F466311

General Info

Members Datasets Scaffolds Average Seq Length
583 298 1166 126

Family's Representative Sequence

Representative Sequence 3300048914|Ga0496111_0529876|Ga0496111_0529876_266_718
Length 150
Sequence MADALSFSLVEHDLVGKPVSTFPDHALMDAPHLPRQALIDAHGSGGFRFAGLSHRGSLLCLPDGIWAWPVGDPATLSEEAFARVFAQAGELDFFVLGTGAAPWITPEPLRVRFRTAQISLDTMTTAAAVRTYNVMLMESRRVGAGLIAVA

Samples

Sample ID Description Type Environment
1 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
30 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
33 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
34 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
35 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
36 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
41 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
44 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
45 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
46 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
68 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
69 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
72 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
76 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
77 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
111 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
112 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
113 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
114 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
116 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
118 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
119 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
120 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
121 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
122 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
123 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
124 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
125 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
126 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
129 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
130 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
131 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
132 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
133 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
134 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
137 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
140 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
143 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
144 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
145 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
148 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
151 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
152 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
153 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
154 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
166 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
172 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
173 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
174 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
175 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
176 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
179 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
180 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
181 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
182 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
183 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
184 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
185 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
186 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
187 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
188 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
191 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
192 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
193 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
194 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
195 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
196 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
197 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
198 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
199 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
202 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
203 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
204 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
205 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
208 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
209 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
210 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
211 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
212 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
213 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
214 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
215 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
216 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
217 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
218 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
219 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
220 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
230 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
231 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
232 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
235 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
236 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
237 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
244 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
250 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
251 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
253 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
254 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
255 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
256 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
257 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
258 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
259 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
