F466302
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 583 | 301 | 567 | 260 |
Family's Representative Sequence
| Representative Sequence | 3300046512|Ga0495610_0035524|Ga0495610_0035524_111_980 |
| Length | 289 |
| Sequence | LVNSNVCFTTAHSRKNNDKEEAVDTSLVTTEIREGYRVLTLNRPDRLNSFSAAMHAELMAALVAAEADTSCRALLLTGAGRGFCAGQDLADPAVAPDLTPGAKPTDVGNVIERFYKPLALRLRAMPIPVIAAVNGVAAGAGASIALGCDMVIAARSASFIQAFSKIGLVPDAGGTWLLPRLVGRANALALAMTGDKLSADDAQRMGLIWKCVDDAAFTDEVSTTAARLAAMPVKALAATRAVIDASAQLSYADALSLEGEWQSRLSASHDYLEGVAAFLAKRPATFSDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185292 | Achromobacter sp. NFACC18-2 | Isolate | Rhizoplane |
| 2 | 2643221569 | Achromobacter sp. Root565 | Isolate | Unclassified |
| 3 | 2643221594 | Achromobacter sp. Root170 | Isolate | Unclassified |
| 4 | 2643221603 | Noviherbaspirillum sp. Root189 | Isolate | Unclassified |
| 5 | 2643221609 | Acidovorax sp. Root217 | Isolate | Unclassified |
| 6 | 2643221611 | Acidovorax sp. Root219 | Isolate | Unclassified |
| 7 | 2643221621 | Achromobacter sp. Root83 | Isolate | Unclassified |
| 8 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 9 | 2643221660 | Methylibium sp. Root1272 | Isolate | Unclassified |
| 10 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 11 | 2816332133 | Acidovorax radicis 2721A | Isolate | Unclassified |
| 12 | 2857537821 | Achromobacter sp. R-71975 | Isolate | Unclassified |
| 13 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 14 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 15 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 16 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 17 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 54 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 55 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 63 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 64 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 65 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 66 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 67 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 68 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 70 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 71 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 72 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 73 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 74 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 75 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 76 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 78 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 102 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 103 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 157 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 161 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 162 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 164 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 165 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 169 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 182 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 183 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 184 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 186 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 188 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 189 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 191 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 192 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 193 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 196 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 197 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 198 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 199 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 200 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 201 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 202 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 203 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 204 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 205 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 206 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 207 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 210 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 211 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 212 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 240 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 241 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 242 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 245 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 246 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 247 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 248 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 249 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 250 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 251 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 252 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 253 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 262 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 276 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 277 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 278 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 286 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 287 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 288 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 289 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 290 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 291 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 292 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 293 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 294 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 295 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 296 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 297 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 299 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 300 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 301 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.26 |
| Metatranscriptomes | 0 |
| Isolates | 2.74 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.49 |
| Nodule | 0.34 |
| Rhizoplane | 1.37 |
| Rhizosphere | 82.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | rootL2_10011839 | 3300003322 | Bacteria | 2378 |
| 2 | Ga0055529_1000970 | 3300003763 | Bacteria | 14586 |
| 3 | Ga0070676_10004590 | 3300005328 | Bacteria | 7280 |
| 4 | Ga0070676_10009109 | 3300005328 | Bacteria | 5369 |
| 5 | Ga0070676_10060916 | 3300005328 | Bacteria | 2242 |
| 6 | Ga0070676_10104959 | 3300005328 | Bacteria | 1751 |
| 7 | Ga0070676_10236586 | 3300005328 | Bacteria | 1213 |
| 8 | Ga0070683_100170703 | 3300005329 | Bacteria | 2064 |
| 9 | Ga0070690_100216120 | 3300005330 | Bacteria | 1341 |
| 10 | Ga0070670_100003540 | 3300005331 | Bacteria | 12986 |
| 11 | Ga0070670_100030342 | 3300005331 | Bacteria | 4656 |
| 12 | Ga0070670_100039813 | 3300005331 | Bacteria | 4041 |
| 13 | Ga0070670_100078217 | 3300005331 | Bacteria | 2841 |
| 14 | Ga0070670_100154247 | 3300005331 | Bacteria | 1988 |
| 15 | Ga0070670_100574006 | 3300005331 | Bacteria | 1008 |
| 16 | Ga0070677_10009873 | 3300005333 | Bacteria | 3250 |
| 17 | Ga0070677_10071266 | 3300005333 | Bacteria | 1463 |
| 18 | Ga0068869_100058292 | 3300005334 | Bacteria | 2823 |
| 19 | Ga0068869_100103617 | 3300005334 | Bacteria | 2156 |
| 20 | Ga0068869_100215260 | 3300005334 | Bacteria | 1520 |
| 21 | Ga0070666_10060734 | 3300005335 | Bacteria | 2558 |
| 22 | Ga0068868_100023248 | 3300005338 | Bacteria | 4690 |
| 23 | Ga0068868_100064919 | 3300005338 | Bacteria | 2899 |
| 24 | Ga0068868_100075800 | 3300005338 | Bacteria | 2688 |
| 25 | Ga0068868_100185742 | 3300005338 | Bacteria | 1727 |
| 26 | Ga0070687_100099758 | 3300005343 | Bacteria | 1623 |
| 27 | Ga0070661_100119433 | 3300005344 | Bacteria | 1973 |
| 28 | Ga0070661_100301707 | 3300005344 | Bacteria | 1247 |
| 29 | Ga0070668_100004039 | 3300005347 | Bacteria | 10856 |
| 30 | Ga0070668_100010211 | 3300005347 | Bacteria | 6964 |
| 31 | Ga0070668_100096386 | 3300005347 | Bacteria | 2338 |
| 32 | Ga0070668_100269107 | 3300005347 | Bacteria | 1420 |
| 33 | Ga0070669_100009428 | 3300005353 | Bacteria | 6951 |
| 34 | Ga0070669_100040781 | 3300005353 | Bacteria | 3375 |
| 35 | Ga0070669_100045564 | 3300005353 | Bacteria | 3196 |
| 36 | Ga0070669_100073387 | 3300005353 | Bacteria | 2535 |
| 37 | Ga0070675_100000968 | 3300005354 | Bacteria | 20525 |
| 38 | Ga0070675_100051959 | 3300005354 | Bacteria | 3368 |
| 39 | Ga0070675_100053171 | 3300005354 | Bacteria | 3330 |
| 40 | Ga0070671_100003531 | 3300005355 | Bacteria | 12223 |
| 41 | Ga0070671_100049480 | 3300005355 | Bacteria | 3497 |
| 42 | Ga0070671_100077017 | 3300005355 | Bacteria | 2787 |
| 43 | Ga0070674_100011101 | 3300005356 | Bacteria | 5470 |
| 44 | Ga0070674_100015723 | 3300005356 | Bacteria | 4731 |
| 45 | Ga0070674_100043910 | 3300005356 | Bacteria | 3043 |
| 46 | Ga0070674_100052253 | 3300005356 | Bacteria | 2818 |
| 47 | Ga0070674_100052928 | 3300005356 | Bacteria | 2801 |
