0209676_100138420 216
407 3300025294 Ga0209025_1000042 Ga0209025_1000042350 216
408 3300025294 Ga0209025_1000241 Ga0209025_1000241108 216
409 3300025295 Ga0209564_1000111 Ga0209564_1000111110 216
410 3300025297 Ga0209758_1057280 Ga0209758_10572802 216
411 3300025298 Ga0209050_1008253 Ga0209050_10082536 216
412 3300025299 Ga0209256_1000132 Ga0209256_100013243 216
413 3300025299 Ga0209256_1000361 Ga0209256_100036133 216
414 3300025299 Ga0209256_1019624 Ga0209256_10196244 216
415 3300025302 Ga0207426_1000072 Ga0207426_1000072206 216
416 3300025302 Ga0207426_1000246 Ga0207426_100024648 216
417 3300025303 Ga0209051_1003573 Ga0209051_10035739 216
418 3300025304 Ga0209257_1001613 Ga0209257_100161322 216
419 3300026078 Ga0207702_10014459 Ga0207702_100144594 216
420 3300027111 Ga0209281_1000030 Ga0209281_1000030322 216
421 3300027111 Ga0209281_1000840 Ga0209281_100084024 216
422 3300027666 Ga0209282_1000004 Ga0209282_1000004322 216
423 3300031824 Ga0307413_10664400 Ga0307413_106644002 216
424 3300031967 Ga0315914_1000001 Ga0315914_100000162 216
425 3300033430 Ga0315913_1000024 Ga0315913_100002431 216
426 3300033464 Ga0315915_1000002 Ga0315915_1000002323 216
427 3300041413 Ga0439465_0085351 Ga0439465_0085351_296_964 216
428 3300042007 Ga0439449_0031021 Ga0439449_0031021_47_715 216
429 3300042015 Ga0439462_0017774 Ga0439462_0017774_852_1514 216
430 3300044694 Ga0466963_0057534 Ga0466963_0057534_291_941 216
431 3300044765 Ga0466970_0023346 Ga0466970_0023346_2209_2859 216
432 3300044842 Ga0466957_0252803 Ga0466957_0252803_261_911 216
433 3300045836 Ga0466958_0031431 Ga0466958_0031431_354_1004 216
434 3300045976 Ga0466967_0177688 Ga0466967_0177688_1268_1918 216
435 3300048920 Ga0496117_0004678 Ga0496117_0004678_12056_12712 216
436 3300048922 Ga0496119_0060203 Ga0496119_0060203_1354_2010 216
437 3300048925 Ga0496122_0002284 Ga0496122_0002284_22229_22885 216
438 3300048926 Ga0496123_0000290 Ga0496123_0000290_72071_72727 216
439 3300048927 Ga0496124_0008017 Ga0496124_0008017_2492_3148 216
440 3300048927 Ga0496124_0271971 Ga0496124_0271971_63_713 216
441 3300048928 Ga0496125_0003346 Ga0496125_0003346_6543_7199 216
442 3300048928 Ga0496125_0133085 Ga0496125_0133085_526_1176 216
443 3300048928 Ga0496125_0248521 Ga0496125_0248521_76_732 216
444 3300048929 Ga0496126_0004878 Ga0496126_0004878_12476_13132 216
445 3300049568 Ga0501031_0027698 Ga0501031_0027698_629_1285 216
446 3300049570 Ga0501033_0077311 Ga0501033_0077311_1550_2206 216
447 3300049570 Ga0501033_0314726 Ga0501033_0314726_198_848 216
448 3300049571 Ga0501034_0251782 Ga0501034_0251782_122_799 216
449 3300049572 Ga0501036_0115040 Ga0501036_0115040_242_898 216
450 3300049573 Ga0501037_0056639 Ga0501037_0056639_179_835 216
451 3300049575 Ga0501039_0058415 Ga0501039_0058415_300_950 216
452 3300049579 Ga0501043_0161588 Ga0501043_0161588_1041_1718 216
453 3300049579 Ga0501043_0165230 Ga0501043_0165230_521_1177 216
454 3300049581 Ga0501047_0078900 Ga0501047_0078900_2177_2854 216
455 3300049581 Ga0501047_0174214 Ga0501047_0174214_651_1301 216
456 3300049582 Ga0501048_0047427 Ga0501048_0047427_1011_1661 216
457 3300049744 Ga0501083_0040593 Ga0501083_0040593_84_761 216
458 3300049822 Ga0501035_0167364 Ga0501035_0167364_100_756 216
459 3300054114 Ga0501084_0242070 Ga0501084_0242070_704_1381 216
460 3300060353 Ga0501082_0055900 Ga0501082_0055900_1312_1989 216
461 3300060353 Ga0501082_0647102 Ga0501082_0647102_21_671 216
462 iso_pu_bacteria 2551306091 2551727294 217
463 3300053153 Ga0500616_0226166 Ga0500616_0226166_110_778 219
464 iso_pu_bacteria 650716007 650741111 219
465 3300048922 Ga0496119_0059077 Ga0496119_0059077_1520_2182 220
466 3300048923 Ga0496120_0280621 Ga0496120_0280621_45_707 220
467 3300048925 Ga0496122_0125444 Ga0496122_0125444_336_998 220
468 3300048926 Ga0496123_0031088 Ga0496123_0031088_1979_2641 220
469 3300005331 Ga0070670_100000183 Ga0070670_10000018336 221
470 3300025925 Ga0207650_10000151 Ga0207650_1000015134 221
471 iso_pu_bacteria 2600255279 2601610783 222
472 iso_pu_bacteria 2600255308 2601747557 222
473 iso_pu_bacteria 2818991439 2819560907 222
474 iso_pu_bacteria 2933006813 2933010684 222
475 iso_pu_bacteria 2933594066 2933597617 222
476 iso_pu_bacteria 2979100975 2979104450 222
477 iso_pu_bacteria 2984509177 2984513754 222
478 iso_pu_bacteria 2984518228 2984522668 222
479 iso_pu_bacteria 2984537506 2984541974 222
480 iso_pu_bacteria 2984601300 2984601404 222
481 iso_pu_bacteria 2878753008 2878760013 224
482 iso_pu_bacteria 2881861095 2881867187 224
483 iso_pu_bacteria 2903492973 2903494247 224
484 iso_pu_bacteria 2924784321 2924790817 224
485 iso_pu_bacteria 2961170736 2961177284 224
486 iso_pu_bacteria 2967996073 2968002387 224
487 iso_pu_bacteria 2968003550 2968009618 224
488 iso_pu_bacteria 2970503327 2970509958 224