260 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
261 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
262 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
263 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
264 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
270 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
271 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
272 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
273 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
274 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
275 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
276 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
284 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
285 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
286 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
287 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
288 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
289 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
290 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
291 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
292 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
293 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
294 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
295 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
296 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
297 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
298 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.38
Nodule 0
Rhizoplane 3.26
Rhizosphere 86.28
Stem 0
Stem Tuber 0
Unclassified 3.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496111_0529876 3300048914 Bacteria 866
2 Ga0070658_10566224 3300005327 Bacteria 984
3 Ga0070670_100029561 3300005331 Bacteria 4717
4 Ga0070680_100068210 3300005336 Bacteria 2919
5 Ga0068868_101996248 3300005338 Bacteria 551
6 Ga0070689_101939045 3300005340 Bacteria 538
7 Ga0070691_10035972 3300005341 Bacteria 2333
8 Ga0070691_10037095 3300005341 Bacteria 2299
9 Ga0070661_100516248 3300005344 Bacteria 958
10 Ga0070668_101035791 3300005347 Bacteria 739
11 Ga0070675_100102845 3300005354 Bacteria 2407
12 Ga0070671_100019566 3300005355 Bacteria 5512
13 Ga0070673_100159623 3300005364 Bacteria 1916
14 Ga0070659_100927847 3300005366 Bacteria 762
15 Ga0070667_100127843 3300005367 Bacteria 2216
16 Ga0070709_10072263 3300005434 Bacteria 2229
17 Ga0070709_10093689 3300005434 Bacteria 1986
18 Ga0070714_100020343 3300005435 Bacteria 5418
19 Ga0070714_100149659 3300005435 Bacteria 2102
20 Ga0070713_100034091 3300005436 Bacteria 4085
21 Ga0070713_100367483 3300005436 Bacteria 1338
22 Ga0070710_10393899 3300005437 Bacteria 927
23 Ga0070710_10401081 3300005437 Bacteria 919
24 Ga0070711_100042680 3300005439 Bacteria 3067
25 Ga0070711_100313397 3300005439 Unclassified 1251
26 Ga0070705_100069044 3300005440 Bacteria 2129
27 Ga0070708_100328333 3300005445 Bacteria 1441
28 Ga0070681_10094369 3300005458 Bacteria 2941
29 Ga0070681_10538672 3300005458 Bacteria 1081
30 Ga0070698_100567820 3300005471 Bacteria 1074
31 Ga0070679_100020870 3300005530 Bacteria 6390
32 Ga0070679_100148950 3300005530 Bacteria 2318
33 Ga0070679_100315502 3300005530 Bacteria 1513
34 Ga0068853_100324133 3300005539 Bacteria 1429
35 Ga0068853_100748923 3300005539 Bacteria 934
36 Ga0070695_100040239 3300005545 Bacteria 2958
37 Ga0070665_100351400 3300005548 Bacteria 1480
38 Ga0070665_102148896 3300005548 Bacteria 562
39 Ga0068855_100010980 3300005563 Bacteria 10929
40 Ga0068854_101596421 3300005578 Bacteria 594
41 Ga0068856_100815502 3300005614 Bacteria 953
42 Ga0070702_100790749 3300005615 Bacteria 733
43 Ga0081455_10001509 3300005937 Bacteria 28740
44 Ga0081538_10026966 3300005981 Bacteria 3998
45 Ga0070717_10041347 3300006028 Bacteria 3757
46 Ga0070717_10053965 3300006028 Bacteria 3313
47 Ga0070717_10347393 3300006028 Bacteria 1326
48 Ga0070717_10732703 3300006028 Bacteria 899
49 Ga0075365_10144979 3300006038 Bacteria 1650
50 Ga0075365_10412240 3300006038 Bacteria 954
51 Ga0075368_10008290 3300006042 Bacteria 3694
52 Ga0075363_100111873 3300006048 Bacteria 1518
53 Ga0075363_100287173 3300006048 Bacteria 953
54 Ga0075364_10242956 3300006051 Bacteria 1223
55 Ga0075364_10253560 3300006051 Bacteria 1196
56 Ga0075364_10312496 3300006051 Bacteria 1070
57 Ga0075364_10622250 3300006051 Bacteria 738
58 Ga0075364_10976827 3300006051 Bacteria 576
59 Ga0075432_10335696 3300006058 Bacteria 637
60 Ga0070715_10026608 3300006163 Bacteria 2303
61 Ga0070715_10107871 3300006163 Bacteria 1309
62 Ga0070715_10401821 3300006163 Bacteria 762
63 Ga0070716_100341975 3300006173 Bacteria 1056
64 Ga0070712_100024609 3300006175 Bacteria 3992
65 Ga0070712_100317503 3300006175 Bacteria 1266
66 Ga0075362_10114075 3300006177 Bacteria 1274
67 Ga0075362_10297370 3300006177 Bacteria 801
68 Ga0075367_10029721 3300006178 Bacteria 3129
69 Ga0075367_10045859 3300006178 Bacteria 2566
70 Ga0075367_10403327 3300006178 Bacteria 865
71 Ga0075367_10930100 3300006178 Bacteria 555
72 Ga0075369_10079427 3300006186 Bacteria 1453
73 Ga0075370_10076506 3300006353 Bacteria 1919
74 Ga0075370_10188671 3300006353 Bacteria 1214
75 Ga0075428_100054116 3300006844 Bacteria 4398
76 Ga0075428_101689192 3300006844 Bacteria 661
77 Ga0075430_100521727 3300006846 Bacteria 980
78 Ga0075430_101816787 3300006846 Bacteria 500
79 Ga0075431_100000033 3300006847 Bacteria 72175
80 Ga0075431_100428718 3300006847 Bacteria 1321
81 Ga0075433_10001904 3300006852 Bacteria 15702
82 Ga0075433_11175763 3300006852 Bacteria 666
83 Ga0075434_100008413 3300006871 Bacteria 9594
84 Ga0075434_100123867 3300006871 Bacteria 2601
85 Ga0075434_101192968 3300006871 Bacteria 773
86 Ga0075429_100167698 3300006880 Bacteria 1923
87 Ga0075436_100003820 3300006914 Bacteria 10333
88 Ga0075436_100157781 3300006914 Bacteria 1599
89 Ga0075436_100978030 3300006914 Bacteria 635
90 Ga0075435_100038491 3300007076 Bacteria 3813
91 Ga0075435_100059230 3300007076 Bacteria 3104
92 Ga0105240_10018094 3300009093 Bacteria 9475
93 Ga0111539_10033184 3300009094 Bacteria 6268
94 Ga0111539_10091935 3300009094 Bacteria 3565
95 Ga0111539_10375770 3300009094 Bacteria 1654
96 Ga0105245_10415621 3300009098 Bacteria 1347
97 Ga0114129_10014704 3300009147 Bacteria 11149
98 Ga0114129_10081763 3300009147 Bacteria 4490
99 Ga0114129_10104440 3300009147 Bacteria 3915