| 48 | Ga0070673_100003906 | 3300005364 | Bacteria | 9368 |
| 49 | Ga0070673_100004627 | 3300005364 | Bacteria | 8724 |
| 50 | Ga0070673_100163849 | 3300005364 | Bacteria | 1892 |
| 51 | Ga0070673_100283936 | 3300005364 | Bacteria | 1453 |
| 52 | Ga0070659_100075953 | 3300005366 | Bacteria | 2679 |
| 53 | Ga0070659_100212422 | 3300005366 | Bacteria | 1595 |
| 54 | Ga0070667_100033806 | 3300005367 | Bacteria | 4277 |
| 55 | Ga0070667_100050187 | 3300005367 | Bacteria | 3516 |
| 56 | Ga0070667_100052812 | 3300005367 | Bacteria | 3430 |
| 57 | Ga0070667_100058139 | 3300005367 | Bacteria | 3269 |
| 58 | Ga0070667_100086665 | 3300005367 | Bacteria | 2687 |
| 59 | Ga0070667_100195856 | 3300005367 | Bacteria | 1791 |
| 60 | Ga0070667_100369256 | 3300005367 | Bacteria | 1301 |
| 61 | Ga0070667_100717555 | 3300005367 | Bacteria | 926 |
| 62 | Ga0070713_100080286 | 3300005436 | Bacteria | 2781 |
| 63 | Ga0070701_10084876 | 3300005438 | Bacteria | 1723 |
| 64 | Ga0070700_100035579 | 3300005441 | Bacteria | 3015 |
| 65 | Ga0070708_100276277 | 3300005445 | Bacteria | 1581 |
| 66 | Ga0070663_100031220 | 3300005455 | Bacteria | 3660 |
| 67 | Ga0070678_100005397 | 3300005456 | Bacteria | 7375 |
| 68 | Ga0070678_100086435 | 3300005456 | Bacteria | 2392 |
| 69 | Ga0070678_100272185 | 3300005456 | Bacteria | 1429 |
| 70 | Ga0070662_100048626 | 3300005457 | Bacteria | 3055 |
| 71 | Ga0068867_100002610 | 3300005459 | Bacteria | 12706 |
| 72 | Ga0068867_100012813 | 3300005459 | Bacteria | 5933 |
| 73 | Ga0068867_100047752 | 3300005459 | Bacteria | 3148 |
| 74 | Ga0068867_100112111 | 3300005459 | Bacteria | 2097 |
| 75 | Ga0070685_10330626 | 3300005466 | Bacteria | 1036 |
| 76 | Ga0070706_100003542 | 3300005467 | Bacteria | 15348 |
| 77 | Ga0070698_100150529 | 3300005471 | Bacteria | 2274 |
| 78 | Ga0070699_100164192 | 3300005518 | Bacteria | 1967 |
| 79 | Ga0070684_100430777 | 3300005535 | Bacteria | 1218 |
| 80 | Ga0070672_100002849 | 3300005543 | Bacteria | 11093 |
| 81 | Ga0070672_100010466 | 3300005543 | Bacteria | 6434 |
| 82 | Ga0070672_100036184 | 3300005543 | Bacteria | 3759 |
| 83 | Ga0070672_100092454 | 3300005543 | Bacteria | 2442 |
| 84 | Ga0070672_100113678 | 3300005543 | Bacteria | 2209 |
| 85 | Ga0070696_100003110 | 3300005546 | Bacteria | 11041 |
| 86 | Ga0070665_100006913 | 3300005548 | Bacteria | 11529 |
| 87 | Ga0070665_100025455 | 3300005548 | Bacteria | 5961 |
| 88 | Ga0070665_100389898 | 3300005548 | Bacteria | 1400 |
| 89 | Ga0070665_100771222 | 3300005548 | Bacteria | 974 |
| 90 | Ga0070664_100307214 | 3300005564 | Bacteria | 1434 |
| 91 | Ga0068857_100121642 | 3300005577 | Bacteria | 2350 |
| 92 | Ga0068857_100383297 | 3300005577 | Bacteria | 1306 |
| 93 | Ga0068857_100406967 | 3300005577 | Bacteria | 1267 |
| 94 | Ga0068854_100120914 | 3300005578 | Bacteria | 1988 |
| 95 | Ga0068856_100181045 | 3300005614 | Bacteria | 2120 |
| 96 | Ga0068852_100247236 | 3300005616 | Bacteria | 1707 |
| 97 | Ga0068859_100018309 | 3300005617 | Bacteria | 7042 |
| 98 | Ga0068859_100073756 | 3300005617 | Bacteria | 3450 |
| 99 | Ga0068859_100091539 | 3300005617 | Bacteria | 3092 |
| 100 | Ga0068859_100121002 | 3300005617 | Bacteria | 2684 |
| 101 | Ga0068864_100010268 | 3300005618 | Bacteria | 7732 |
| 102 | Ga0068864_100055639 | 3300005618 | Bacteria | 3416 |
| 103 | Ga0068864_100118256 | 3300005618 | Bacteria | 2366 |
| 104 | Ga0068864_100122304 | 3300005618 | Bacteria | 2328 |
| 105 | Ga0068864_100315586 | 3300005618 | Bacteria | 1467 |
| 106 | Ga0068866_10028786 | 3300005718 | Bacteria | 2650 |
| 107 | Ga0068861_100002798 | 3300005719 | Bacteria | 11463 |
| 108 | Ga0068861_100008169 | 3300005719 | Bacteria | 7202 |
| 109 | Ga0068851_10001307 | 3300005834 | Bacteria | 10851 |
| 110 | Ga0068851_10058040 | 3300005834 | Bacteria | 1977 |
| 111 | Ga0068851_10234962 | 3300005834 | Bacteria | 1034 |
| 112 | Ga0068863_100007247 | 3300005841 | Bacteria | 10867 |
| 113 | Ga0068863_100014591 | 3300005841 | Bacteria | 7564 |
| 114 | Ga0068863_100022212 | 3300005841 | Bacteria | 6059 |
| 115 | Ga0068863_100031218 | 3300005841 | Bacteria | 5085 |
| 116 | Ga0068863_100033017 | 3300005841 | Bacteria | 4931 |
| 117 | Ga0068863_100041906 | 3300005841 | Bacteria | 4351 |
| 118 | Ga0068863_100054240 | 3300005841 | Bacteria | 3798 |
| 119 | Ga0068858_100001501 | 3300005842 | Bacteria | 24053 |
| 120 | Ga0068858_100014852 | 3300005842 | Bacteria | 7325 |
| 121 | Ga0068858_100145986 | 3300005842 | Bacteria | 2222 |
| 122 | Ga0068860_100000887 | 3300005843 | Bacteria | 33240 |
| 123 | Ga0068860_100001383 | 3300005843 | Bacteria | 26323 |
| 124 | Ga0068862_100003804 | 3300005844 | Bacteria | 12855 |
| 125 | Ga0068862_100041402 | 3300005844 | Bacteria | 3919 |
| 126 | Ga0075367_10050285 | 3300006178 | Bacteria | 2460 |
| 127 | Ga0075366_10016865 | 3300006195 | Bacteria | 4199 |
| 128 | Ga0097621_100013309 | 3300006237 | Bacteria | 6128 |
| 129 | Ga0097621_100379163 | 3300006237 | Bacteria | 1263 |
| 130 | Ga0075370_10093959 | 3300006353 | Bacteria | 1731 |
| 131 | Ga0075370_10121926 | 3300006353 | Bacteria | 1518 |
| 132 | Ga0068871_100043036 | 3300006358 | Bacteria | 3627 |
| 133 | Ga0068871_100365582 | 3300006358 | Bacteria | 1279 |
| 134 | Ga0068871_100482833 | 3300006358 | Bacteria | 1115 |
| 135 | Ga0068871_100520716 | 3300006358 | Bacteria | 1074 |
| 136 | Ga0075428_100020551 | 3300006844 | Bacteria | 7311 |
| 137 | Ga0075428_100034174 | 3300006844 | Bacteria | 5609 |
| 138 | Ga0075428_100035932 | 3300006844 | Bacteria | 5460 |
| 139 | Ga0075431_100023575 | 3300006847 | Bacteria | 6299 |
| 140 | Ga0075431_100026802 | 3300006847 | Bacteria | 5911 |
| 141 | Ga0075433_10008299 | 3300006852 | Bacteria | 8280 |
| 142 | Ga0075429_100021214 | 3300006880 | Bacteria | 5631 |
| 143 | Ga0068865_100017925 | 3300006881 | Bacteria | 4561 |
| 144 | Ga0068865_100043261 | 3300006881 | Bacteria | 3076 |
| 145 | Ga0068865_100107372 | 3300006881 | Bacteria | 2053 |
| 146 | Ga0068865_100213184 | 3300006881 | Bacteria | 1506 |
| 147 | Ga0068865_100292811 | 3300006881 | Bacteria | 1300 |
| 148 | Ga0097620_100018309 | 3300006931 | Bacteria | 7042 |
| 149 | Ga0097620_100073756 | 3300006931 | Bacteria | 3450 |
| 150 | Ga0097620_100091538 | 3300006931 | Bacteria | 3092 |
| 151 | Ga0097620_100121007 | 3300006931 | Bacteria | 2684 |
| 152 | Ga0079104_1007715 | 3300006946 | Bacteria | 3855 |
| 153 | Ga0111539_10017029 | 3300009094 | Bacteria | 8996 |
| 154 | Ga0105245_10071927 | 3300009098 | Bacteria | 3141 |
| 155 | Ga0105245_10463696 | 3300009098 | Bacteria | 1277 |
| 156 | Ga0105245_10698287 | 3300009098 | Bacteria | 1048 |
| 157 | Ga0105247_10104332 | 3300009101 | Bacteria | 1816 |
| 158 | Ga0114129_10044298 | 3300009147 | Bacteria | 6260 |
| 159 | Ga0105243_10051938 | 3300009148 | Bacteria | 3244 |
| 160 | Ga0105243_10118602 | 3300009148 | Bacteria | 2227 |
| 161 | Ga0105241_10342665 | 3300009174 | Bacteria | 1295 |
| 162 | Ga0105242_10072383 | 3300009176 | Bacteria | 2862 |
| 163 | Ga0105242_10099151 | 3300009176 | Bacteria | 2466 |
| 164 | Ga0105242_10342584 | 3300009176 | Bacteria | 1378 |
| 165 | Ga0105248_10044692 | 3300009177 | Bacteria | 4968 |
| 166 | Ga0105248_10053979 | 3300009177 | Bacteria | 4507 |
| 167 | Ga0105248_10088842 | 3300009177 | Bacteria | 3478 |
| 168 | Ga0105248_10134212 | 3300009177 | Bacteria | 2793 |
| 169 | Ga0105248_10531267 | 3300009177 | Bacteria | 1327 |
| 170 | Ga0105248_10738669 | 3300009177 | Bacteria | 1110 |
| 171 | Ga0105237_10077421 | 3300009545 | Bacteria | 3315 |
| 172 | Ga0105237_10211855 | 3300009545 | Bacteria | 1937 |
| 173 | Ga0105238_10056685 | 3300009551 | Bacteria | 3930 |
| 174 | Ga0105238_10241694 | 3300009551 | Bacteria | 1783 |
| 175 | Ga0105249_10016954 | 3300009553 | Bacteria | 6463 |
| 176 | Ga0105249_10561140 | 3300009553 | Bacteria | 1193 |
| 177 | Ga0105246_10046791 | 3300011119 | Bacteria | 2952 |
| 178 | Ga0157371_10211600 | 3300013102 | Bacteria | 1391 |
| 179 | Ga0157370_10103811 | 3300013104 | Bacteria | 2660 |
| 180 | Ga0157374_10388059 | 3300013296 | Bacteria | 1392 |
| 181 | Ga0157374_10790492 | 3300013296 | Bacteria | 964 |
| 182 | Ga0157378_10002940 | 3300013297 | Bacteria | 15150 |
| 183 | Ga0157378_10174393 | 3300013297 | Bacteria | 2019 |
| 184 | Ga0157378_10832349 | 3300013297 | Bacteria | 950 |
| 185 | Ga0163162_10009038 | 3300013306 | Bacteria | 9685 |
| 186 | Ga0163162_10156902 | 3300013306 | Bacteria | 2396 |
| 187 | Ga0163162_10172071 | 3300013306 | Bacteria | 2290 |
| 188 | Ga0163162_10348497 | 3300013306 | Bacteria | 1614 |
| 189 | Ga0157375_10045415 | 3300013308 | Bacteria | 4275 |
| 190 | Ga0157375_10077149 | 3300013308 | Bacteria | 3361 |
| 191 | Ga0157375_10113828 | 3300013308 | Bacteria | 2807 |
| 192 | Ga0157375_10273435 | 3300013308 | Bacteria | 1852 |
| 193 | Ga0157375_10291216 | 3300013308 | Bacteria | 1796 |
| 194 | Ga0157375_10814436 | 3300013308 | Bacteria | 1082 |
| 195 | Ga0163163_10144317 | 3300014325 | Bacteria | 2423 |
| 196 | Ga0163163_10246843 | 3300014325 | Bacteria | 1835 |
| 197 | Ga0163163_10913788 | 3300014325 | Bacteria | 941 |
| 198 | Ga0157380_10064520 | 3300014326 | Bacteria | 2940 |
| 199 | Ga0157380_10078021 | 3300014326 | Bacteria | 2701 |
| 200 | Ga0157380_10101086 | 3300014326 | Bacteria | 2402 |