489 iso_pu_bacteria 2977821940 2977828535 224
490 iso_pu_bacteria 2977828996 2977829663 224
491 iso_pu_bacteria 2979808191 2979814834 224
492 iso_pu_bacteria 8004374579 8004381512 224
493 3300003856 Ga0058692_1007029 Ga0058692_10070295 226
494 3300006178 Ga0075367_10214809 Ga0075367_102148092 226
495 3300006186 Ga0075369_10007006 Ga0075369_100070065 226
496 3300006948 Ga0099826_10030104 Ga0099826_100301043 226
497 3300027312 Ga0209371_1000037 Ga0209371_100003791 226
498 3300027666 Ga0209282_1000283 Ga0209282_10002834 226
499 3300027666 Ga0209282_1039116 Ga0209282_10391163 226
500 3300030500 Ga0268256_1000039 Ga0268256_1000039218 226
501 3300031852 Ga0307410_10469622 Ga0307410_104696221 226
502 iso_pu_bacteria 2513237159 2513998548 226
503 iso_pu_bacteria 2791355267 2793365840 227
504 iso_pu_bacteria 8018176218 8018177081 227
505 iso_pu_bacteria 8056375014 8056380349 227
506 iso_pu_bacteria 2510065057 2510305357 228
507 iso_pu_bacteria 2511231052 2511503225 228
508 iso_pu_bacteria 2513237086 2513586099 228
509 iso_pu_bacteria 2513237091 2513615615 228
510 iso_pu_bacteria 2513237140 2513884190 228
511 iso_pu_bacteria 2513237143 2513903519 228
512 iso_pu_bacteria 2515154107 2515610963 228
513 iso_pu_bacteria 2516653046 2516894656 228
514 iso_pu_bacteria 2551306084 2551675887 228
515 iso_pu_bacteria 2551306085 2551689613 228
516 iso_pu_bacteria 2551306086 2551693318 228
517 iso_pu_bacteria 2551306087 2551703303 228
518 iso_pu_bacteria 2551306089 2551709408 228
519 iso_pu_bacteria 2551306090 2551723760 228
520 iso_pu_bacteria 2551306092 2551734706 228
521 iso_pu_bacteria 2551306093 2551741024 228
522 iso_pu_bacteria 2936996657 2936997559 228
523 iso_pu_bacteria 2937009748 2937013674 228
524 iso_pu_bacteria 2937016420 2937019108 228
525 iso_pu_bacteria 2937023124 2937024782 228
526 iso_pu_bacteria 2937049772 2937051125 228
527 iso_pu_bacteria 2937106411 2937106700 228
528 iso_pu_bacteria 2937126314 2937132663 228
529 iso_pu_bacteria 2957395598 2957400517 228
530 iso_pu_bacteria 2957415311 2957416601 228
531 iso_pu_bacteria 2957457609 2957463743 228
532 iso_pu_bacteria 2957464669 2957470678 228
533 iso_pu_bacteria 2957478035 2957483963 228
534 iso_pu_bacteria 2957484790 2957485692 228
535 iso_pu_bacteria 2957498199 2957502980 228
536 iso_pu_bacteria 2960584000 2960587002 228
537 iso_pu_bacteria 2960624210 2960624930 228
538 iso_pu_bacteria 2960660292 2960664286 228
539 iso_pu_bacteria 2964607997 2964609626 228
540 iso_pu_bacteria 2964656573 2964657402 228
541 iso_pu_bacteria 2964670856 2964674246 228
542 iso_pu_bacteria 2964678106 2964683083 228
543 iso_pu_bacteria 2964705432 2964707906 228
544 iso_pu_bacteria 2964712639 2964712887 228
545 iso_pu_bacteria 2967671571 2967673513 228
546 iso_pu_bacteria 2967706974 2967711412 228
547 iso_pu_bacteria 2967721400 2967722583 228
548 iso_pu_bacteria 2967735183 2967739022 228
549 iso_pu_bacteria 2967748971 2967749874 228
550 iso_pu_bacteria 2967762386 2967768122 228
551 iso_pu_bacteria 2970061556 2970062355 228
552 iso_pu_bacteria 2970082768 2970086371 228
553 iso_pu_bacteria 2970116247 2970122353 228
554 iso_pu_bacteria 2970129317 2970133729 228
555 iso_pu_bacteria 2970136068 2970138159 228
556 iso_pu_bacteria 2970170962 2970175015 228
557 iso_pu_bacteria 2970177841 2970178822 228
558 iso_pu_bacteria 2970184632 2970186912 228
559 iso_pu_bacteria 2977558990 2977559691 228
560 iso_pu_bacteria 2977579622 2977585491 228
561 iso_pu_bacteria 648276728 648737104 228
562 iso_pu_bacteria 8003992118 8003995246 228
563 iso_pu_bacteria 8054558443 8054560172 228
564 iso_pu_bacteria 2838668709 2838672882 230
565 iso_pu_bacteria 8005688590 8005694404 230
566 3300006353 Ga0075370_10036562 Ga0075370_100365624 231
567 3300028794 Ga0307515_10016274 Ga0307515_100162745 231
568 3300046513 Ga0495616_0002338 Ga0495616_0002338_11050_11760 231
569 3300046538 Ga0495609_0012502 Ga0495609_0012502_1799_2509 231
570 3300046616 Ga0495668_0025481 Ga0495668_0025481_1677_2387 231
571 3300049460 Ga0495682_0007963 Ga0495682_0007963_2422_3132 231
572 3300053109 Ga0500569_094345 Ga0500569_094345_236_946 231
573 3300053118 Ga0500594_0001734 Ga0500594_0001734_3274_3984 231
574 3300031852 Ga0307410_10188008 Ga0307410_101880082 232
575 3300002705 JGI25156J39149_1000102 JGI25156J39149_100010257 238
576 3300002738 JGI25154J39366_1000184 JGI25154J39366_100018411 238
577 3300002741 JGI25157J39369_1000009 JGI25157J39369_100000955 238
578 3300025206 Ga0209435_100009 Ga0209435_100009314 238
579 3300025246 Ga0209646_1000018 Ga0209646_1000018314 238
580 3300025250 Ga0209026_1000068 Ga0209026_100006856 238
581 3300025256 Ga0209759_1000007 Ga0209759_1000007314 238
582 3300027312 Ga0209371_1008497 Ga0209371_10084972 238
583 3300030500 Ga0268256_1002298 Ga0268256_100229812 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06325