100 Ga0114129_11095497 3300009147 Bacteria 997
101 Ga0114129_12101237 3300009147 Bacteria 681
102 Ga0105242_11696216 3300009176 Bacteria 668
103 Ga0105248_10137295 3300009177 Bacteria 2758
104 Ga0105248_11821400 3300009177 Bacteria 690
105 Ga0105237_10683910 3300009545 Bacteria 1033
106 Ga0105237_12031184 3300009545 Bacteria 584
107 Ga0105238_11873060 3300009551 Bacteria 632
108 Ga0105249_11878867 3300009553 Bacteria 671
109 Ga0105239_10265383 3300010375 Bacteria 1930
110 Ga0157370_10084055 3300013104 Bacteria 2992
111 Ga0157369_11710841 3300013105 Bacteria 639
112 Ga0157378_10031227 3300013297 Bacteria 4705
113 Ga0157378_10505995 3300013297 Bacteria 1207
114 Ga0163162_10838958 3300013306 Bacteria 1035
115 Ga0157372_11420322 3300013307 Bacteria 800
116 Ga0163163_11548776 3300014325 Bacteria 724
117 Ga0157380_10428624 3300014326 Bacteria 1264
118 Ga0157377_10412003 3300014745 Bacteria 923
119 Ga0157379_10226841 3300014968 Bacteria 1693
120 Ga0157376_11225566 3300014969 Bacteria 779
121 Ga0213874_10145600 3300021377 Bacteria 823
122 Ga0224572_1003950 3300024225 Bacteria 2543
123 Ga0224572_1060953 3300024225 Bacteria 699
124 Ga0228598_1000693 3300024227 Bacteria 7153
125 Ga0228598_1014860 3300024227 Bacteria 1539
126 Ga0207692_10152374 3300025898 Bacteria 1325
127 Ga0207692_10175578 3300025898 Bacteria 1244
128 Ga0207685_10252483 3300025905 Bacteria 853
129 Ga0207685_10736647 3300025905 Unclassified 539
130 Ga0207699_10113978 3300025906 Bacteria 1738
131 Ga0207699_10393940 3300025906 Bacteria 985
132 Ga0207699_10448759 3300025906 Bacteria 925
133 Ga0207705_10334586 3300025909 Bacteria 1165
134 Ga0207684_10950703 3300025910 Bacteria 721
135 Ga0207707_10203548 3300025912 Bacteria 1726
136 Ga0207707_11644679 3300025912 Bacteria 504
137 Ga0207695_10039179 3300025913 Bacteria 5095
138 Ga0207693_10009117 3300025915 Bacteria 8100
139 Ga0207693_10242494 3300025915 Bacteria 1415
140 Ga0207693_10399939 3300025915 Bacteria 1074
141 Ga0207663_10068907 3300025916 Bacteria 2274
142 Ga0207663_10374141 3300025916 Bacteria 1084
143 Ga0207663_10447691 3300025916 Bacteria 995
144 Ga0207663_11345253 3300025916 Unclassified 575
145 Ga0207660_10019021 3300025917 Bacteria 4588
146 Ga0207662_10637462 3300025918 Bacteria 743
147 Ga0207649_10800808 3300025920 Bacteria 735
148 Ga0207652_10091242 3300025921 Bacteria 2678
149 Ga0207650_10035385 3300025925 Bacteria 3626
150 Ga0207687_10298213 3300025927 Bacteria 1297
151 Ga0207700_10203369 3300025928 Bacteria 1670
152 Ga0207700_11003528 3300025928 Bacteria 747
153 Ga0207664_10030116 3300025929 Bacteria 4143
154 Ga0207664_10136523 3300025929 Bacteria 2070
155 Ga0207664_10561325 3300025929 Bacteria 1024
156 Ga0207664_10656831 3300025929 Bacteria 942
157 Ga0207664_10664538 3300025929 Bacteria 937
158 Ga0207644_10006764 3300025931 Bacteria 7473
159 Ga0207706_10084452 3300025933 Bacteria 2791
160 Ga0207670_10664517 3300025936 Bacteria 860
161 Ga0207669_10792482 3300025937 Bacteria 785
162 Ga0207665_10127445 3300025939 Bacteria 1803
163 Ga0207665_10414772 3300025939 Bacteria 1028
164 Ga0207665_11673249 3300025939 Unclassified 504
165 Ga0207679_10458629 3300025945 Bacteria 1131
166 Ga0207667_10028383 3300025949 Bacteria 6079
167 Ga0207667_11844787 3300025949 Bacteria 568
168 Ga0207651_10005889 3300025960 Bacteria 6342
169 Ga0207668_11090133 3300025972 Bacteria 716
170 Ga0207677_12269308 3300026023 Bacteria 505
171 Ga0207703_11690479 3300026035 Bacteria 609
172 Ga0207639_10272371 3300026041 Bacteria 1485
173 Ga0207702_10421543 3300026078 Bacteria 1291
174 Ga0207702_11852910 3300026078 Bacteria 595
175 Ga0207674_10380250 3300026116 Bacteria 1365
176 Ga0207683_10214042 3300026121 Bacteria 1754
177 Ga0209813_10307543 3300027866 Bacteria 617
178 Ga0209813_10413956 3300027866 Bacteria 545
179 Ga0207428_10005560 3300027907 Bacteria 11736
180 Ga0207428_10018543 3300027907 Bacteria 5940
181 Ga0207428_10115770 3300027907 Bacteria 2059
182 Ga0207428_10482553 3300027907 Bacteria 901
183 Ga0265357_1003992 3300028023 Bacteria 1309
184 Ga0265338_10207280 3300028800 Bacteria 1474
185 Ga0265338_11032018 3300028800 Bacteria 556
186 Ga0265763_1003844 3300030763 Bacteria 1210
187 Ga0265770_1159016 3300030878 Bacteria 501
188 Ga0265760_10211058 3300031090 Bacteria 659
189 Ga0265325_10005503 3300031241 Bacteria 7817
190 Ga0265325_10006079 3300031241 Bacteria 7386
191 Ga0265325_10024162 3300031241 Bacteria 3307
192 Ga0265325_10040607 3300031241 Bacteria 2443
193 Ga0265340_10045670 3300031247 Bacteria 2138
194 Ga0265340_10109666 3300031247 Bacteria 1277
195 Ga0265340_10259512 3300031247 Bacteria 774
196 Ga0265340_10368092 3300031247 Bacteria 634
197 Ga0265339_10000024 3300031249 Bacteria 169774
198 Ga0265339_10002031 3300031249 Bacteria 14865
199 Ga0265339_10144088 3300031249 Bacteria 1210
200 Ga0265331_10019423 3300031250 Bacteria 3509
201 Ga0265316_10120462 3300031344 Bacteria 1982
202 Ga0307513_10261675 3300031456 Bacteria 1519
203 Ga0265313_10000006 3300031595 Bacteria 183184
204 Ga0265313_10000106 3300031595 Bacteria 83923
205 Ga0265313_10005085 3300031595 Bacteria 9796
206 Ga0265313_10074411 3300031595 Bacteria 1557
207 Ga0265314_10360114 3300031711 Bacteria 798
208 Ga0265342_10236268 3300031712 Bacteria 980
209 Ga0307413_11515806 3300031824 Bacteria 593
210 Ga0307410_10423233 3300031852 Bacteria 1081
211 Ga0307406_10671538 3300031901 Bacteria 862
212 Ga0307412_10124487 3300031911 Bacteria 1862
213 Ga0307416_100385107 3300032002 Bacteria 1434
214 Ga0373948_0068625 3300034817 Unclassified 791
215 Ga0373958_0021409 3300034819 Bacteria 1199
216 Ga0373938_0051146 3300034957 Bacteria 944
217 Ga0373926_0095068 3300035083 Bacteria 1111
218 Ga0373928_0012409 3300035084 Bacteria 1699
219 Ga0373940_0098953 3300035088 Bacteria 883
220 Ga0373944_0127791 3300035089 Unclassified 881
221 Ga0373949_0015728 3300035090 Bacteria 1692
222 Ga0373952_0099878 3300035092 Bacteria 764
223 Ga0373923_0014893 3300035111 Bacteria 2928
224 Ga0373932_0037664 3300035112 Bacteria 1379
225 Ga0373936_0007147 3300035113 Bacteria 4202
226 Ga0373939_0019143 3300035114 Bacteria 1844
227 Ga0373941_0148218 3300035115 Bacteria 859
228 Ga0373945_0006710 3300035116 Bacteria 3719
229 Ga0373945_0292412 3300035116 Unclassified 696
230 Ga0373954_0015986 3300035118 Bacteria 3356
231 Ga0373954_0097531 3300035118 Bacteria 1416
232 Ga0373956_0067851 3300035119 Bacteria 1624
233 Ga0373956_0101446 3300035119 Bacteria 1335