| 201 | Ga0157380_10617269 | 3300014326 | Bacteria | 1076 |
| 202 | Ga0157380_10899910 | 3300014326 | Bacteria | 911 |
| 203 | Ga0157379_10091558 | 3300014968 | Bacteria | 2728 |
| 204 | Ga0157379_10176324 | 3300014968 | Bacteria | 1930 |
| 205 | Ga0157379_10765113 | 3300014968 | Bacteria | 910 |
| 206 | Ga0157376_10018173 | 3300014969 | Bacteria | 5382 |
| 207 | Ga0157376_10048419 | 3300014969 | Bacteria | 3514 |
| 208 | Ga0157376_10064677 | 3300014969 | Bacteria | 3086 |
| 209 | Ga0157376_10099751 | 3300014969 | Bacteria | 2534 |
| 210 | Ga0163161_10032563 | 3300017792 | Bacteria | 3723 |
| 211 | Ga0163161_10181671 | 3300017792 | Bacteria | 1613 |
| 212 | Ga0163161_10256007 | 3300017792 | Bacteria | 1366 |
| 213 | Ga0213876_10102858 | 3300021384 | Bacteria | 1514 |
| 214 | Ga0213871_10009898 | 3300021441 | Bacteria | 2148 |
| 215 | Ga0209455_1000566 | 3300025272 | Bacteria | 24635 |
| 216 | Ga0209676_1009602 | 3300025292 | Bacteria | 4152 |
| 217 | Ga0209050_1005397 | 3300025298 | Bacteria | 8070 |
| 218 | Ga0207697_10076530 | 3300025315 | Bacteria | 1406 |
| 219 | Ga0207656_10004179 | 3300025321 | Bacteria | 5026 |
| 220 | Ga0207682_10000207 | 3300025893 | Bacteria | 26681 |
| 221 | Ga0207682_10034026 | 3300025893 | Bacteria | 2053 |
| 222 | Ga0207688_10048803 | 3300025901 | Bacteria | 2365 |
| 223 | Ga0207647_10141996 | 3300025904 | Bacteria | 1407 |
| 224 | Ga0207645_10001642 | 3300025907 | Bacteria | 18222 |
| 225 | Ga0207645_10003256 | 3300025907 | Bacteria | 12402 |
| 226 | Ga0207645_10012366 | 3300025907 | Bacteria | 5791 |
| 227 | Ga0207645_10031204 | 3300025907 | Bacteria | 3430 |
| 228 | Ga0207645_10306430 | 3300025907 | Bacteria | 1058 |
| 229 | Ga0207705_10206106 | 3300025909 | Bacteria | 1491 |
| 230 | Ga0207684_10021243 | 3300025910 | Bacteria | 5542 |
| 231 | Ga0207695_10026298 | 3300025913 | Bacteria | 6496 |
| 232 | Ga0207662_10030867 | 3300025918 | Bacteria | 3113 |
| 233 | Ga0207657_10208705 | 3300025919 | Bacteria | 1568 |
| 234 | Ga0207646_10073512 | 3300025922 | Bacteria | 3054 |
| 235 | Ga0207681_10043502 | 3300025923 | Bacteria | 3006 |
| 236 | Ga0207681_10121812 | 3300025923 | Bacteria | 1914 |
| 237 | Ga0207650_10003576 | 3300025925 | Bacteria | 10659 |
| 238 | Ga0207650_10009488 | 3300025925 | Bacteria | 6650 |
| 239 | Ga0207650_10043702 | 3300025925 | Bacteria | 3290 |
| 240 | Ga0207650_10045594 | 3300025925 | Bacteria | 3226 |
| 241 | Ga0207650_10629527 | 3300025925 | Bacteria | 903 |
| 242 | Ga0207659_10002431 | 3300025926 | Bacteria | 11095 |
| 243 | Ga0207659_10009509 | 3300025926 | Bacteria | 6079 |
| 244 | Ga0207659_10017151 | 3300025926 | Bacteria | 4728 |
| 245 | Ga0207659_10037827 | 3300025926 | Bacteria | 3353 |
| 246 | Ga0207659_10120428 | 3300025926 | Bacteria | 2010 |
| 247 | Ga0207687_10486668 | 3300025927 | Bacteria | 1028 |
| 248 | Ga0207687_10595296 | 3300025927 | Bacteria | 931 |
| 249 | Ga0207687_10631643 | 3300025927 | Bacteria | 905 |
| 250 | Ga0207644_10001589 | 3300025931 | Bacteria | 14679 |
| 251 | Ga0207644_10027999 | 3300025931 | Bacteria | 3897 |
| 252 | Ga0207690_10184558 | 3300025932 | Bacteria | 1573 |
| 253 | Ga0207706_10001508 | 3300025933 | Bacteria | 23112 |
| 254 | Ga0207706_10032850 | 3300025933 | Bacteria | 4617 |
| 255 | Ga0207686_10161849 | 3300025934 | Bacteria | 1569 |
| 256 | Ga0207686_10350385 | 3300025934 | Bacteria | 1111 |
| 257 | Ga0207686_10357182 | 3300025934 | Bacteria | 1102 |
| 258 | Ga0207709_10073150 | 3300025935 | Bacteria | 2183 |
| 259 | Ga0207709_10376947 | 3300025935 | Bacteria | 1078 |
| 260 | Ga0207669_10023991 | 3300025937 | Bacteria | 3270 |
| 261 | Ga0207669_10029166 | 3300025937 | Bacteria | 3047 |
| 262 | Ga0207669_10036389 | 3300025937 | Bacteria | 2812 |
| 263 | Ga0207669_10039938 | 3300025937 | Bacteria | 2717 |
| 264 | Ga0207669_10044857 | 3300025937 | Bacteria | 2601 |
| 265 | Ga0207704_10002656 | 3300025938 | Bacteria | 8071 |
| 266 | Ga0207704_10451306 | 3300025938 | Bacteria | 1026 |
| 267 | Ga0207704_10487739 | 3300025938 | Bacteria | 991 |
| 268 | Ga0207691_10000127 | 3300025940 | Bacteria | 69355 |
| 269 | Ga0207691_10000846 | 3300025940 | Bacteria | 30480 |
| 270 | Ga0207691_10003752 | 3300025940 | Bacteria | 14739 |
| 271 | Ga0207691_10013729 | 3300025940 | Bacteria | 7739 |
| 272 | Ga0207691_10018677 | 3300025940 | Bacteria | 6567 |
| 273 | Ga0207691_10045169 | 3300025940 | Bacteria | 4051 |
| 274 | Ga0207691_10056758 | 3300025940 | Bacteria | 3566 |
| 275 | Ga0207691_10121274 | 3300025940 | Bacteria | 2317 |
| 276 | Ga0207711_10029923 | 3300025941 | Bacteria | 4593 |
| 277 | Ga0207711_10042409 | 3300025941 | Bacteria | 3877 |
| 278 | Ga0207711_10067651 | 3300025941 | Bacteria | 3093 |
| 279 | Ga0207689_10048147 | 3300025942 | Bacteria | 3516 |
| 280 | Ga0207689_10114295 | 3300025942 | Bacteria | 2219 |
| 281 | Ga0207689_10137975 | 3300025942 | Bacteria | 2008 |
| 282 | Ga0207661_10247635 | 3300025944 | Bacteria | 1583 |
| 283 | Ga0207679_10290667 | 3300025945 | Bacteria | 1405 |
| 284 | Ga0207651_10010844 | 3300025960 | Bacteria | 5071 |
| 285 | Ga0207651_10033176 | 3300025960 | Bacteria | 3327 |
| 286 | Ga0207651_10043856 | 3300025960 | Bacteria | 2988 |
| 287 | Ga0207712_10031620 | 3300025961 | Bacteria | 3566 |
| 288 | Ga0207712_10065389 | 3300025961 | Bacteria | 2595 |
| 289 | Ga0207712_10322642 | 3300025961 | Bacteria | 1275 |
| 290 | Ga0207640_10409670 | 3300025981 | Bacteria | 1106 |
| 291 | Ga0207640_10470205 | 3300025981 | Bacteria | 1040 |
| 292 | Ga0207658_10034200 | 3300025986 | Bacteria | 3630 |
| 293 | Ga0207658_10087441 | 3300025986 | Bacteria | 2407 |
| 294 | Ga0207658_10115526 | 3300025986 | Bacteria | 2130 |
| 295 | Ga0207658_10269876 | 3300025986 | Bacteria | 1454 |
| 296 | Ga0207658_10320471 | 3300025986 | Bacteria | 1341 |
| 297 | Ga0207658_10334252 | 3300025986 | Bacteria | 1315 |
| 298 | Ga0207677_10037715 | 3300026023 | Bacteria | 3161 |
| 299 | Ga0207703_10000318 | 3300026035 | Bacteria | 52249 |
| 300 | Ga0207703_10015668 | 3300026035 | Bacteria | 5912 |
| 301 | Ga0207639_10123454 | 3300026041 | Bacteria | 2132 |
| 302 | Ga0207678_10463234 | 3300026067 | Bacteria | 1103 |
| 303 | Ga0207708_10037978 | 3300026075 | Bacteria | 3669 |
| 304 | Ga0207708_10139170 | 3300026075 | Bacteria | 1903 |
| 305 | Ga0207702_10059528 | 3300026078 | Bacteria | 3253 |
| 306 | Ga0207641_10000721 | 3300026088 | Bacteria | 35497 |
| 307 | Ga0207641_10008611 | 3300026088 | Bacteria | 8421 |
| 308 | Ga0207641_10041711 | 3300026088 | Bacteria | 3847 |
| 309 | Ga0207641_10081807 | 3300026088 | Bacteria | 2805 |
| 310 | Ga0207641_10187746 | 3300026088 | Bacteria | 1897 |
| 311 | Ga0207648_10000799 | 3300026089 | Bacteria | 35474 |
| 312 | Ga0207648_10003102 | 3300026089 | Bacteria | 17547 |
| 313 | Ga0207648_10017634 | 3300026089 | Bacteria | 6484 |
| 314 | Ga0207648_10059758 | 3300026089 | Bacteria | 3325 |
| 315 | Ga0207648_10088738 | 3300026089 | Bacteria | 2700 |
| 316 | Ga0207648_10160206 | 3300026089 | Bacteria | 1987 |
| 317 | Ga0207648_10223184 | 3300026089 | Bacteria | 1675 |
| 318 | Ga0207648_10366587 | 3300026089 | Bacteria | 1300 |
| 319 | Ga0207676_10098527 | 3300026095 | Bacteria | 2417 |
| 320 | Ga0207676_10110071 | 3300026095 | Bacteria | 2303 |
| 321 | Ga0207676_10111808 | 3300026095 | Bacteria | 2287 |
| 322 | Ga0207676_10285128 | 3300026095 | Bacteria | 1501 |
| 323 | Ga0207676_10585059 | 3300026095 | Bacteria | 1070 |
| 324 | Ga0207674_10037482 | 3300026116 | Bacteria | 5042 |
| 325 | Ga0207675_100000205 | 3300026118 | Bacteria | 54926 |
| 326 | Ga0207675_100003220 | 3300026118 | Bacteria | 16019 |
| 327 | Ga0207675_100012363 | 3300026118 | Bacteria | 7973 |
| 328 | Ga0207675_100308285 | 3300026118 | Bacteria | 1543 |
| 329 | Ga0207675_100318722 | 3300026118 | Bacteria | 1517 |
| 330 | Ga0207683_10003804 | 3300026121 | Bacteria | 13074 |
| 331 | Ga0207683_10008294 | 3300026121 | Bacteria | 8888 |
| 332 | Ga0207683_10030377 | 3300026121 | Bacteria | 4682 |
| 333 | Ga0207683_10039136 | 3300026121 | Bacteria | 4136 |
| 334 | Ga0207683_10100452 | 3300026121 | Bacteria | 2583 |
| 335 | Ga0207683_10238570 | 3300026121 | Bacteria | 1658 |
| 336 | Ga0207683_10296538 | 3300026121 | Bacteria | 1479 |
| 337 | Ga0207698_10170172 | 3300026142 | Bacteria | 1917 |
| 338 | Ga0207698_10553696 | 3300026142 | Bacteria | 1128 |
| 339 | Ga0209281_1004875 | 3300027111 | Bacteria | 3883 |
| 340 | Ga0209371_1006575 | 3300027312 | Bacteria | 4270 |
| 341 | Ga0209983_1000057 | 3300027665 | Bacteria | 16946 |
| 342 | Ga0209998_10000641 | 3300027717 | Bacteria | 9378 |
| 343 | Ga0209974_10010235 | 3300027876 | Bacteria | 3166 |
| 344 | Ga0207428_10061282 | 3300027907 | Bacteria | 2979 |
| 345 | Ga0207428_10163081 | 3300027907 | Bacteria | 1692 |
| 346 | Ga0268266_10014568 | 3300028379 | Bacteria | 6756 |
| 347 | Ga0268266_10039553 | 3300028379 | Bacteria | 4017 |
| 348 | Ga0268266_10195253 | 3300028379 | Bacteria | 1850 |
| 349 | Ga0268266_10242918 | 3300028379 | Bacteria | 1663 |
| 350 | Ga0268265_10034022 | 3300028380 | Bacteria | 3711 |
| 351 | Ga0268265_10039450 | 3300028380 | Bacteria | 3481 |
| 352 | Ga0268265_10371914 | 3300028380 | Bacteria | 1312 |
| 353 | Ga0268264_10000373 | 3300028381 | Bacteria | 65793 |
| 354 | Ga0268264_10002625 | 3300028381 | Bacteria | 15693 |