PrmA

Ribosomal protein L11 methyltransferase (PrmA)

72

153

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ori-assembly1.cif.gz_A structure of the predominant protein arginine methyltransferase prmt1 0.818 85 171
4qqn-assembly1.cif.gz_A-2 protein arginine methyltransferase 3 in complex with compound mtv044246 0.796 83 171
8g2f-assembly1.cif.gz_A-2 crystal structure of prmt3 with compound ii710 0.7958 83 171
4ryl-assembly1.cif.gz_A human protein arginine methyltransferase 3 in complex with 1-isoquinolin-6-yl-3-[2-oxo-2-(pyrrolidin-1-yl)ethyl]urea 0.7952 83 171
1orh-assembly1.cif.gz_A structure of the predominant protein arginine methyltransferase prmt1 0.7947 85 181
ID Description Score Start End Superfamily
af_Q8IXQ9_82_251_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9625 72 202 3.40.50.150
af_O01503_44_226_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8959 66 206 3.40.50.150
af_A0A1D6EFY7_537_616_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.894 96 154 3.40.50.150
af_Q4CTF2_4_246_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8505 93 139 3.40.50.150
af_A4I047_66_249_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8448 77 179 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A436IY35-F1-model_v4 deleted 0.987 71 235
AF-A0A2P2E907-F1-model_v4 Ribosomal protein L11 methyltransferase 0.9855 27 235 GO:0005840
GO:0016279
GO:0032259
AF-A0A256FAM0-F1-model_v4 Methyltransferase family protein 0.9837 27 236 GO:0016279
GO:0032259
AF-A0A519PNX6-F1-model_v4 Methyltransferase 0.983 27 144 GO:0016279
GO:0032259
AF-A0A651G2J7-F1-model_v4 Methyltransferase 0.9768 24 237 GO:0016279
GO:0032259

Feature Viewer

pLDDT pTM Quality
86.58 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map