234 Ga0373956_0175752 3300035119 Bacteria 1011
235 Ga0373956_0243357 3300035119 Bacteria 855
236 Ga0373960_0007381 3300035121 Bacteria 2604
237 Ga0373943_0000221 3300035170 Bacteria 23249
238 Ga0373943_0170443 3300035170 Unclassified 1191
239 Ga0373946_0006186 3300035171 Bacteria 4335
240 Ga0373955_0079258 3300035172 Bacteria 1852
241 Ga0373955_0935420 3300035172 Bacteria 533
242 Ga0373961_0028090 3300035241 Bacteria 1549
243 Ga0373962_0003982 3300035242 Bacteria 3558
244 Ga0373924_0067451 3300035410 Bacteria 1505
245 Ga0373924_0569692 3300035410 Bacteria 510
246 Ga0373931_0001340 3300035691 Bacteria 10526
247 Ga0373931_0170025 3300035691 Bacteria 1284
248 Ga0373935_0011453 3300035692 Bacteria 5325
249 Ga0373935_0235394 3300035692 Unclassified 1277
250 Ga0373935_0649990 3300035692 Bacteria 773
251 Ga0373927_0001024 3300035695 Bacteria 21270
252 Ga0373927_0053596 3300035695 Bacteria 2609
253 Ga0373927_0669394 3300035695 Unclassified 686
254 Ga0373933_0001214 3300035724 Bacteria 15250
255 Ga0373933_0068198 3300035724 Bacteria 2160
256 Ga0373933_0126164 3300035724 Bacteria 1606
257 Ga0373947_0004864 3300035725 Bacteria 7853
258 Ga0373947_0110074 3300035725 Bacteria 1739
259 Ga0373947_1214350 3300035725 Bacteria 513
260 Ga0373937_0035939 3300036401 Bacteria 4512
261 Ga0373937_0095914 3300036401 Bacteria 2750
262 Ga0373937_0138736 3300036401 Bacteria 2274
263 Ga0373937_0219397 3300036401 Bacteria 1790
264 Ga0373937_0423922 3300036401 Unclassified 1263
265 Ga0373925_0179850 3300037068 Bacteria 1673
266 Ga0395899_0336947 3300037312 Bacteria 1012
267 Ga0395900_0095457 3300037418 Bacteria 3055
268 Ga0395898_0024386 3300037466 Bacteria 6100
269 Ga0436364_0947229 3300037853 Bacteria 12847
270 Ga0436364_1302206 3300037853 Bacteria 1729
271 Ga0436364_1305909 3300037853 Bacteria 2280
272 Ga0395901_0040927 3300038443 Bacteria 4800
273 Ga0436365_0737983 3300039437 Bacteria 989
274 Ga0436365_0752823 3300039437 Unclassified 669
275 Ga0436365_1116149 3300039437 Bacteria 577
276 Ga0436365_1128251 3300039437 Bacteria 3693
277 Ga0436365_1454352 3300039437 Bacteria 772
278 Ga0436365_1820137 3300039437 Bacteria 536
279 Ga0436360_1125497 3300039438 Bacteria 589
280 Ga0436361_0530340 3300039447 Bacteria 1682
281 Ga0436363_0406387 3300039450 Bacteria 1758
282 Ga0436363_0616450 3300039450 Bacteria 5808
283 Ga0436363_1267158 3300039450 Bacteria 898
284 Ga0451789_0717766 3300041443 Bacteria 519
285 Ga0451807_0189583 3300041486 Bacteria 3433
286 Ga0466963_0125210 3300044694 Bacteria 1771
287 Ga0466957_0015860 3300044842 Bacteria 4403
288 Ga0466959_0184717 3300045049 Bacteria 1457
289 Ga0466958_0052122 3300045836 Bacteria 2479
290 Ga0466967_0600000 3300045976 Bacteria 1087
291 Ga0466967_1376317 3300045976 Bacteria 703
292 Ga0466967_2129999 3300045976 Bacteria 557
293 Ga0495592_0009628 3300046454 Bacteria 7271
294 Ga0495592_0055493 3300046454 Bacteria 2931
295 Ga0495590_0355843 3300046457 Bacteria 557
296 Ga0495629_0001836 3300046459 Bacteria 16619
297 Ga0495629_0220875 3300046459 Bacteria 1307
298 Ga0495629_0429877 3300046459 Bacteria 895
299 Ga0495638_0013217 3300046460 Bacteria 5631
300 Ga0495641_0164394 3300046461 Bacteria 993
301 Ga0495651_0000765 3300046462 Bacteria 24883
302 Ga0495651_0099299 3300046462 Bacteria 2171
303 Ga0495651_0189077 3300046462 Bacteria 1450
304 Ga0495651_0590672 3300046462 Bacteria 701
305 Ga0495653_0015798 3300046463 Bacteria 6156
306 Ga0495653_0038275 3300046463 Bacteria 3765
307 Ga0495580_0085277 3300046472 Bacteria 2200
308 Ga0495580_0487774 3300046472 Unclassified 823
309 Ga0495639_0028123 3300046475 Bacteria 2491
310 Ga0495639_0107001 3300046475 Bacteria 1324
311 Ga0495639_0169902 3300046475 Unclassified 1058
312 Ga0495662_0002001 3300046476 Bacteria 10212
313 Ga0495662_0189170 3300046476 Bacteria 1015
314 Ga0495664_0000171 3300046477 Bacteria 31849
315 Ga0495664_0013011 3300046477 Bacteria 4717
316 Ga0495664_0069000 3300046477 Bacteria 2110
317 Ga0495664_0852416 3300046477 Unclassified 534
318 Ga0495584_0096085 3300046491 Bacteria 1496
319 Ga0495608_0005094 3300046511 Bacteria 9386
320 Ga0495608_0341676 3300046511 Bacteria 922
321 Ga0495618_0002334 3300046514 Bacteria 12256
322 Ga0495618_0004025 3300046514 Bacteria 9063
323 Ga0495618_0064400 3300046514 Bacteria 2329
324 Ga0495618_0429470 3300046514 Bacteria 804
325 Ga0495618_0849255 3300046514 Bacteria 529
326 Ga0495628_0119959 3300046516 Bacteria 2018
327 Ga0495628_0309681 3300046516 Bacteria 1167
328 Ga0495628_0310148 3300046516 Bacteria 1166
329 Ga0495628_0811212 3300046516 Unclassified 654
330 Ga0495630_0003478 3300046517 Bacteria 10944
331 Ga0495630_0052173 3300046517 Bacteria 3061
332 Ga0495630_0364748 3300046517 Bacteria 1106
333 Ga0495630_1095490 3300046517 Bacteria 604
334 Ga0495630_1295551 3300046517 Bacteria 549
335 Ga0495666_0054342 3300046526 Bacteria 1921
336 Ga0495652_0014396 3300046529 Bacteria 7101
337 Ga0495652_0089066 3300046529 Bacteria 2527
338 Ga0495652_0884218 3300046529 Bacteria 590
339 Ga0495652_1002582 3300046529 Unclassified 546
340 Ga0495665_0006610 3300046531 Bacteria 6260
341 Ga0495665_0050302 3300046531 Bacteria 2209
342 Ga0495665_0172398 3300046531 Bacteria 1126
343 Ga0495640_0003719 3300046533 Bacteria 12254
344 Ga0495640_0052412 3300046533 Bacteria 2802
345 Ga0495640_0091465 3300046533 Bacteria 2007
346 Ga0495640_0231674 3300046533 Bacteria 1161
347 Ga0495586_0049281 3300046535 Bacteria 2277
348 Ga0495587_0000610 3300046536 Bacteria 24302
349 Ga0495645_0000870 3300046543 Bacteria 20610
350 Ga0495645_0012750 3300046543 Bacteria 5931
351 Ga0495667_0007313 3300046559 Bacteria 7492
352 Ga0495667_0134572 3300046559 Bacteria 1594
353 Ga0495656_0340668 3300046615 Bacteria 775
354 Ga0495634_0002299 3300046642 Bacteria 15987
355 Ga0495634_0005435 3300046642 Bacteria 9813
356 Ga0495634_0016075 3300046642 Bacteria 5357
357 Ga0495634_0029322 3300046642 Bacteria 3810
358 Ga0495635_0004094 3300046663 Bacteria 10119
359 Ga0495635_0009326 3300046663 Bacteria 6857
360 Ga0495635_0560387 3300046663 Bacteria 748
361 Ga0495659_0495600 3300046664 Bacteria 535
362 Ga0495599_0021858 3300046678 Bacteria 3993
363 Ga0495623_0010207 3300046679 Bacteria 6076
364 Ga0495646_0002731 3300046680 Bacteria 10908
365 Ga0495646_0005739 3300046680 Bacteria 7865
366 Ga0495646_0062264 3300046680 Bacteria 2219
367 Ga0495647_0040198 3300046681 Bacteria 1776
368 Ga0495658_0047745 3300046683 Unclassified 2412