| 355 | Ga0268264_10099782 | 3300028381 | Bacteria | 2520 |
| 356 | Ga0307517_10000052 | 3300028786 | Bacteria | 155904 |
| 357 | Ga0307515_10000358 | 3300028794 | Bacteria | 112133 |
| 358 | Ga0307515_10003504 | 3300028794 | Bacteria | 32990 |
| 359 | Ga0307515_10017024 | 3300028794 | Bacteria | 13278 |
| 360 | Ga0307515_10028554 | 3300028794 | Bacteria | 9479 |
| 361 | Ga0307515_10104667 | 3300028794 | Bacteria | 3378 |
| 362 | Ga0268256_1006625 | 3300030500 | Bacteria | 4270 |
| 363 | Ga0307512_10012320 | 3300030522 | Bacteria | 8075 |
| 364 | Ga0307513_10037344 | 3300031456 | Bacteria | 5407 |
| 365 | Ga0307509_10002117 | 3300031507 | Bacteria | 32688 |
| 366 | Ga0307509_10013408 | 3300031507 | Bacteria | 9709 |
| 367 | Ga0307509_10024236 | 3300031507 | Bacteria | 6797 |
| 368 | Ga0307509_10029302 | 3300031507 | Bacteria | 6112 |
| 369 | Ga0307509_10216644 | 3300031507 | Bacteria | 1732 |
| 370 | Ga0307509_10267057 | 3300031507 | Bacteria | 1481 |
| 371 | Ga0307408_100124380 | 3300031548 | Bacteria | 2003 |
| 372 | Ga0307408_100333935 | 3300031548 | Bacteria | 1281 |
| 373 | Ga0307508_10000053 | 3300031616 | Bacteria | 128020 |
| 374 | Ga0307508_10244006 | 3300031616 | Bacteria | 1393 |
| 375 | Ga0307514_10009268 | 3300031649 | Bacteria | 8293 |
| 376 | Ga0307514_10260914 | 3300031649 | Bacteria | 1014 |
| 377 | Ga0307516_10034119 | 3300031730 | Bacteria | 5116 |
| 378 | Ga0307405_10008662 | 3300031731 | Bacteria | 5171 |
| 379 | Ga0307405_10142693 | 3300031731 | Bacteria | 1672 |
| 380 | Ga0307413_10101936 | 3300031824 | Bacteria | 1899 |
| 381 | Ga0307413_10152944 | 3300031824 | Bacteria | 1610 |
| 382 | Ga0307413_10175090 | 3300031824 | Bacteria | 1523 |
| 383 | Ga0307410_10013807 | 3300031852 | Bacteria | 4727 |
| 384 | Ga0307410_10142019 | 3300031852 | Bacteria | 1777 |
| 385 | Ga0307406_10066072 | 3300031901 | Bacteria | 2353 |
| 386 | Ga0307407_10034564 | 3300031903 | Bacteria | 2769 |
| 387 | Ga0307407_10162104 | 3300031903 | Bacteria | 1464 |
| 388 | Ga0307412_10001167 | 3300031911 | Bacteria | 15025 |
| 389 | Ga0307412_10013973 | 3300031911 | Bacteria | 4724 |
| 390 | Ga0307412_10272645 | 3300031911 | Bacteria | 1325 |
| 391 | Ga0307409_100095983 | 3300031995 | Bacteria | 2444 |
| 392 | Ga0307409_100097537 | 3300031995 | Bacteria | 2428 |
| 393 | Ga0307416_100001303 | 3300032002 | Bacteria | 13464 |
| 394 | Ga0307416_100035126 | 3300032002 | Bacteria | 3824 |
| 395 | Ga0307416_100039700 | 3300032002 | Bacteria | 3648 |
| 396 | Ga0307416_100135747 | 3300032002 | Bacteria | 2225 |
| 397 | Ga0307416_100542778 | 3300032002 | Bacteria | 1235 |
| 398 | Ga0307416_100633299 | 3300032002 | Bacteria | 1152 |
| 399 | Ga0307414_10015531 | 3300032004 | Bacteria | 4597 |
| 400 | Ga0307414_10081091 | 3300032004 | Bacteria | 2375 |
| 401 | Ga0307411_10017113 | 3300032005 | Bacteria | 4119 |
| 402 | Ga0307411_10093622 | 3300032005 | Bacteria | 2104 |
| 403 | Ga0307415_100005445 | 3300032126 | Bacteria | 6762 |
| 404 | Ga0307415_100338432 | 3300032126 | Bacteria | 1262 |
| 405 | Ga0307507_10136927 | 3300033179 | Bacteria | 1893 |
| 406 | Ga0307507_10166568 | 3300033179 | Bacteria | 1613 |
| 407 | Ga0307510_10001123 | 3300033180 | Bacteria | 28660 |
| 408 | Ga0307510_10125131 | 3300033180 | Bacteria | 2262 |
| 409 | Ga0307510_10254894 | 3300033180 | Bacteria | 1239 |
| 410 | Ga0373939_0000239 | 3300035114 | Bacteria | 14843 |
| 411 | Ga0373960_0001500 | 3300035121 | Bacteria | 5188 |
| 412 | Ga0373931_0028290 | 3300035691 | Bacteria | 2868 |
| 413 | Ga0373935_0507337 | 3300035692 | Bacteria | 876 |
| 414 | Ga0373927_0031321 | 3300035695 | Bacteria | 3467 |
| 415 | Ga0373937_0104007 | 3300036401 | Bacteria | 2638 |
| 416 | Ga0373925_0003598 | 3300037068 | Bacteria | 11945 |
| 417 | Ga0373925_0294504 | 3300037068 | Bacteria | 1309 |
| 418 | Ga0395899_0087461 | 3300037312 | Bacteria | 2262 |
| 419 | Ga0395900_0044064 | 3300037418 | Bacteria | 4599 |
| 420 | Ga0395898_0041312 | 3300037466 | Bacteria | 4556 |
| 421 | Ga0395905_0011306 | 3300037471 | Bacteria | 8631 |
| 422 | Ga0436364_0804269 | 3300037853 | Bacteria | 3901 |
| 423 | Ga0436365_0116034 | 3300039437 | Bacteria | 3825 |
| 424 | Ga0436360_0217520 | 3300039438 | Bacteria | 3182 |
| 425 | Ga0436363_0090351 | 3300039450 | Bacteria | 4290 |
| 426 | Ga0436363_0818447 | 3300039450 | Bacteria | 743 |
| 427 | Ga0439433_0014717 | 3300041999 | Bacteria | 1724 |
| 428 | Ga0439442_005368 | 3300042002 | Bacteria | 2564 |
| 429 | Ga0439445_0006810 | 3300042004 | Bacteria | 2635 |
| 430 | Ga0439432_002542 | 3300042006 | Bacteria | 6875 |
| 431 | Ga0439449_0006606 | 3300042007 | Bacteria | 4435 |
| 432 | Ga0439452_008154 | 3300042010 | Bacteria | 3168 |
| 433 | Ga0439462_0007813 | 3300042015 | Bacteria | 2684 |
| 434 | Ga0450923_004013 | 3300042125 | Bacteria | 2278 |
| 435 | Ga0450895_004569 | 3300042132 | Bacteria | 1095 |
| 436 | Ga0450896_002017 | 3300042133 | Bacteria | 2585 |
| 437 | Ga0439446_0021365 | 3300042156 | Bacteria | 1829 |
| 438 | Ga0439434_0005056 | 3300042435 | Bacteria | 3856 |
| 439 | Ga0439434_0095636 | 3300042435 | Bacteria | 953 |
| 440 | Ga0439444_0004016 | 3300042437 | Bacteria | 2111 |
| 441 | Ga0439460_0041366 | 3300042461 | Bacteria | 1354 |
| 442 | Ga0451577_0003401 | 3300042876 | Bacteria | 17770 |
| 443 | Ga0451577_0083821 | 3300042876 | Bacteria | 2844 |
| 444 | Ga0451577_0397719 | 3300042876 | Bacteria | 1250 |
| 445 | Ga0451576_0212818 | 3300045051 | Bacteria | 2018 |
| 446 | Ga0451576_0259420 | 3300045051 | Bacteria | 1816 |
| 447 | Ga0495592_0000370 | 3300046454 | Bacteria | 35460 |
| 448 | Ga0495590_0018473 | 3300046457 | Bacteria | 2496 |
| 449 | Ga0495590_0077918 | 3300046457 | Bacteria | 1166 |
| 450 | Ga0495629_0133852 | 3300046459 | Bacteria | 1726 |
| 451 | Ga0495641_0154252 | 3300046461 | Bacteria | 1027 |
| 452 | Ga0495650_0004943 | 3300046471 | Bacteria | 8892 |
| 453 | Ga0495606_0042220 | 3300046507 | Bacteria | 3052 |
| 454 | Ga0495610_0035524 | 3300046512 | Bacteria | 2558 |
| 455 | Ga0495630_0226860 | 3300046517 | Bacteria | 1426 |
| 456 | Ga0495632_0120244 | 3300046519 | Bacteria | 1228 |
| 457 | Ga0495598_0015509 | 3300046537 | Bacteria | 1926 |
| 458 | Ga0495621_0017012 | 3300046539 | Bacteria | 2343 |
| 459 | Ga0495621_0129707 | 3300046539 | Bacteria | 980 |
| 460 | Ga0495668_0120190 | 3300046616 | Bacteria | 1437 |
| 461 | Ga0495658_0021511 | 3300046683 | Bacteria | 3401 |
| 462 | Ga0495658_0046760 | 3300046683 | Bacteria | 2434 |
| 463 | Ga0495624_0057406 | 3300046690 | Bacteria | 2447 |
| 464 | Ga0495660_0087825 | 3300046810 | Bacteria | 1621 |
| 465 | Ga0495674_0283840 | 3300047319 | Bacteria | 1356 |
| 466 | Ga0495672_0033634 | 3300047320 | Bacteria | 3175 |
| 467 | Ga0495676_0037805 | 3300047321 | Bacteria | 4014 |
| 468 | Ga0495687_007340 | 3300047443 | Bacteria | 6515 |
| 469 | Ga0495681_0134308 | 3300047470 | Bacteria | 1051 |
| 470 | Ga0495684_0084233 | 3300047471 | Bacteria | 2412 |
| 471 | Ga0495686_0013777 | 3300047472 | Bacteria | 5602 |
| 472 | Ga0495593_0025281 | 3300047673 | Bacteria | 3286 |
| 473 | Ga0495614_0087608 | 3300048089 | Bacteria | 1352 |
| 474 | Ga0495614_0127394 | 3300048089 | Bacteria | 1125 |
| 475 | Ga0496100_0259363 | 3300048903 | Bacteria | 1289 |
| 476 | Ga0496102_0445177 | 3300048905 | Bacteria | 1215 |
| 477 | Ga0496103_0161945 | 3300048906 | Bacteria | 1435 |
| 478 | Ga0496108_0489606 | 3300048911 | Bacteria | 1074 |
| 479 | Ga0496110_0026602 | 3300048913 | Bacteria | 4953 |
| 480 | Ga0496114_0226734 | 3300048917 | Bacteria | 1641 |
| 481 | Ga0496114_1049779 | 3300048917 | Bacteria | 699 |
| 482 | Ga0496116_0008170 | 3300048919 | Bacteria | 9134 |
| 483 | Ga0496116_0030720 | 3300048919 | Bacteria | 3855 |
| 484 | Ga0496117_0022859 | 3300048920 | Bacteria | 5007 |
| 485 | Ga0496118_0005781 | 3300048921 | Bacteria | 13889 |
| 486 | Ga0496118_0032451 | 3300048921 | Bacteria | 4301 |
| 487 | Ga0496119_0018081 | 3300048922 | Bacteria | 5266 |
| 488 | Ga0496120_0063561 | 3300048923 | Bacteria | 2052 |
| 489 | Ga0496121_0000314 | 3300048924 | Bacteria | 100909 |
| 490 | Ga0496121_0025188 | 3300048924 | Bacteria | 5657 |
| 491 | Ga0496122_0000046 | 3300048925 | Bacteria | 274640 |
| 492 | Ga0496122_0038261 | 3300048925 | Bacteria | 3847 |
| 493 | Ga0496123_0000082 | 3300048926 | Bacteria | 188909 |
| 494 | Ga0496124_0254698 | 3300048927 | Bacteria | 1295 |
| 495 | Ga0496125_0000028 | 3300048928 | Bacteria | 387222 |
| 496 | Ga0496125_0000854 | 3300048928 | Bacteria | 48916 |
| 497 | Ga0496125_0009558 | 3300048928 | Bacteria | 9941 |
| 498 | Ga0496126_0021467 | 3300048929 | Bacteria | 6305 |
| 499 | Ga0496126_0031548 | 3300048929 | Bacteria | 5004 |
| 500 | Ga0496126_0035484 | 3300048929 | Bacteria | 4674 |
| 501 | Ga0501032_0294285 | 3300049569 | Bacteria | 1050 |
| 502 | Ga0501033_0022359 | 3300049570 | Bacteria | 4771 |
| 503 | Ga0501034_0147189 | 3300049571 | Bacteria | 2332 |
| 504 | Ga0501036_0001323 | 3300049572 | Bacteria | 19023 |
| 505 | Ga0501038_0023395 | 3300049574 | Bacteria | 5524 |
| 506 | Ga0501038_0031829 | 3300049574 | Bacteria | 4659 |
| 507 | Ga0501039_0001406 | 3300049575 | Bacteria | 17703 |
| 508 | Ga0501039_0032244 | 3300049575 | Bacteria | 4039 |
| 509 | Ga0501040_0126635 | 3300049576 | Bacteria | 1794 |
| 510 | Ga0501042_0007611 | 3300049578 | Bacteria | 7107 |
| 511 | Ga0501043_0711032 | 3300049579 | Bacteria | 733 |
| 512 | Ga0501046_0030231 | 3300049580 | Bacteria | 4398 |
| 513 | Ga0501046_0172036 | 3300049580 | Bacteria | 1625 |
| 514 | Ga0501047_0002464 | 3300049581 | Bacteria | 17651 |
| 515 | Ga0501048_0017159 | 3300049582 | Bacteria | 5336 |
| 516 | Ga0501068_0005693 | 3300049584 | Bacteria | 6824 |
| 517 | Ga0501071_0026671 | 3300049587 | Bacteria | 4058 |
| 518 | Ga0501074_0206344 | 3300049590 | Bacteria | 1400 |
| 519 | Ga0501076_0003858 | 3300049592 | Bacteria | 10557 |
| 520 | Ga0501076_0102992 | 3300049592 | Bacteria | 2302 |
| 521 | Ga0501079_0295658 | 3300049741 | Bacteria | 1267 |
| 522 | Ga0501081_0017702 | 3300049743 | Bacteria | 4722 |
| 523 | Ga0501035_0008851 | 3300049822 | Bacteria | 9366 |
| 524 | Ga0501035_0019386 | 3300049822 | Bacteria | 6256 |
| 525 | Ga0501035_0029433 | 3300049822 | Bacteria | 5008 |
| 526 | Ga0501044_0000022 | 3300049823 | Bacteria | 201689 |
| 527 | Ga0501044_0040830 | 3300049823 | Bacteria | 4833 |
| 528 | Ga0501044_0059324 | 3300049823 | Bacteria | 3920 |
| 529 | Ga0501045_0012264 | 3300049824 | Bacteria | 6036 |
| 530 | nmdc:mga06z11_252922_c1 | 3300050494 | Bacteria | 1038 |
| 531 | nmdc:mga07m45_79236_c1 | 3300050496 | Bacteria | 1875 |
| 532 | nmdc:mga05p37_43331_c1 | 3300050507 | Bacteria | 5536 |
| 533 | nmdc:mga05p37_835647_c1 | 3300050507 | Bacteria | 1002 |
| 534 | nmdc:mga09592_43177_c1 | 3300050508 | Bacteria | 3794 |
| 535 | nmdc:mga06r32_102907_c1 | 3300050510 | Bacteria | 2804 |
| 536 | nmdc:mga06r32_32080_c1 | 3300050510 | Bacteria | 4939 |
| 537 | nmdc:mga08y16_222889_c1 | 3300050511 | Bacteria | 1952 |
| 538 | nmdc:mga08y16_85784_c1 | 3300050511 | Bacteria | 3282 |
| 539 | nmdc:mga0n895_2463_c1 | 3300050512 | Bacteria | 14477 |
| 540 | nmdc:mga08x19_176731_c1 | 3300050514 | Bacteria | 1456 |
| 541 | nmdc:mga0a205_2569_c1 | 3300050515 | Bacteria | 16006 |
| 542 | Ga0500578_0011753 | 3300053086 | Bacteria | 5654 |
| 543 | Ga0500643_000258 | 3300053087 | Bacteria | 47298 |
| 544 | Ga0500651_0067977 | 3300053093 | Bacteria | 2219 |
| 545 | Ga0500641_0000180 | 3300053096 | Bacteria | 23776 |
| 546 | Ga0500650_0101848 | 3300053098 | Bacteria | 1343 |
| 547 | Ga0500556_0010134 | 3300053104 | Bacteria | 2757 |
| 548 | Ga0500557_058593 | 3300053105 | Bacteria | 1247 |
| 549 | Ga0500607_071221 | 3300053121 | Bacteria | 1795 |
| 550 | Ga0500652_074936 | 3300053131 | Bacteria | 1406 |
| 551 | Ga0500652_077904 | 3300053131 | Bacteria | 1379 |
| 552 | Ga0500658_0003162 | 3300053134 | Bacteria | 6280 |
| 553 | Ga0500559_0000041 | 3300053136 | Bacteria | 104877 |
| 554 | Ga0500568_0039618 | 3300053139 | Bacteria | 1901 |
| 555 | Ga0500568_0089800 | 3300053139 | Bacteria | 1159 |
| 556 | Ga0500616_0005445 | 3300053153 | Bacteria | 8637 |
| 557 | Ga0500616_0008837 | 3300053153 | Bacteria | 6196 |
| 558 | Ga0500622_0003555 | 3300053156 | Bacteria | 10302 |
| 559 | Ga0500622_0003593 | 3300053156 | Bacteria | 10221 |
| 560 | Ga0500622_0005836 | 3300053156 | Bacteria | 7292 |
| 561 | Ga0500645_000789 | 3300053730 | Bacteria | 19068 |
| 562 | Ga0500645_001374 | 3300053730 | Bacteria | 12490 |
| 563 | Ga0500645_016606 | 3300053730 | Bacteria | 2316 |
| 564 | Ga0501082_0005387 | 3300060353 | Bacteria | 11102 |
| 565 | Ga0501082_0026969 | 3300060353 | Bacteria | 4949 |
| 566 | Ga0501082_0414680 | 3300060353 | Bacteria | 1176 |
| 567 | Ga0530510_0051497 | 3300061734 | Bacteria | 2975 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053131 | Ga0500652_077904 | Ga0500652_077904_393_1076 | 210 |
| 2 | 3300048903 | Ga0496100_0259363 | Ga0496100_0259363_603_1268 | 221 |
| 3 | 3300048917 | Ga0496114_1049779 | Ga0496114_1049779_10_675 | 221 |
| 4 | 3300005367 | Ga0070667_100052812 | Ga0070667_1000528122 | 230 |
| 5 | 3300014969 | Ga0157376_10099751 | Ga0157376_100997512 | 230 |
| 6 | 3300025940 | Ga0207691_10018677 | Ga0207691_100186775 | 230 |
| 7 | 3300025986 | Ga0207658_10115526 | Ga0207658_101155262 | 230 |
| 8 | 3300026121 | Ga0207683_10008294 | Ga0207683_100082946 | 230 |
| 9 | 3300005456 | Ga0070678_100005397 | Ga0070678_1000053974 | 231 |
| 10 | 3300039450 | Ga0436363_0818447 | Ga0436363_0818447_16_711 | 231 |
| 11 | 3300050507 | nmdc:mga05p37_43331_c1 | nmdc:mga05p37_43331_c1_4814_5509 | 231 |
| 12 | 3300025925 | Ga0207650_10629527 | Ga0207650_106295271 | 232 |
| 13 | 3300005347 | Ga0070668_100096386 | Ga0070668_1000963862 | 234 |
| 14 | 3300005353 | Ga0070669_100040781 | Ga0070669_1000407813 | 234 |
| 15 | 3300005367 | Ga0070667_100050187 | Ga0070667_1000501873 | 234 |
| 16 | 3300005459 | Ga0068867_100002610 | Ga0068867_1000026108 | 234 |
| 17 | 3300005617 | Ga0068859_100121002 | Ga0068859_1001210022 | 234 |
| 18 | 3300005719 | Ga0068861_100002798 | Ga0068861_1000027986 | 234 |
| 19 | 3300005843 | Ga0068860_100001383 | Ga0068860_10000138318 | 234 |
| 20 | 3300005844 | Ga0068862_100041402 | Ga0068862_1000414022 | 234 |
| 21 | 3300006881 | Ga0068865_100017925 | Ga0068865_1000179252 | 234 |
| 22 | 3300006931 | Ga0097620_100121007 | Ga0097620_1001210072 | 234 |
| 23 | 3300009174 | Ga0105241_10342665 | Ga0105241_103426652 | 234 |
| 24 | 3300009553 | Ga0105249_10016954 | Ga0105249_100169545 | 234 |
| 25 | 3300013297 | Ga0157378_10002940 | Ga0157378_100029402 | 234 |
| 26 | 3300013306 | Ga0163162_10009038 | Ga0163162_100090382 | 234 |
| 27 | 3300013308 | Ga0157375_10113828 | Ga0157375_101138282 | 234 |
| 28 | 3300017792 | Ga0163161_10256007 | Ga0163161_102560072 | 234 |
| 29 | 3300025923 | Ga0207681_10043502 | Ga0207681_100435023 | 234 |
| 30 | 3300025938 | Ga0207704_10002656 | Ga0207704_100026564 | 234 |
| 31 | 3300025940 | Ga0207691_10121274 | Ga0207691_101212742 | 234 |
| 32 | 3300025961 | Ga0207712_10065389 | Ga0207712_100653892 | 234 |
| 33 | 3300026067 | Ga0207678_10463234 | Ga0207678_104632342 | 234 |
| 34 | 3300026089 | Ga0207648_10000799 | Ga0207648_1000079918 | 234 |
| 35 | 3300026118 | Ga0207675_100003220 | Ga0207675_10000322010 | 234 |
| 36 | 3300028380 | Ga0268265_10039450 | Ga0268265_100394502 | 234 |
| 37 | 3300028381 | Ga0268264_10002625 | Ga0268264_100026259 | 234 |
| 38 | 3300014326 | Ga0157380_10078021 | Ga0157380_100780213 | 235 |
| 39 | 3300049579 | Ga0501043_0711032 | Ga0501043_0711032_11_721 | 236 |
| 40 | 3300053730 | Ga0500645_016606 | Ga0500645_016606_1235_2023 | 236 |
| 41 | 3300005329 | Ga0070683_100170703 | Ga0070683_1001707032 | 237 |
| 42 | 3300005344 | Ga0070661_100119433 | Ga0070661_1001194332 | 237 |
| 43 | 3300005366 | Ga0070659_100212422 | Ga0070659_1002124223 | 237 |
| 44 | 3300005616 | Ga0068852_100247236 | Ga0068852_1002472362 | 237 |
| 45 | 3300013102 | Ga0157371_10211600 | Ga0157371_102116002 | 237 |
| 46 | 3300013297 | Ga0157378_10174393 | Ga0157378_101743932 | 237 |
| 47 | 3300025944 | Ga0207661_10247635 | Ga0207661_102476352 | 237 |
| 48 | 3300035692 | Ga0373935_0507337 | Ga0373935_0507337_14_817 | 238 |
| 49 | 3300046683 | Ga0495658_0046760 | Ga0495658_0046760_297_1100 | 238 |
| 50 | 3300047319 | Ga0495674_0283840 | Ga0495674_0283840_479_1282 | 238 |
| 51 | 3300049741 | Ga0501079_0295658 | Ga0501079_0295658_325_1113 | 238 |
| 52 | 3300005331 | Ga0070670_100078217 | Ga0070670_1000782173 | 239 |
| 53 | 3300005333 | Ga0070677_10071266 | Ga0070677_100712662 | 239 |
| 54 | 3300005354 | Ga0070675_100051959 | Ga0070675_1000519593 | 239 |
| 55 | 3300005456 | Ga0070678_100086435 | Ga0070678_1000864353 | 239 |
| 56 | 3300005543 | Ga0070672_100092454 | Ga0070672_1000924543 | 239 |
| 57 | 3300014325 | Ga0163163_10144317 | Ga0163163_101443172 | 239 |
| 58 | 3300025925 | Ga0207650_10009488 | Ga0207650_100094884 | 239 |
| 59 | 3300025926 | Ga0207659_10037827 | Ga0207659_100378272 | 239 |
| 60 | 3300026089 | Ga0207648_10223184 | Ga0207648_102231841 | 239 |
| 61 | 3300026121 | Ga0207683_10100452 | Ga0207683_101004523 | 239 |
| 62 | 3300060353 | Ga0501082_0005387 | Ga0501082_0005387_9908_10699 | 239 |
| 63 | 3300005834 | Ga0068851_10234962 | Ga0068851_102349621 | 240 |
| 64 | 3300025926 | Ga0207659_10120428 | Ga0207659_101204283 | 240 |
| 65 | 3300026089 | Ga0207648_10366587 | Ga0207648_103665871 | 240 |
| 66 | 3300028379 | Ga0268266_10242918 | Ga0268266_102429182 | 240 |
| 67 | 3300046457 | Ga0495590_0018473 | Ga0495590_0018473_695_1534 | 240 |
| 68 | 3300046810 | Ga0495660_0087825 | Ga0495660_0087825_284_1123 | 240 |
| 69 | 3300060353 | Ga0501082_0414680 | Ga0501082_0414680_161_958 | 240 |
| 70 | 3300005328 | Ga0070676_10104959 | Ga0070676_101049591 | 241 |
| 71 | 3300009098 | Ga0105245_10463696 | Ga0105245_104636962 | 241 |
| 72 | 3300013104 | Ga0157370_10103811 | Ga0157370_101038113 | 241 |
| 73 | 3300025909 | Ga0207705_10206106 | Ga0207705_102061062 | 241 |
| 74 | 3300032002 | Ga0307416_100542778 | Ga0307416_1005427782 | 241 |
| 75 | 3300048089 | Ga0495614_0087608 | Ga0495614_0087608_195_1031 | 241 |
| 76 | 3300005334 | Ga0068869_100215260 | Ga0068869_1002152602 | 242 |
| 77 | 3300005338 | Ga0068868_100075800 | Ga0068868_1000758002 | 242 |
| 78 | 3300005343 | Ga0070687_100099758 | Ga0070687_1000997582 | 242 |
| 79 | 3300005355 | Ga0070671_100003531 | Ga0070671_1000035313 | 242 |
| 80 | 3300005356 | Ga0070674_100052253 | Ga0070674_1000522534 | 242 |