369 Ga0495658_0157754 3300046683 Bacteria 1397
370 Ga0495613_0007640 3300046689 Bacteria 8044
371 Ga0495613_0070497 3300046689 Bacteria 2549
372 Ga0495613_0086627 3300046689 Bacteria 2271
373 Ga0495624_0007466 3300046690 Bacteria 7672
374 Ga0495624_0245574 3300046690 Bacteria 1083
375 Ga0495600_0000572 3300046809 Bacteria 19075
376 Ga0495600_0139039 3300046809 Bacteria 1576
377 Ga0495581_0009138 3300047315 Bacteria 5734
378 Ga0495581_0076016 3300047315 Bacteria 1943
379 Ga0495581_0244529 3300047315 Bacteria 1049
380 Ga0495581_0439379 3300047315 Unclassified 760
381 Ga0495604_0004136 3300047317 Bacteria 11521
382 Ga0495604_0089440 3300047317 Bacteria 2289
383 Ga0495604_0146955 3300047317 Bacteria 1679
384 Ga0495674_0000595 3300047319 Bacteria 33874
385 Ga0495674_0006620 3300047319 Bacteria 11102
386 Ga0495674_0138174 3300047319 Bacteria 2049
387 Ga0495676_0022089 3300047321 Bacteria 5545
388 Ga0495680_0000217 3300047322 Bacteria 62734
389 Ga0495680_0388686 3300047322 Unclassified 965
390 Ga0495680_0823753 3300047322 Bacteria 605
391 Ga0495675_0065325 3300047444 Bacteria 2301
392 Ga0495684_0005983 3300047471 Bacteria 9451
393 Ga0495684_0007539 3300047471 Bacteria 8421
394 Ga0495684_0009724 3300047471 Bacteria 7418
395 Ga0495684_0091175 3300047471 Bacteria 2308
396 Ga0495684_0746952 3300047471 Bacteria 644
397 Ga0495593_0017780 3300047673 Bacteria 4004
398 Ga0495593_0287657 3300047673 Bacteria 822
399 Ga0495602_0010136 3300048088 Bacteria 9782
400 Ga0495602_0066173 3300048088 Bacteria 3115
401 Ga0495602_0647389 3300048088 Unclassified 722
402 Ga0495614_0381204 3300048089 Unclassified 660
403 Ga0496101_0104172 3300048904 Bacteria 2127
404 Ga0496102_0974690 3300048905 Bacteria 769
405 Ga0496103_1047477 3300048906 Bacteria 506
406 Ga0496104_0124978 3300048907 Bacteria 2470
407 Ga0496104_0616602 3300048907 Bacteria 995
408 Ga0496106_0831061 3300048909 Bacteria 732
409 Ga0496107_0550410 3300048910 Bacteria 855
410 Ga0496108_0416427 3300048911 Bacteria 1173
411 Ga0496108_1237992 3300048911 Bacteria 630
412 Ga0496109_0367855 3300048912 Bacteria 1358
413 Ga0496110_0403658 3300048913 Bacteria 1246
414 Ga0496112_0014918 3300048915 Bacteria 7230
415 Ga0496112_0043220 3300048915 Bacteria 4411
416 Ga0496112_0381328 3300048915 Bacteria 1351
417 Ga0496112_0583898 3300048915 Bacteria 1050
418 Ga0496113_0086218 3300048916 Bacteria 2413
419 Ga0496123_0078993 3300048926 Bacteria 2013
420 Ga0496126_0364053 3300048929 Bacteria 1180
421 Ga0496126_0712089 3300048929 Bacteria 779
422 Ga0496126_1125402 3300048929 Bacteria 582
423 Ga0501031_0006322 3300049568 Bacteria 7721
424 Ga0501031_0468892 3300049568 Bacteria 813
425 Ga0501032_0033398 3300049569 Bacteria 3525
426 Ga0501032_0331962 3300049569 Bacteria 980
427 Ga0501033_0016136 3300049570 Bacteria 5655
428 Ga0501033_0047883 3300049570 Bacteria 3177
429 Ga0501033_0066459 3300049570 Bacteria 2651
430 Ga0501034_0010992 3300049571 Bacteria 9397
431 Ga0501034_0019364 3300049571 Bacteria 6961
432 Ga0501034_0063478 3300049571 Bacteria 3707
433 Ga0501034_1025715 3300049571 Bacteria 708
434 Ga0501036_0021797 3300049572 Bacteria 5385
435 Ga0501036_0032387 3300049572 Bacteria 4416
436 Ga0501036_0130795 3300049572 Bacteria 2119
437 Ga0501036_0201800 3300049572 Bacteria 1672
438 Ga0501037_0031337 3300049573 Bacteria 3925
439 Ga0501037_0082808 3300049573 Bacteria 2324
440 Ga0501037_0204570 3300049573 Bacteria 1394
441 Ga0501037_0344230 3300049573 Bacteria 1029
442 Ga0501038_0015924 3300049574 Bacteria 6833
443 Ga0501038_0016516 3300049574 Bacteria 6690
444 Ga0501038_0134029 3300049574 Bacteria 2031
445 Ga0501038_0576035 3300049574 Bacteria 854
446 Ga0501038_0596041 3300049574 Bacteria 836
447 Ga0501038_0664955 3300049574 Bacteria 783
448 Ga0501039_0022864 3300049575 Bacteria 4796
449 Ga0501039_0109959 3300049575 Bacteria 2154
450 Ga0501039_1127789 3300049575 Bacteria 607
451 Ga0501040_0983091 3300049576 Bacteria 612
452 Ga0501041_0495153 3300049577 Bacteria 777
453 Ga0501042_0114288 3300049578 Bacteria 1944
454 Ga0501042_0187102 3300049578 Bacteria 1494
455 Ga0501043_0023178 3300049579 Bacteria 4869
456 Ga0501043_0113195 3300049579 Bacteria 2131
457 Ga0501043_0132760 3300049579 Bacteria 1951
458 Ga0501043_0829732 3300049579 Bacteria 667
459 Ga0501046_0054775 3300049580 Bacteria 3136
460 Ga0501047_0013725 3300049581 Bacteria 7691
461 Ga0501047_0178296 3300049581 Bacteria 1992
462 Ga0501047_0223144 3300049581 Bacteria 1740
463 Ga0501047_0275969 3300049581 Bacteria 1526
464 Ga0501047_0741045 3300049581 Bacteria 799
465 Ga0501048_0060842 3300049582 Bacteria 2675
466 Ga0501048_0399007 3300049582 Bacteria 983
467 Ga0501067_0173889 3300049583 Bacteria 1199
468 Ga0501068_0180915 3300049584 Bacteria 1333
469 Ga0501069_0018699 3300049585 Bacteria 3742
470 Ga0501069_0086940 3300049585 Bacteria 1765
471 Ga0501069_0112332 3300049585 Bacteria 1552
472 Ga0501069_0129902 3300049585 Bacteria 1442
473 Ga0501069_0454168 3300049585 Bacteria 762
474 Ga0501069_0521570 3300049585 Bacteria 710
475 Ga0501070_0004165 3300049586 Bacteria 12443
476 Ga0501070_0012500 3300049586 Bacteria 7160
477 Ga0501070_0056946 3300049586 Bacteria 3240
478 Ga0501070_0077346 3300049586 Bacteria 2754
479 Ga0501070_0113999 3300049586 Bacteria 2233
480 Ga0501070_0199992 3300049586 Bacteria 1641
481 Ga0501070_0358680 3300049586 Bacteria 1183
482 Ga0501070_0445847 3300049586 Bacteria 1044
483 Ga0501070_1027629 3300049586 Bacteria 638
484 Ga0501070_1230427 3300049586 Bacteria 574
485 Ga0501071_0016680 3300049587 Bacteria 5053
486 Ga0501071_0143934 3300049587 Bacteria 1776
487 Ga0501071_0503608 3300049587 Bacteria 929
488 Ga0501071_0647548 3300049587 Bacteria 813
489 Ga0501072_0019583 3300049588 Bacteria 5233
490 Ga0501072_0089151 3300049588 Bacteria 2448
491 Ga0501072_0298672 3300049588 Bacteria 1280
492 Ga0501072_1486009 3300049588 Bacteria 523
493 Ga0501073_0219516 3300049589 Bacteria 1313
494 Ga0501073_0338215 3300049589 Bacteria 1039
495 Ga0501073_0574767 3300049589 Bacteria 778
496 Ga0501074_0197842 3300049590 Bacteria 1432
497 Ga0501074_0303187 3300049590 Bacteria 1134
498 Ga0501076_0030823 3300049592 Bacteria 4178
499 Ga0501076_0809299 3300049592 Bacteria 773
500 Ga0501077_0135880 3300049593 Bacteria 1559
501 Ga0501079_0048958 3300049741 Bacteria 3262
502 Ga0501079_0366082 3300049741 Bacteria 1130
503 Ga0501080_0076720 3300049742 Bacteria 3108
504 Ga0501080_0166794 3300049742 Bacteria 2032
505 Ga0501080_0523805 3300049742 Bacteria 1057
506 Ga0501080_0602933 3300049742 Bacteria 975
507 Ga0501081_0131351 3300049743 Bacteria 1789
508 Ga0501083_0019174 3300049744 Bacteria 4764
509 Ga0501083_0126142 3300049744 Bacteria 1678
510 Ga0501083_0296160 3300049744 Bacteria 1052
511 Ga0501035_0000654 3300049822 Bacteria 38184
512 Ga0501035_0012365 3300049822 Bacteria 7890
513 Ga0501035_0033030 3300049822 Bacteria 4705
514 Ga0501035_0168789 3300049822 Bacteria 1891
515 Ga0501035_0588746 3300049822 Bacteria 908
516 Ga0501035_0842072 3300049822 Bacteria 730
517 Ga0501035_1159171 3300049822 Bacteria 601
518 Ga0501044_0009168 3300049823 Bacteria 10809
519 Ga0501044_0163295 3300049823 Bacteria 2202
520 Ga0501044_0392925 3300049823 Bacteria 1300
521 Ga0501044_0688597 3300049823 Bacteria 908
522 Ga0501044_1100024 3300049823 Bacteria 664
523 Ga0501045_0259094 3300049824 Bacteria 1294
524 Ga0501045_0611865 3300049824 Bacteria 806
525 nmdc:mga03683_72454_c1 3300050489 Bacteria 1475
526 nmdc:mga03n38_907951_c1 3300050490 Unclassified 518
527 nmdc:mga00v17_352908_c1 3300050491 Bacteria 956
528 nmdc:mga00v17_980570_c1 3300050491 Bacteria 532
529 nmdc:mga0yw44_198829_c1 3300050492 Bacteria 1323
530 nmdc:mga0yw44_374036_c1 3300050492 Bacteria 961
531 nmdc:mga0yw44_497161_c1 3300050492 Bacteria 827
532 nmdc:mga0k408_156192_c1 3300050493 Bacteria 1359
533 nmdc:mga06z11_47514_c1 3300050494 Bacteria 2180
534 nmdc:mga06z11_791424_c1 3300050494 Bacteria 578
535 nmdc:mga04h51_343302_c1 3300050495 Bacteria 616
536 nmdc:mga04h51_411708_c1 3300050495 Bacteria 567
537 nmdc:mga04h51_7942_c1 3300050495 Bacteria 2823
538 nmdc:mga07m45_41286_c1 3300050496 Bacteria 2583
539 nmdc:mga07m45_814483_c1 3300050496 Bacteria 535
540 nmdc:mga05p37_14_c1 3300050507 Bacteria 137209
541 nmdc:mga05p37_40957_c1 3300050507 Bacteria 5688
542 nmdc:mga05p37_59268_c1 3300050507 Bacteria 4714
543 nmdc:mga05p37_73296_c1 3300050507 Bacteria 4214
544 nmdc:mga09592_346_c1 3300050508 Bacteria 33997
545 nmdc:mga0qj67_157279_c1 3300050509 Bacteria 1845
546 nmdc:mga06r32_1042_c1 3300050510 Bacteria 25028
547 nmdc:mga06r32_1522319_c1 3300050510 Bacteria 609
548 nmdc:mga08y16_230170_c1 3300050511 Bacteria 1917
549 nmdc:mga08y16_412_c1 3300050511 Bacteria 39249
550 nmdc:mga08y16_66174_c1 3300050511 Bacteria 3772
551 nmdc:mga08y16_843757_c1 3300050511 Bacteria 906
552 nmdc:mga0n895_149269_c1 3300050512 Bacteria 2367
553 nmdc:mga0n895_4962_c1 3300050512 Bacteria 11038
554 nmdc:mga0rr50_225447_c1 3300050513 Bacteria 1549
555 nmdc:mga0rr50_301371_c1 3300050513 Bacteria 1341
556 nmdc:mga08x19_193981_c1 3300050514 Bacteria 1390
557 nmdc:mga08x19_4_c1 3300050514 Bacteria 335979
558 nmdc:mga08x19_635700_c1 3300050514 Bacteria 757
559 nmdc:mga0a205_2038_c1 3300050515 Bacteria 17644
560 Ga0495601_0001341 3300053077 Bacteria 13518
561 Ga0495601_0021791 3300053077 Bacteria 3927
562 Ga0495601_0073229 3300053077 Bacteria 2189
563 Ga0495601_0614918 3300053077 Bacteria 696
564 Ga0495612_0000511 3300053078 Bacteria 15584
565 Ga0495612_0019564 3300053078 Bacteria 2711
566 Ga0500610_0196952 3300053079 Bacteria 974
567 Ga0495595_0000457 3300053084 Bacteria 15460
568 Ga0495595_0014789 3300053084 Bacteria 3318
569 Ga0495595_0200826 3300053084 Bacteria 992
570 Ga0495619_0000499 3300053085 Bacteria 26333
571 Ga0495619_0002578 3300053085 Bacteria 11836
572 Ga0500641_0009379 3300053096 Bacteria 3520
573 Ga0500641_0104620 3300053096 Bacteria 1216
574 Ga0500650_0516048 3300053098 Bacteria 507
575 Ga0500562_208883 3300053108 Bacteria 528
576 Ga0500593_028503 3300053117 Bacteria 2495
577 Ga0500604_0062013 3300053151 Bacteria 1176
578 Ga0501084_0306961 3300054114 Bacteria 1340
579 Ga0501084_0657083 3300054114 Bacteria 885
580 Ga0501084_0685727 3300054114 Bacteria 864
581 Ga0501082_0022186 3300060353 Bacteria 5472
582 Ga0501082_0870173 3300060353 Bacteria 788
583 Ga0530510_0005973 3300061734 Bacteria 8446
584 Ga0496111_0529876
585 Ga0070658_10566224
586 Ga0070670_100029561
587 Ga0070680_100068210
588 Ga0068868_101996248
589 Ga0070689_101939045
590 Ga0070691_10035972
591 Ga0070691_10037095
592 Ga0070661_100516248
593 Ga0070668_101035791
594 Ga0070675_100102845
595 Ga0070671_100019566
596 Ga0070673_100159623
597 Ga0070659_100927847
598 Ga0070667_100127843
599 Ga0070709_10072263
600 Ga0070709_10093689
601 Ga0070714_100020343
602 Ga0070714_100149659
603 Ga0070713_100034091
604 Ga0070713_100367483
605 Ga0070710_10393899
606 Ga0070710_10401081
607 Ga0070711_100042680
608 Ga0070711_100313397
609 Ga0070705_100069044
610 Ga0070708_100328333
611 Ga0070681_10094369
612 Ga0070681_10538672
613 Ga0070698_100567820
614 Ga0070679_100020870
615 Ga0070679_100148950
616 Ga0070679_100315502
617 Ga0068853_100324133
618 Ga0068853_100748923
619 Ga0070695_100040239
620 Ga0070665_100351400
621 Ga0070665_102148896
622 Ga0068855_100010980
623 Ga0068854_101596421
624 Ga0068856_100815502
625 Ga0070702_100790749
626 Ga0081455_10001509
627 Ga0081538_10026966
628 Ga0070717_10041347
629 Ga0070717_10053965
630 Ga0070717_10347393
631 Ga0070717_10732703
632 Ga0075365_10144979
633 Ga0075365_10412240
634 Ga0075368_10008290
635 Ga0075363_100111873
636 Ga0075363_100287173
637 Ga0075364_10242956
638 Ga0075364_10253560
639 Ga0075364_10312496
640 Ga0075364_10622250
641 Ga0075364_10976827
642 Ga0075432_10335696
643 Ga0070715_10026608
644 Ga0070715_10107871
645 Ga0070715_10401821
646 Ga0070716_100341975
647 Ga0070712_100024609
648 Ga0070712_100317503
649 Ga0075362_10114075
650 Ga0075362_10297370
651 Ga0075367_10029721
652 Ga0075367_10045859
653 Ga0075367_10403327
654 Ga0075367_10930100
655 Ga0075369_10079427
656 Ga0075370_10076506
657 Ga0075370_10188671
658 Ga0075428_100054116
659 Ga0075428_101689192
660 Ga0075430_100521727
661 Ga0075430_101816787
662 Ga0075431_100000033
663 Ga0075431_100428718
664 Ga0075433_10001904
665 Ga0075433_11175763
666 Ga0075434_100008413
667 Ga0075434_100123867
668 Ga0075434_101192968
669 Ga0075429_100167698
670 Ga0075436_100003820
671 Ga0075436_100157781
672 Ga0075436_100978030
673 Ga0075435_100038491
674 Ga0075435_100059230
675 Ga0105240_10018094
676 Ga0111539_10033184
677 Ga0111539_10091935
678 Ga0111539_10375770
679 Ga0105245_10415621
680 Ga0114129_10014704
681 Ga0114129_10081763
682 Ga0114129_10104440
683 Ga0114129_11095497
684 Ga0114129_12101237
685 Ga0105242_11696216
686 Ga0105248_10137295
687 Ga0105248_11821400
688 Ga0105237_10683910
689 Ga0105237_12031184
690 Ga0105238_11873060
691 Ga0105249_11878867