| 81 | 3300005367 | Ga0070667_100195856 | Ga0070667_1001958562 | 242 |
| 82 | 3300005438 | Ga0070701_10084876 | Ga0070701_100848762 | 242 |
| 83 | 3300005441 | Ga0070700_100035579 | Ga0070700_1000355793 | 242 |
| 84 | 3300005617 | Ga0068859_100073756 | Ga0068859_1000737564 | 242 |
| 85 | 3300005618 | Ga0068864_100118256 | Ga0068864_1001182562 | 242 |
| 86 | 3300005841 | Ga0068863_100033017 | Ga0068863_1000330172 | 242 |
| 87 | 3300005841 | Ga0068863_100041906 | Ga0068863_1000419063 | 242 |
| 88 | 3300005842 | Ga0068858_100014852 | Ga0068858_1000148524 | 242 |
| 89 | 3300006931 | Ga0097620_100073756 | Ga0097620_1000737562 | 242 |
| 90 | 3300009098 | Ga0105245_10698287 | Ga0105245_106982871 | 242 |
| 91 | 3300009148 | Ga0105243_10118602 | Ga0105243_101186022 | 242 |
| 92 | 3300009176 | Ga0105242_10072383 | Ga0105242_100723832 | 242 |
| 93 | 3300009177 | Ga0105248_10738669 | Ga0105248_107386691 | 242 |
| 94 | 3300013308 | Ga0157375_10814436 | Ga0157375_108144361 | 242 |
| 95 | 3300017792 | Ga0163161_10181671 | Ga0163161_101816712 | 242 |
| 96 | 3300025901 | Ga0207688_10048803 | Ga0207688_100488032 | 242 |
| 97 | 3300025907 | Ga0207645_10031204 | Ga0207645_100312042 | 242 |
| 98 | 3300025918 | Ga0207662_10030867 | Ga0207662_100308673 | 242 |
| 99 | 3300025925 | Ga0207650_10043702 | Ga0207650_100437022 | 242 |
| 100 | 3300025927 | Ga0207687_10486668 | Ga0207687_104866682 | 242 |
| 101 | 3300025931 | Ga0207644_10001589 | Ga0207644_100015899 | 242 |
| 102 | 3300025933 | Ga0207706_10032850 | Ga0207706_100328503 | 242 |
| 103 | 3300025934 | Ga0207686_10350385 | Ga0207686_103503851 | 242 |
| 104 | 3300025940 | Ga0207691_10045169 | Ga0207691_100451694 | 242 |
| 105 | 3300025942 | Ga0207689_10137975 | Ga0207689_101379753 | 242 |
| 106 | 3300025961 | Ga0207712_10031620 | Ga0207712_100316203 | 242 |
| 107 | 3300025986 | Ga0207658_10320471 | Ga0207658_103204711 | 242 |
| 108 | 3300026075 | Ga0207708_10037978 | Ga0207708_100379783 | 242 |
| 109 | 3300026088 | Ga0207641_10081807 | Ga0207641_100818072 | 242 |
| 110 | 3300026118 | Ga0207675_100012363 | Ga0207675_1000123636 | 242 |
| 111 | 3300026142 | Ga0207698_10170172 | Ga0207698_101701723 | 242 |
| 112 | 3300046537 | Ga0495598_0015509 | Ga0495598_0015509_733_1536 | 242 |
| 113 | 3300049580 | Ga0501046_0030231 | Ga0501046_0030231_3285_4076 | 242 |
| 114 | 3300005331 | Ga0070670_100154247 | Ga0070670_1001542471 | 243 |
| 115 | 3300005354 | Ga0070675_100053171 | Ga0070675_1000531712 | 243 |
| 116 | 3300005356 | Ga0070674_100052928 | Ga0070674_1000529282 | 243 |
| 117 | 3300005364 | Ga0070673_100163849 | Ga0070673_1001638491 | 243 |
| 118 | 3300005718 | Ga0068866_10028786 | Ga0068866_100287862 | 243 |
| 119 | 3300017792 | Ga0163161_10032563 | Ga0163161_100325633 | 243 |
| 120 | 3300025893 | Ga0207682_10034026 | Ga0207682_100340263 | 243 |
| 121 | 3300025937 | Ga0207669_10029166 | Ga0207669_100291663 | 243 |
| 122 | 3300026118 | Ga0207675_100318722 | Ga0207675_1003187222 | 243 |
| 123 | 3300026121 | Ga0207683_10039136 | Ga0207683_100391363 | 243 |
| 124 | 3300047471 | Ga0495684_0084233 | Ga0495684_0084233_636_1439 | 244 |
| 125 | 3300053156 | Ga0500622_0005836 | Ga0500622_0005836_789_1580 | 244 |
| 126 | 3300049572 | Ga0501036_0001323 | Ga0501036_0001323_7149_7946 | 245 |
| 127 | 3300049574 | Ga0501038_0023395 | Ga0501038_0023395_3028_3825 | 245 |
| 128 | 3300049575 | Ga0501039_0001406 | Ga0501039_0001406_7006_7803 | 245 |
| 129 | 3300049576 | Ga0501040_0126635 | Ga0501040_0126635_938_1735 | 245 |
| 130 | 3300049578 | Ga0501042_0007611 | Ga0501042_0007611_3791_4588 | 245 |
| 131 | 3300049582 | Ga0501048_0017159 | Ga0501048_0017159_1256_2053 | 245 |
| 132 | 3300049590 | Ga0501074_0206344 | Ga0501074_0206344_180_977 | 245 |
| 133 | 3300049592 | Ga0501076_0003858 | Ga0501076_0003858_5345_6142 | 245 |
| 134 | 3300049743 | Ga0501081_0017702 | Ga0501081_0017702_947_1744 | 245 |
| 135 | 3300049822 | Ga0501035_0029433 | Ga0501035_0029433_2968_3765 | 245 |
| 136 | 3300049824 | Ga0501045_0012264 | Ga0501045_0012264_1006_1803 | 245 |
| 137 | 3300053139 | Ga0500568_0039618 | Ga0500568_0039618_143_934 | 245 |
| 138 | 3300053139 | Ga0500568_0089800 | Ga0500568_0089800_146_937 | 245 |
| 139 | 3300060353 | Ga0501082_0026969 | Ga0501082_0026969_1481_2278 | 245 |
| 140 | 3300061734 | Ga0530510_0051497 | Ga0530510_0051497_892_1689 | 245 |
| 141 | 3300021441 | Ga0213871_10009898 | Ga0213871_100098982 | 246 |
| 142 | 3300039438 | Ga0436360_0217520 | Ga0436360_0217520_1918_2712 | 246 |
| 143 | 3300046683 | Ga0495658_0021511 | Ga0495658_0021511_301_1104 | 246 |
| 144 | 3300009176 | Ga0105242_10099151 | Ga0105242_100991512 | 247 |
| 145 | 3300025934 | Ga0207686_10357182 | Ga0207686_103571821 | 247 |
| 146 | 3300053087 | Ga0500643_000258 | Ga0500643_000258_16554_17342 | 248 |
| 147 | 3300053096 | Ga0500641_0000180 | Ga0500641_0000180_21907_22695 | 248 |
| 148 | 3300053104 | Ga0500556_0010134 | Ga0500556_0010134_1785_2573 | 248 |
| 149 | 3300053105 | Ga0500557_058593 | Ga0500557_058593_370_1158 | 248 |
| 150 | 3300053153 | Ga0500616_0008837 | Ga0500616_0008837_3239_4027 | 248 |
| 151 | 3300053156 | Ga0500622_0003593 | Ga0500622_0003593_1621_2409 | 248 |
| 152 | 3300053730 | Ga0500645_000789 | Ga0500645_000789_2324_3112 | 248 |
| 153 | 3300042132 | Ga0450895_004569 | Ga0450895_004569_334_1083 | 249 |
| 154 | 3300049569 | Ga0501032_0294285 | Ga0501032_0294285_237_1034 | 249 |
| 155 | 3300049570 | Ga0501033_0022359 | Ga0501033_0022359_3586_4383 | 249 |
| 156 | 3300049571 | Ga0501034_0147189 | Ga0501034_0147189_1109_1906 | 249 |
| 157 | 3300049575 | Ga0501039_0032244 | Ga0501039_0032244_3062_3859 | 249 |
| 158 | 3300049581 | Ga0501047_0002464 | Ga0501047_0002464_10482_11279 | 249 |
| 159 | 3300049822 | Ga0501035_0008851 | Ga0501035_0008851_2184_2981 | 249 |
| 160 | 3300049823 | Ga0501044_0040830 | Ga0501044_0040830_709_1506 | 249 |
| 161 | 3300005546 | Ga0070696_100003110 | Ga0070696_1000031108 | 251 |
| 162 | 3300047443 | Ga0495687_007340 | Ga0495687_007340_3183_3986 | 251 |
| 163 | 3300053134 | Ga0500658_0003162 | Ga0500658_0003162_2660_3463 | 251 |
| 164 | 3300005331 | Ga0070670_100039813 | Ga0070670_1000398133 | 252 |
| 165 | 3300005618 | Ga0068864_100055639 | Ga0068864_1000556393 | 252 |
| 166 | 3300006358 | Ga0068871_100043036 | Ga0068871_1000430362 | 252 |
| 167 | 3300009177 | Ga0105248_10044692 | Ga0105248_100446922 | 252 |
| 168 | 3300025941 | Ga0207711_10029923 | Ga0207711_100299232 | 252 |
| 169 | 3300026095 | Ga0207676_10110071 | Ga0207676_101100712 | 252 |
| 170 | 3300031911 | Ga0307412_10272645 | Ga0307412_102726452 | 252 |
| 171 | 3300042007 | Ga0439449_0006606 | Ga0439449_0006606_1120_1923 | 252 |
| 172 | 3300046457 | Ga0495590_0077918 | Ga0495590_0077918_343_1149 | 254 |
| 173 | 3300005367 | Ga0070667_100717555 | Ga0070667_1007175551 | 255 |
| 174 | 3300009176 | Ga0105242_10342584 | Ga0105242_103425842 | 255 |
| 175 | 3300025927 | Ga0207687_10595296 | Ga0207687_105952962 | 255 |
| 176 | 3300026095 | Ga0207676_10285128 | Ga0207676_102851282 | 255 |
| 177 | 3300047472 | Ga0495686_0013777 | Ga0495686_0013777_2489_3286 | 255 |
| 178 | 3300049574 | Ga0501038_0031829 | Ga0501038_0031829_787_1572 | 255 |
| 179 | 3300005436 | Ga0070713_100080286 | Ga0070713_1000802862 | 256 |
| 180 | 3300014969 | Ga0157376_10064677 | Ga0157376_100646773 | 256 |
| 181 | 3300006881 | Ga0068865_100213184 | Ga0068865_1002131843 | 257 |
| 182 | 3300030522 | Ga0307512_10012320 | Ga0307512_100123204 | 258 |
| 183 | 3300031507 | Ga0307509_10002117 | Ga0307509_1000211727 | 258 |
| 184 | 3300032004 | Ga0307414_10081091 | Ga0307414_100810912 | 258 |
| 185 | 3300035695 | Ga0373927_0031321 | Ga0373927_0031321_539_1315 | 258 |
| 186 | 3300037068 | Ga0373925_0003598 | Ga0373925_0003598_4918_5694 | 258 |
| 187 | 3300046461 | Ga0495641_0154252 | Ga0495641_0154252_229_1005 | 258 |
| 188 | 3300046507 | Ga0495606_0042220 | Ga0495606_0042220_2151_2954 | 258 |
| 189 | 3300053086 | Ga0500578_0011753 | Ga0500578_0011753_3187_3990 | 258 |
| 190 | 3300053730 | Ga0500645_001374 | Ga0500645_001374_2235_3038 | 258 |
| 191 | 3300005471 | Ga0070698_100150529 | Ga0070698_1001505292 | 259 |
| 192 | 3300013297 | Ga0157378_10832349 | Ga0157378_108323491 | 259 |
| 193 | 3300028794 | Ga0307515_10017024 | Ga0307515_1001702410 | 259 |
| 194 | 3300031507 | Ga0307509_10024236 | Ga0307509_100242363 | 259 |
| 195 | 3300031507 | Ga0307509_10267057 | Ga0307509_102670571 | 259 |
| 196 | 3300031616 | Ga0307508_10244006 | Ga0307508_102440062 | 259 |
| 197 | 3300033179 | Ga0307507_10136927 | Ga0307507_101369272 | 259 |
| 198 | 3300033180 | Ga0307510_10254894 | Ga0307510_102548941 | 259 |
| 199 | 3300036401 | Ga0373937_0104007 | Ga0373937_0104007_699_1535 | 259 |
| 200 | 3300037068 | Ga0373925_0294504 | Ga0373925_0294504_58_894 | 259 |
| 201 | 3300050496 | nmdc:mga07m45_79236_c1 | nmdc:mga07m45_79236_c1_895_1692 | 259 |
| 202 | iso_pu_bacteria | 2643221603 | 2644028815 | 259 |
| 203 | 3300042876 | Ga0451577_0083821 | Ga0451577_0083821_932_1714 | 260 |
| 204 | 3300042876 | Ga0451577_0397719 | Ga0451577_0397719_231_1013 | 260 |
| 205 | 3300045051 | Ga0451576_0259420 | Ga0451576_0259420_175_957 | 260 |
| 206 | 3300047470 | Ga0495681_0134308 | Ga0495681_0134308_172_954 | 260 |
| 207 | iso_pu_bacteria | 2928115317 | 2928116268 | 260 |
| 208 | 3300025292 | Ga0209676_1009602 | Ga0209676_10096023 | 261 |
| 209 | 3300025298 | Ga0209050_1005397 | Ga0209050_10053972 | 261 |
| 210 | 3300025961 | Ga0207712_10322642 | Ga0207712_103226422 | 261 |
| 211 | 3300046539 | Ga0495621_0129707 | Ga0495621_0129707_175_960 | 261 |
| 212 | 3300049822 | Ga0501035_0019386 | Ga0501035_0019386_3516_4319 | 261 |
| 213 | 3300049823 | Ga0501044_0059324 | Ga0501044_0059324_1662_2465 | 261 |
| 214 | iso_pu_bacteria | 2599185292 | 2599906434 | 261 |
| 215 | iso_pu_bacteria | 2643221594 | 2643980295 | 261 |
| 216 | iso_pu_bacteria | 2643221609 | 2644061596 | 261 |
| 217 | iso_pu_bacteria | 2643221611 | 2644075128 | 261 |
| 218 | iso_pu_bacteria | 2643221621 | 2644121925 | 261 |
| 219 | iso_pu_bacteria | 2643221660 | 2644341317 | 261 |
| 220 | iso_pu_bacteria | 2808606395 | 2809032392 | 261 |
| 221 | iso_pu_bacteria | 2816332133 | 2816473870 | 261 |
| 222 | iso_pu_bacteria | 2857537821 | 2857542470 | 261 |
| 223 | iso_pu_bacteria | 2885192300 | 2885195308 | 261 |
| 224 | iso_pu_bacteria | 2941479691 | 2941485192 | 261 |
| 225 | 3300005328 | Ga0070676_10009109 | Ga0070676_100091094 | 262 |
| 226 | 3300005331 | Ga0070670_100574006 | Ga0070670_1005740062 | 262 |
| 227 | 3300005333 | Ga0070677_10009873 | Ga0070677_100098731 | 262 |
| 228 | 3300005347 | Ga0070668_100004039 | Ga0070668_10000403911 | 262 |
| 229 | 3300005353 | Ga0070669_100045564 | Ga0070669_1000455643 | 262 |
| 230 | 3300005354 | Ga0070675_100000968 | Ga0070675_10000096819 | 262 |
| 231 | 3300005356 | Ga0070674_100015723 | Ga0070674_1000157233 | 262 |
| 232 | 3300005364 | Ga0070673_100283936 | Ga0070673_1002839362 | 262 |
| 233 | 3300005366 | Ga0070659_100075953 | Ga0070659_1000759533 | 262 |
| 234 | 3300005367 | Ga0070667_100369256 | Ga0070667_1003692562 | 262 |
| 235 | 3300005457 | Ga0070662_100048626 | Ga0070662_1000486263 | 262 |
| 236 | 3300005466 | Ga0070685_10330626 | Ga0070685_103306261 | 262 |
| 237 | 3300005543 | Ga0070672_100036184 | Ga0070672_1000361842 | 262 |
| 238 | 3300005577 | Ga0068857_100383297 | Ga0068857_1003832972 | 262 |
| 239 | 3300005577 | Ga0068857_100406967 | Ga0068857_1004069672 | 262 |
| 240 | 3300005614 | Ga0068856_100181045 | Ga0068856_1001810452 | 262 |
| 241 | 3300005617 | Ga0068859_100018309 | Ga0068859_1000183098 | 262 |
| 242 | 3300005618 | Ga0068864_100315586 | Ga0068864_1003155862 | 262 |
| 243 | 3300005719 | Ga0068861_100008169 | Ga0068861_1000081693 | 262 |
| 244 | 3300005834 | Ga0068851_10058040 | Ga0068851_100580402 | 262 |
| 245 | 3300005841 | Ga0068863_100007247 | Ga0068863_1000072479 | 262 |
| 246 | 3300005842 | Ga0068858_100001501 | Ga0068858_1000015018 | 262 |
| 247 | 3300005843 | Ga0068860_100000887 | Ga0068860_10000088710 | 262 |
| 248 | 3300005844 | Ga0068862_100003804 | Ga0068862_10000380414 | 262 |
| 249 | 3300006844 | Ga0075428_100020551 | Ga0075428_1000205515 | 262 |
| 250 | 3300006844 | Ga0075428_100034174 | Ga0075428_1000341742 | 262 |
| 251 | 3300006844 | Ga0075428_100035932 | Ga0075428_1000359325 | 262 |
| 252 | 3300006847 | Ga0075431_100023575 | Ga0075431_1000235752 | 262 |
| 253 | 3300006847 | Ga0075431_100026802 | Ga0075431_1000268026 | 262 |
| 254 | 3300006852 | Ga0075433_10008299 | Ga0075433_100082995 | 262 |
| 255 | 3300006880 | Ga0075429_100021214 | Ga0075429_1000212143 | 262 |
| 256 | 3300006931 | Ga0097620_100018309 | Ga0097620_1000183098 | 262 |
| 257 | 3300009094 | Ga0111539_10017029 | Ga0111539_100170298 | 262 |
| 258 | 3300009101 | Ga0105247_10104332 | Ga0105247_101043323 | 262 |
| 259 | 3300009147 | Ga0114129_10044298 | Ga0114129_100442984 | 262 |
| 260 | 3300009177 | Ga0105248_10088842 | Ga0105248_100888422 | 262 |
| 261 | 3300009545 | Ga0105237_10077421 | Ga0105237_100774212 | 262 |
| 262 | 3300009545 | Ga0105237_10211855 | Ga0105237_102118552 | 262 |
| 263 | 3300009551 | Ga0105238_10056685 | Ga0105238_100566853 | 262 |
| 264 | 3300009551 | Ga0105238_10241694 | Ga0105238_102416942 | 262 |
| 265 | 3300009553 | Ga0105249_10561140 | Ga0105249_105611402 | 262 |
| 266 | 3300011119 | Ga0105246_10046791 | Ga0105246_100467912 | 262 |
| 267 | 3300013306 | Ga0163162_10156902 | Ga0163162_101569022 | 262 |
| 268 | 3300014326 | Ga0157380_10064520 | Ga0157380_100645202 | 262 |
| 269 | 3300014326 | Ga0157380_10101086 | Ga0157380_101010863 | 262 |
| 270 | 3300014326 | Ga0157380_10617269 | Ga0157380_106172692 | 262 |
| 271 | 3300021384 | Ga0213876_10102858 | Ga0213876_101028581 | 262 |
| 272 | 3300025904 | Ga0207647_10141996 | Ga0207647_101419962 | 262 |
| 273 | 3300025907 | Ga0207645_10003256 | Ga0207645_100032568 | 262 |
| 274 | 3300025913 | Ga0207695_10026298 | Ga0207695_100262982 | 262 |
| 275 | 3300025919 | Ga0207657_10208705 | Ga0207657_102087052 | 262 |
| 276 | 3300025933 | Ga0207706_10001508 | Ga0207706_100015085 | 262 |
| 277 | 3300025937 | Ga0207669_10023991 | Ga0207669_100239913 | 262 |
| 278 | 3300025938 | Ga0207704_10451306 | Ga0207704_104513061 | 262 |
| 279 | 3300025940 | Ga0207691_10000846 | Ga0207691_1000084628 | 262 |
| 280 | 3300025986 | Ga0207658_10334252 | Ga0207658_103342522 | 262 |
| 281 | 3300026035 | Ga0207703_10000318 | Ga0207703_1000031814 | 262 |
| 282 | 3300026078 | Ga0207702_10059528 | Ga0207702_100595283 | 262 |
| 283 | 3300026088 | Ga0207641_10000721 | Ga0207641_100007212 | 262 |
| 284 | 3300026089 | Ga0207648_10003102 | Ga0207648_1000310215 | 262 |
| 285 | 3300026118 | Ga0207675_100000205 | Ga0207675_10000020533 | 262 |
| 286 | 3300027665 | Ga0209983_1000057 | Ga0209983_100005718 | 262 |
| 287 | 3300027717 | Ga0209998_10000641 | Ga0209998_100006418 | 262 |
| 288 | 3300027876 | Ga0209974_10010235 | Ga0209974_100102354 | 262 |
| 289 | 3300027907 | Ga0207428_10061282 | Ga0207428_100612823 | 262 |
| 290 | 3300027907 | Ga0207428_10163081 | Ga0207428_101630812 | 262 |
| 291 | 3300028380 | Ga0268265_10034022 | Ga0268265_100340224 | 262 |
| 292 | 3300028381 | Ga0268264_10000373 | Ga0268264_1000037315 | 262 |
| 293 | 3300031456 | Ga0307513_10037344 | Ga0307513_100373443 | 262 |
| 294 | 3300031548 | Ga0307408_100124380 | Ga0307408_1001243802 | 262 |
| 295 | 3300031731 | Ga0307405_10142693 | Ga0307405_101426933 | 262 |
| 296 | 3300031824 | Ga0307413_10175090 | Ga0307413_101750903 | 262 |
| 297 | 3300031852 | Ga0307410_10142019 | Ga0307410_101420192 | 262 |
| 298 | 3300031903 | Ga0307407_10162104 | Ga0307407_101621042 | 262 |
| 299 | 3300031911 | Ga0307412_10013973 | Ga0307412_100139733 | 262 |
| 300 | 3300031995 | Ga0307409_100095983 | Ga0307409_1000959833 | 262 |
| 301 | 3300032002 | Ga0307416_100001303 | Ga0307416_10000130311 | 262 |
| 302 | 3300032002 | Ga0307416_100633299 | Ga0307416_1006332992 | 262 |
| 303 | 3300032005 | Ga0307411_10093622 | Ga0307411_100936222 | 262 |
| 304 | 3300032126 | Ga0307415_100005445 | Ga0307415_1000054453 | 262 |
| 305 | 3300037312 | Ga0395899_0087461 | Ga0395899_0087461_1404_2192 | 262 |
| 306 | 3300037418 | Ga0395900_0044064 | Ga0395900_0044064_984_1772 | 262 |
| 307 | 3300037466 | Ga0395898_0041312 | Ga0395898_0041312_1815_2603 | 262 |
| 308 | 3300037853 | Ga0436364_0804269 | Ga0436364_0804269_1043_1837 | 262 |
| 309 | 3300039437 | Ga0436365_0116034 | Ga0436365_0116034_2023_2817 | 262 |
| 310 | 3300039450 | Ga0436363_0090351 | Ga0436363_0090351_2941_3735 | 262 |
| 311 | 3300042125 | Ga0450923_004013 | Ga0450923_004013_46_834 | 262 |
| 312 | 3300042133 | Ga0450896_002017 | Ga0450896_002017_834_1622 | 262 |
| 313 | 3300042156 | Ga0439446_0021365 | Ga0439446_0021365_807_1595 | 262 |
| 314 | 3300042435 | Ga0439434_0095636 | Ga0439434_0095636_99_887 | 262 |
| 315 | 3300042437 | Ga0439444_0004016 | Ga0439444_0004016_686_1474 | 262 |
| 316 | 3300042461 | Ga0439460_0041366 | Ga0439460_0041366_540_1328 | 262 |
| 317 | 3300047320 | Ga0495672_0033634 | Ga0495672_0033634_402_1190 | 262 |
| 318 | 3300048911 | Ga0496108_0489606 | Ga0496108_0489606_134_922 | 262 |
| 319 | 3300048928 | Ga0496125_0000854 | Ga0496125_0000854_17053_17841 | 262 |
| 320 | 3300048929 | Ga0496126_0031548 | Ga0496126_0031548_579_1367 | 262 |
| 321 | 3300049580 | Ga0501046_0172036 | Ga0501046_0172036_69_857 | 262 |
| 322 | 3300049584 | Ga0501068_0005693 | Ga0501068_0005693_3452_4240 | 262 |
| 323 | 3300049587 | Ga0501071_0026671 | Ga0501071_0026671_1766_2554 | 262 |
| 324 | 3300049592 | Ga0501076_0102992 | Ga0501076_0102992_1295_2083 | 262 |
| 325 | 3300050507 | nmdc:mga05p37_835647_c1 | nmdc:mga05p37_835647_c1_16_804 | 262 |
| 326 | 3300050508 | nmdc:mga09592_43177_c1 | nmdc:mga09592_43177_c1_282_1070 | 262 |
| 327 | 3300050510 | nmdc:mga06r32_102907_c1 | nmdc:mga06r32_102907_c1_620_1408 | 262 |
| 328 | 3300050510 | nmdc:mga06r32_32080_c1 | nmdc:mga06r32_32080_c1_3605_4393 | 262 |
| 329 | 3300050511 | nmdc:mga08y16_222889_c1 | nmdc:mga08y16_222889_c1_203_991 | 262 |
| 330 | 3300050511 | nmdc:mga08y16_85784_c1 | nmdc:mga08y16_85784_c1_2014_2802 | 262 |
| 331 | 3300050512 | nmdc:mga0n895_2463_c1 | nmdc:mga0n895_2463_c1_89_877 | 262 |
| 332 | 3300050515 | nmdc:mga0a205_2569_c1 | nmdc:mga0a205_2569_c1_2810_3598 | 262 |
| 333 | 3300053153 | Ga0500616_0005445 | Ga0500616_0005445_5724_6521 | 262 |
| 334 | iso_pu_bacteria | 2643221654 | 2644304470 | 262 |
| 335 | iso_pu_bacteria | 2858950400 | 2858952817 | 262 |
| 336 | 3300005338 | Ga0068868_100185742 | Ga0068868_1001857422 | 263 |
| 337 | 3300005367 | Ga0070667_100058139 | Ga0070667_1000581392 | 263 |