692 Ga0105239_10265383
693 Ga0157370_10084055
694 Ga0157369_11710841
695 Ga0157378_10031227
696 Ga0157378_10505995
697 Ga0163162_10838958
698 Ga0157372_11420322
699 Ga0163163_11548776
700 Ga0157380_10428624
701 Ga0157377_10412003
702 Ga0157379_10226841
703 Ga0157376_11225566
704 Ga0213874_10145600
705 Ga0224572_1003950
706 Ga0224572_1060953
707 Ga0228598_1000693
708 Ga0228598_1014860
709 Ga0207692_10152374
710 Ga0207692_10175578
711 Ga0207685_10252483
712 Ga0207685_10736647
713 Ga0207699_10113978
714 Ga0207699_10393940
715 Ga0207699_10448759
716 Ga0207705_10334586
717 Ga0207684_10950703
718 Ga0207707_10203548
719 Ga0207707_11644679
720 Ga0207695_10039179
721 Ga0207693_10009117
722 Ga0207693_10242494
723 Ga0207693_10399939
724 Ga0207663_10068907
725 Ga0207663_10374141
726 Ga0207663_10447691
727 Ga0207663_11345253
728 Ga0207660_10019021
729 Ga0207662_10637462
730 Ga0207649_10800808
731 Ga0207652_10091242
732 Ga0207650_10035385
733 Ga0207687_10298213
734 Ga0207700_10203369
735 Ga0207700_11003528
736 Ga0207664_10030116
737 Ga0207664_10136523
738 Ga0207664_10561325
739 Ga0207664_10656831
740 Ga0207664_10664538
741 Ga0207644_10006764
742 Ga0207706_10084452
743 Ga0207670_10664517
744 Ga0207669_10792482
745 Ga0207665_10127445
746 Ga0207665_10414772
747 Ga0207665_11673249
748 Ga0207679_10458629
749 Ga0207667_10028383
750 Ga0207667_11844787
751 Ga0207651_10005889
752 Ga0207668_11090133
753 Ga0207677_12269308
754 Ga0207703_11690479
755 Ga0207639_10272371
756 Ga0207702_10421543
757 Ga0207702_11852910
758 Ga0207674_10380250
759 Ga0207683_10214042
760 Ga0209813_10307543
761 Ga0209813_10413956
762 Ga0207428_10005560
763 Ga0207428_10018543
764 Ga0207428_10115770
765 Ga0207428_10482553
766 Ga0265357_1003992
767 Ga0265338_10207280
768 Ga0265338_11032018
769 Ga0265763_1003844
770 Ga0265770_1159016
771 Ga0265760_10211058
772 Ga0265325_10005503
773 Ga0265325_10006079
774 Ga0265325_10024162
775 Ga0265325_10040607
776 Ga0265340_10045670
777 Ga0265340_10109666
778 Ga0265340_10259512
779 Ga0265340_10368092
780 Ga0265339_10000024
781 Ga0265339_10002031
782 Ga0265339_10144088
783 Ga0265331_10019423
784 Ga0265316_10120462
785 Ga0307513_10261675
786 Ga0265313_10000006
787 Ga0265313_10000106
788 Ga0265313_10005085
789 Ga0265313_10074411
790 Ga0265314_10360114
791 Ga0265342_10236268
792 Ga0307413_11515806
793 Ga0307410_10423233
794 Ga0307406_10671538
795 Ga0307412_10124487
796 Ga0307416_100385107
797 Ga0373948_0068625
798 Ga0373958_0021409
799 Ga0373938_0051146
800 Ga0373926_0095068
801 Ga0373928_0012409
802 Ga0373940_0098953
803 Ga0373944_0127791
804 Ga0373949_0015728
805 Ga0373952_0099878
806 Ga0373923_0014893
807 Ga0373932_0037664
808 Ga0373936_0007147
809 Ga0373939_0019143
810 Ga0373941_0148218
811 Ga0373945_0006710
812 Ga0373945_0292412
813 Ga0373954_0015986
814 Ga0373954_0097531
815 Ga0373956_0067851
816 Ga0373956_0101446
817 Ga0373956_0175752
818 Ga0373956_0243357
819 Ga0373960_0007381
820 Ga0373943_0000221
821 Ga0373943_0170443
822 Ga0373946_0006186
823 Ga0373955_0079258
824 Ga0373955_0935420
825 Ga0373961_0028090
826 Ga0373962_0003982
827 Ga0373924_0067451
828 Ga0373924_0569692
829 Ga0373931_0001340
830 Ga0373931_0170025
831 Ga0373935_0011453
832 Ga0373935_0235394
833 Ga0373935_0649990
834 Ga0373927_0001024
835 Ga0373927_0053596
836 Ga0373927_0669394
837 Ga0373933_0001214
838 Ga0373933_0068198
839 Ga0373933_0126164
840 Ga0373947_0004864
841 Ga0373947_0110074
842 Ga0373947_1214350
843 Ga0373937_0035939
844 Ga0373937_0095914
845 Ga0373937_0138736
846 Ga0373937_0219397
847 Ga0373937_0423922
848 Ga0373925_0179850
849 Ga0395899_0336947
850 Ga0395900_0095457
851 Ga0395898_0024386
852 Ga0436364_0947229
853 Ga0436364_1302206
854 Ga0436364_1305909
855 Ga0395901_0040927
856 Ga0436365_0737983
857 Ga0436365_0752823
858 Ga0436365_1116149
859 Ga0436365_1128251
860 Ga0436365_1454352
861 Ga0436365_1820137
862 Ga0436360_1125497
863 Ga0436361_0530340
864 Ga0436363_0406387
865 Ga0436363_0616450
866 Ga0436363_1267158
867 Ga0451789_0717766
868 Ga0451807_0189583
869 Ga0466963_0125210
870 Ga0466957_0015860
871 Ga0466959_0184717
872 Ga0466958_0052122
873 Ga0466967_0600000
874 Ga0466967_1376317
875 Ga0466967_2129999
876 Ga0495592_0009628
877 Ga0495592_0055493
878 Ga0495590_0355843
879 Ga0495629_0001836
880 Ga0495629_0220875
881 Ga0495629_0429877
882 Ga0495638_0013217
883 Ga0495641_0164394
884 Ga0495651_0000765
885 Ga0495651_0099299
886 Ga0495651_0189077
887 Ga0495651_0590672
888 Ga0495653_0015798
889 Ga0495653_0038275
890 Ga0495580_0085277
891 Ga0495580_0487774
892 Ga0495639_0028123
893 Ga0495639_0107001
894 Ga0495639_0169902
895 Ga0495662_0002001
896 Ga0495662_0189170
897 Ga0495664_0000171
898 Ga0495664_0013011
899 Ga0495664_0069000
900 Ga0495664_0852416
901 Ga0495584_0096085
902 Ga0495608_0005094
903 Ga0495608_0341676
904 Ga0495618_0002334
905 Ga0495618_0004025
906 Ga0495618_0064400
907 Ga0495618_0429470
908 Ga0495618_0849255
909 Ga0495628_0119959
910 Ga0495628_0309681
911 Ga0495628_0310148
912 Ga0495628_0811212
913 Ga0495630_0003478
914 Ga0495630_0052173
915 Ga0495630_0364748
916 Ga0495630_1095490
917 Ga0495630_1295551
918 Ga0495666_0054342
919 Ga0495652_0014396
920 Ga0495652_0089066
921 Ga0495652_0884218
922 Ga0495652_1002582
923 Ga0495665_0006610
924 Ga0495665_0050302
925 Ga0495665_0172398
926 Ga0495640_0003719
927 Ga0495640_0052412
928 Ga0495640_0091465
929 Ga0495640_0231674
930 Ga0495586_0049281
931 Ga0495587_0000610
932 Ga0495645_0000870
933 Ga0495645_0012750
934 Ga0495667_0007313
935 Ga0495667_0134572
936 Ga0495656_0340668
937 Ga0495634_0002299
938 Ga0495634_0005435
939 Ga0495634_0016075
940 Ga0495634_0029322
941 Ga0495635_0004094
942 Ga0495635_0009326
943 Ga0495635_0560387
944 Ga0495659_0495600
945 Ga0495599_0021858
946 Ga0495623_0010207
947 Ga0495646_0002731
948 Ga0495646_0005739
949 Ga0495646_0062264
950 Ga0495647_0040198
951 Ga0495658_0047745
952 Ga0495658_0157754
953 Ga0495613_0007640
954 Ga0495613_0070497
955 Ga0495613_0086627
956 Ga0495624_0007466
957 Ga0495624_0245574
958 Ga0495600_0000572
959 Ga0495600_0139039
960 Ga0495581_0009138
961 Ga0495581_0076016
962 Ga0495581_0244529
963 Ga0495581_0439379
964 Ga0495604_0004136
965 Ga0495604_0089440
966 Ga0495604_0146955
967 Ga0495674_0000595
968 Ga0495674_0006620
969 Ga0495674_0138174
970 Ga0495676_0022089
971 Ga0495680_0000217
972 Ga0495680_0388686
973 Ga0495680_0823753
974 Ga0495675_0065325
975 Ga0495684_0005983
976 Ga0495684_0007539
977 Ga0495684_0009724
978 Ga0495684_0091175
979 Ga0495684_0746952
980 Ga0495593_0017780
981 Ga0495593_0287657
982 Ga0495602_0010136
983 Ga0495602_0066173
984 Ga0495602_0647389
985 Ga0495614_0381204
986 Ga0496101_0104172
987 Ga0496102_0974690
988 Ga0496103_1047477
989 Ga0496104_0124978
990 Ga0496104_0616602
991 Ga0496106_0831061
992 Ga0496107_0550410
993 Ga0496108_0416427
994 Ga0496108_1237992
995 Ga0496109_0367855
996 Ga0496110_0403658
997 Ga0496112_0014918
998 Ga0496112_0043220
999 Ga0496112_0381328
1000 Ga0496112_0583898
1001 Ga0496113_0086218
1002 Ga0496123_0078993
1003 Ga0496126_0364053
1004 Ga0496126_0712089
1005 Ga0496126_1125402
1006 Ga0501031_0006322
1007 Ga0501031_0468892
1008 Ga0501032_0033398
1009 Ga0501032_0331962
1010 Ga0501033_0016136
1011 Ga0501033_0047883
1012 Ga0501033_0066459
1013 Ga0501034_0010992
1014 Ga0501034_0019364
1015 Ga0501034_0063478
1016 Ga0501034_1025715
1017 Ga0501036_0021797
1018 Ga0501036_0032387
1019 Ga0501036_0130795
1020 Ga0501036_0201800
1021 Ga0501037_0031337
1022 Ga0501037_0082808
1023 Ga0501037_0204570
1024 Ga0501037_0344230
1025 Ga0501038_0015924
1026 Ga0501038_0016516
1027 Ga0501038_0134029
1028 Ga0501038_0576035
1029 Ga0501038_0596041
1030 Ga0501038_0664955
1031 Ga0501039_0022864
1032 Ga0501039_0109959
1033 Ga0501039_1127789
1034 Ga0501040_0983091
1035 Ga0501041_0495153
1036 Ga0501042_0114288
1037 Ga0501042_0187102
1038 Ga0501043_0023178
1039 Ga0501043_0113195
1040 Ga0501043_0132760
1041 Ga0501043_0829732
1042 Ga0501046_0054775
1043 Ga0501047_0013725
1044 Ga0501047_0178296
1045 Ga0501047_0223144
1046 Ga0501047_0275969
1047 Ga0501047_0741045
1048 Ga0501048_0060842
1049 Ga0501048_0399007
1050 Ga0501067_0173889
1051 Ga0501068_0180915
1052 Ga0501069_0018699
1053 Ga0501069_0086940
1054 Ga0501069_0112332
1055 Ga0501069_0129902
1056 Ga0501069_0454168
1057 Ga0501069_0521570
1058 Ga0501070_0004165
1059 Ga0501070_0012500
1060 Ga0501070_0056946
1061 Ga0501070_0077346
1062 Ga0501070_0113999
1063 Ga0501070_0199992
1064 Ga0501070_0358680
1065 Ga0501070_0445847
1066 Ga0501070_1027629
1067 Ga0501070_1230427
1068 Ga0501071_0016680
1069 Ga0501071_0143934
1070 Ga0501071_0503608
1071 Ga0501071_0647548
1072 Ga0501072_0019583
1073 Ga0501072_0089151
1074 Ga0501072_0298672
1075 Ga0501072_1486009
1076 Ga0501073_0219516
1077 Ga0501073_0338215
1078 Ga0501073_0574767
1079 Ga0501074_0197842
1080 Ga0501074_0303187
1081 Ga0501076_0030823
1082 Ga0501076_0809299
1083 Ga0501077_0135880
1084 Ga0501079_0048958
1085 Ga0501079_0366082
1086 Ga0501080_0076720
1087 Ga0501080_0166794
1088 Ga0501080_0523805
1089 Ga0501080_0602933
1090 Ga0501081_0131351
1091 Ga0501083_0019174
1092 Ga0501083_0126142
1093 Ga0501083_0296160
1094 Ga0501035_0000654
1095 Ga0501035_0012365
1096 Ga0501035_0033030
1097 Ga0501035_0168789
1098 Ga0501035_0588746
1099 Ga0501035_0842072
1100 Ga0501035_1159171
1101 Ga0501044_0009168
1102 Ga0501044_0163295
1103 Ga0501044_0392925
1104 Ga0501044_0688597
1105 Ga0501044_1100024
1106 Ga0501045_0259094
1107 Ga0501045_0611865
1108 nmdc:mga03683_72454_c1
1109 nmdc:mga03n38_907951_c1
1110 nmdc:mga00v17_352908_c1
1111 nmdc:mga00v17_980570_c1
1112 nmdc:mga0yw44_198829_c1
1113 nmdc:mga0yw44_374036_c1
1114 nmdc:mga0yw44_497161_c1
1115 nmdc:mga0k408_156192_c1
1116 nmdc:mga06z11_47514_c1
1117 nmdc:mga06z11_791424_c1
1118 nmdc:mga04h51_343302_c1
1119 nmdc:mga04h51_411708_c1
1120 nmdc:mga04h51_7942_c1
1121 nmdc:mga07m45_41286_c1
1122 nmdc:mga07m45_814483_c1
1123 nmdc:mga05p37_14_c1
1124 nmdc:mga05p37_40957_c1
1125 nmdc:mga05p37_59268_c1
1126 nmdc:mga05p37_73296_c1
1127 nmdc:mga09592_346_c1
1128 nmdc:mga0qj67_157279_c1
1129 nmdc:mga06r32_1042_c1
1130 nmdc:mga06r32_1522319_c1
1131 nmdc:mga08y16_230170_c1
1132 nmdc:mga08y16_412_c1
1133 nmdc:mga08y16_66174_c1
1134 nmdc:mga08y16_843757_c1
1135 nmdc:mga0n895_149269_c1
1136 nmdc:mga0n895_4962_c1
1137 nmdc:mga0rr50_225447_c1
1138 nmdc:mga0rr50_301371_c1
1139 nmdc:mga08x19_193981_c1
1140 nmdc:mga08x19_4_c1
1141 nmdc:mga08x19_635700_c1
1142 nmdc:mga0a205_2038_c1
1143 Ga0495601_0001341
1144 Ga0495601_0021791
1145 Ga0495601_0073229
1146 Ga0495601_0614918
1147 Ga0495612_0000511
1148 Ga0495612_0019564
1149 Ga0500610_0196952
1150 Ga0495595_0000457
1151 Ga0495595_0014789
1152 Ga0495595_0200826
1153 Ga0495619_0000499
1154 Ga0495619_0002578
1155 Ga0500641_0009379
1156 Ga0500641_0104620
1157 Ga0500650_0516048
1158 Ga0500562_208883
1159 Ga0500593_028503
1160 Ga0500604_0062013
1161 Ga0501084_0306961
1162 Ga0501084_0657083
1163 Ga0501084_0685727
1164 Ga0501082_0022186
1165 Ga0501082_0870173
1166 Ga0530510_0005973

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04430

DUF498

Protein of unknown function (DUF498/DUF598)

39

147

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fi9-assembly1.cif.gz_A the crystal structure of an outer membrane protein from the bartonella henselae 0.9755 9 127
2fi9-assembly1.cif.gz_A the crystal structure of an outer membrane protein from the bartonella henselae 0.9674 9 127
2k2e-assembly1.cif.gz_A solution nmr structure of bordetella pertussis protein bp2786, a mth938-like domain. northeast structural genomics consortium target ber31 0.8924 14 125
3cpk-assembly1.cif.gz_A crystal structure of the q7w7n7_borpa protein from bordetella parapertussis. northeast structural genomics consortium target ber31 0.8682 12 125
2q4q-assembly1.cif.gz_A ensemble refinement of the protein crystal structure of gene product from homo sapiens hs.95870 0.8556 14 127
ID Description Score Start End Superfamily
2fi9A00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9755 9 127 3.40.1230.10
2fi9A00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9674 9 127 3.40.1230.10
af_A0A0P0VZT1_1_69_3.40.50.10190 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;BRCT domain 0.9584 67 126 3.40.50.10190
af_Q9BU61_55_171_3.40.1230.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9442 13 127 3.40.1230.10
af_A0A1D6P6M4_78_189_3.40.1230.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Mth938; Chain: A,;MTH938-like 0.9412 16 125 3.40.1230.10
ID Description Score Start End GO Terms
AF-A0A436CPS0-F1-model_v4 Uncharacterized protein 0.9897 62 127
AF-A0A2W6Z0V6-F1-model_v4 Mth938-like domain-containing protein 0.9882 29 127
AF-A0A0Q3SZR0-F1-model_v4 Uncharacterized conserved protein, contains Mth938-like domain 0.9873 10 127
AF-A0A812UYF5-F1-model_v4 deleted 0.9858 31 125
AF-A0A7U2V5E8-F1-model_v4 deleted 0.9848 29 127

Map