| 338 | 3300005535 | Ga0070684_100430777 | Ga0070684_1004307772 | 263 |
| 339 | 3300005548 | Ga0070665_100389898 | Ga0070665_1003898982 | 263 |
| 340 | 3300005841 | Ga0068863_100031218 | Ga0068863_1000312182 | 263 |
| 341 | 3300005842 | Ga0068858_100145986 | Ga0068858_1001459862 | 263 |
| 342 | 3300006237 | Ga0097621_100379163 | Ga0097621_1003791632 | 263 |
| 343 | 3300006358 | Ga0068871_100365582 | Ga0068871_1003655822 | 263 |
| 344 | 3300006358 | Ga0068871_100520716 | Ga0068871_1005207162 | 263 |
| 345 | 3300006881 | Ga0068865_100107372 | Ga0068865_1001073722 | 263 |
| 346 | 3300006946 | Ga0079104_1007715 | Ga0079104_10077154 | 263 |
| 347 | 3300009177 | Ga0105248_10053979 | Ga0105248_100539793 | 263 |
| 348 | 3300013296 | Ga0157374_10790492 | Ga0157374_107904921 | 263 |
| 349 | 3300013308 | Ga0157375_10291216 | Ga0157375_102912161 | 263 |
| 350 | 3300014325 | Ga0163163_10246843 | Ga0163163_102468432 | 263 |
| 351 | 3300014326 | Ga0157380_10899910 | Ga0157380_108999101 | 263 |
| 352 | 3300014968 | Ga0157379_10765113 | Ga0157379_107651131 | 263 |
| 353 | 3300014969 | Ga0157376_10018173 | Ga0157376_100181734 | 263 |
| 354 | 3300025941 | Ga0207711_10042409 | Ga0207711_100424093 | 263 |
| 355 | 3300025981 | Ga0207640_10409670 | Ga0207640_104096701 | 263 |
| 356 | 3300025986 | Ga0207658_10087441 | Ga0207658_100874412 | 263 |
| 357 | 3300026041 | Ga0207639_10123454 | Ga0207639_101234542 | 263 |
| 358 | 3300026088 | Ga0207641_10008611 | Ga0207641_100086115 | 263 |
| 359 | 3300026118 | Ga0207675_100308285 | Ga0207675_1003082851 | 263 |
| 360 | 3300026121 | Ga0207683_10296538 | Ga0207683_102965382 | 263 |
| 361 | 3300026142 | Ga0207698_10553696 | Ga0207698_105536962 | 263 |
| 362 | 3300027111 | Ga0209281_1004875 | Ga0209281_10048752 | 263 |
| 363 | 3300027312 | Ga0209371_1006575 | Ga0209371_10065754 | 263 |
| 364 | 3300028380 | Ga0268265_10371914 | Ga0268265_103719141 | 263 |
| 365 | 3300028794 | Ga0307515_10000358 | Ga0307515_1000035819 | 263 |
| 366 | 3300030500 | Ga0268256_1006625 | Ga0268256_10066254 | 263 |
| 367 | 3300032002 | Ga0307416_100035126 | Ga0307416_1000351263 | 263 |
| 368 | 3300032126 | Ga0307415_100338432 | Ga0307415_1003384322 | 263 |
| 369 | 3300042876 | Ga0451577_0003401 | Ga0451577_0003401_3474_4274 | 263 |
| 370 | 3300046539 | Ga0495621_0017012 | Ga0495621_0017012_874_1665 | 263 |
| 371 | 3300048905 | Ga0496102_0445177 | Ga0496102_0445177_265_1056 | 263 |
| 372 | 3300048906 | Ga0496103_0161945 | Ga0496103_0161945_110_901 | 263 |
| 373 | 3300048913 | Ga0496110_0026602 | Ga0496110_0026602_1705_2496 | 263 |
| 374 | 3300050514 | nmdc:mga08x19_176731_c1 | nmdc:mga08x19_176731_c1_374_1165 | 263 |
| 375 | iso_pu_bacteria | 2643221569 | 2643862699 | 263 |
| 376 | 3300003763 | Ga0055529_1000970 | Ga0055529_10009705 | 264 |
| 377 | 3300005328 | Ga0070676_10060916 | Ga0070676_100609162 | 264 |
| 378 | 3300005331 | Ga0070670_100030342 | Ga0070670_1000303423 | 264 |
| 379 | 3300005335 | Ga0070666_10060734 | Ga0070666_100607342 | 264 |
| 380 | 3300005347 | Ga0070668_100010211 | Ga0070668_1000102115 | 264 |
| 381 | 3300005353 | Ga0070669_100073387 | Ga0070669_1000733872 | 264 |
| 382 | 3300005356 | Ga0070674_100011101 | Ga0070674_1000111012 | 264 |
| 383 | 3300005367 | Ga0070667_100033806 | Ga0070667_1000338062 | 264 |
| 384 | 3300005455 | Ga0070663_100031220 | Ga0070663_1000312203 | 264 |
| 385 | 3300005543 | Ga0070672_100010466 | Ga0070672_1000104665 | 264 |
| 386 | 3300005548 | Ga0070665_100025455 | Ga0070665_1000254555 | 264 |
| 387 | 3300005834 | Ga0068851_10001307 | Ga0068851_100013077 | 264 |
| 388 | 3300005841 | Ga0068863_100014591 | Ga0068863_1000145913 | 264 |
| 389 | 3300006237 | Ga0097621_100013309 | Ga0097621_1000133096 | 264 |
| 390 | 3300006881 | Ga0068865_100043261 | Ga0068865_1000432612 | 264 |
| 391 | 3300013306 | Ga0163162_10348497 | Ga0163162_103484972 | 264 |
| 392 | 3300025272 | Ga0209455_1000566 | Ga0209455_100056615 | 264 |
| 393 | 3300025321 | Ga0207656_10004179 | Ga0207656_100041792 | 264 |
| 394 | 3300025893 | Ga0207682_10000207 | Ga0207682_1000020715 | 264 |
| 395 | 3300025907 | Ga0207645_10001642 | Ga0207645_1000164210 | 264 |
| 396 | 3300025925 | Ga0207650_10045594 | Ga0207650_100455942 | 264 |
| 397 | 3300025926 | Ga0207659_10009509 | Ga0207659_100095092 | 264 |
| 398 | 3300025937 | Ga0207669_10039938 | Ga0207669_100399382 | 264 |
| 399 | 3300025940 | Ga0207691_10000127 | Ga0207691_100001279 | 264 |
| 400 | 3300025941 | Ga0207711_10067651 | Ga0207711_100676513 | 264 |
| 401 | 3300025960 | Ga0207651_10043856 | Ga0207651_100438563 | 264 |
| 402 | 3300025986 | Ga0207658_10034200 | Ga0207658_100342003 | 264 |
| 403 | 3300026035 | Ga0207703_10015668 | Ga0207703_100156682 | 264 |
| 404 | 3300026075 | Ga0207708_10139170 | Ga0207708_101391702 | 264 |
| 405 | 3300026089 | Ga0207648_10088738 | Ga0207648_100887382 | 264 |
| 406 | 3300026095 | Ga0207676_10111808 | Ga0207676_101118082 | 264 |
| 407 | 3300026121 | Ga0207683_10003804 | Ga0207683_100038045 | 264 |
| 408 | 3300028379 | Ga0268266_10014568 | Ga0268266_100145687 | 264 |
| 409 | 3300028381 | Ga0268264_10099782 | Ga0268264_100997822 | 264 |
| 410 | 3300031911 | Ga0307412_10001167 | Ga0307412_1000116714 | 264 |
| 411 | 3300037471 | Ga0395905_0011306 | Ga0395905_0011306_5851_6654 | 264 |
| 412 | 3300048919 | Ga0496116_0008170 | Ga0496116_0008170_6547_7398 | 264 |
| 413 | 3300048919 | Ga0496116_0030720 | Ga0496116_0030720_2808_3632 | 264 |
| 414 | 3300048920 | Ga0496117_0022859 | Ga0496117_0022859_4040_4864 | 264 |
| 415 | 3300048921 | Ga0496118_0005781 | Ga0496118_0005781_6045_6902 | 264 |
| 416 | 3300048921 | Ga0496118_0032451 | Ga0496118_0032451_3255_4079 | 264 |
| 417 | 3300048922 | Ga0496119_0018081 | Ga0496119_0018081_255_1079 | 264 |
| 418 | 3300048923 | Ga0496120_0063561 | Ga0496120_0063561_773_1597 | 264 |
| 419 | 3300048924 | Ga0496121_0000314 | Ga0496121_0000314_46415_47239 | 264 |
| 420 | 3300048924 | Ga0496121_0025188 | Ga0496121_0025188_1212_2087 | 264 |
| 421 | 3300048925 | Ga0496122_0000046 | Ga0496122_0000046_81492_82367 | 264 |
| 422 | 3300048925 | Ga0496122_0038261 | Ga0496122_0038261_118_942 | 264 |
| 423 | 3300048926 | Ga0496123_0000082 | Ga0496123_0000082_43388_44263 | 264 |
| 424 | 3300048927 | Ga0496124_0254698 | Ga0496124_0254698_217_1041 | 264 |
| 425 | 3300048928 | Ga0496125_0000028 | Ga0496125_0000028_122104_122928 | 264 |
| 426 | 3300048928 | Ga0496125_0009558 | Ga0496125_0009558_247_1158 | 264 |
| 427 | 3300048929 | Ga0496126_0021467 | Ga0496126_0021467_2532_3356 | 264 |
| 428 | 3300048929 | Ga0496126_0035484 | Ga0496126_0035484_2737_3624 | 264 |
| 429 | 3300049823 | Ga0501044_0000022 | Ga0501044_0000022_13613_14413 | 264 |
| 430 | 3300005328 | Ga0070676_10004590 | Ga0070676_100045903 | 265 |
| 431 | 3300005330 | Ga0070690_100216120 | Ga0070690_1002161202 | 265 |
| 432 | 3300005334 | Ga0068869_100058292 | Ga0068869_1000582922 | 265 |
| 433 | 3300005338 | Ga0068868_100023248 | Ga0068868_1000232483 | 265 |
| 434 | 3300005344 | Ga0070661_100301707 | Ga0070661_1003017071 | 265 |
| 435 | 3300005347 | Ga0070668_100269107 | Ga0070668_1002691072 | 265 |
| 436 | 3300005355 | Ga0070671_100077017 | Ga0070671_1000770172 | 265 |
| 437 | 3300005364 | Ga0070673_100004627 | Ga0070673_1000046275 | 265 |
| 438 | 3300005367 | Ga0070667_100086665 | Ga0070667_1000866652 | 265 |
| 439 | 3300005459 | Ga0068867_100012813 | Ga0068867_1000128133 | 265 |
| 440 | 3300005543 | Ga0070672_100113678 | Ga0070672_1001136783 | 265 |
| 441 | 3300005577 | Ga0068857_100121642 | Ga0068857_1001216422 | 265 |
| 442 | 3300005618 | Ga0068864_100122304 | Ga0068864_1001223043 | 265 |
| 443 | 3300005841 | Ga0068863_100022212 | Ga0068863_1000222124 | 265 |
| 444 | 3300006353 | Ga0075370_10093959 | Ga0075370_100939592 | 265 |
| 445 | 3300009148 | Ga0105243_10051938 | Ga0105243_100519383 | 265 |
| 446 | 3300009177 | Ga0105248_10134212 | Ga0105248_101342123 | 265 |
| 447 | 3300013296 | Ga0157374_10388059 | Ga0157374_103880592 | 265 |
| 448 | 3300013306 | Ga0163162_10172071 | Ga0163162_101720713 | 265 |
| 449 | 3300013308 | Ga0157375_10045415 | Ga0157375_100454154 | 265 |
| 450 | 3300013308 | Ga0157375_10077149 | Ga0157375_100771492 | 265 |
| 451 | 3300014325 | Ga0163163_10913788 | Ga0163163_109137882 | 265 |
| 452 | 3300014968 | Ga0157379_10176324 | Ga0157379_101763243 | 265 |
| 453 | 3300025315 | Ga0207697_10076530 | Ga0207697_100765302 | 265 |
| 454 | 3300025907 | Ga0207645_10012366 | Ga0207645_100123665 | 265 |
| 455 | 3300025923 | Ga0207681_10121812 | Ga0207681_101218122 | 265 |
| 456 | 3300025926 | Ga0207659_10017151 | Ga0207659_100171512 | 265 |
| 457 | 3300025927 | Ga0207687_10631643 | Ga0207687_106316431 | 265 |
| 458 | 3300025932 | Ga0207690_10184558 | Ga0207690_101845582 | 265 |
| 459 | 3300025934 | Ga0207686_10161849 | Ga0207686_101618492 | 265 |
| 460 | 3300025935 | Ga0207709_10073150 | Ga0207709_100731502 | 265 |
| 461 | 3300025940 | Ga0207691_10013729 | Ga0207691_100137295 | 265 |
| 462 | 3300025940 | Ga0207691_10056758 | Ga0207691_100567583 | 265 |
| 463 | 3300025942 | Ga0207689_10048147 | Ga0207689_100481473 | 265 |
| 464 | 3300025960 | Ga0207651_10010844 | Ga0207651_100108445 | 265 |
| 465 | 3300025960 | Ga0207651_10033176 | Ga0207651_100331763 | 265 |
| 466 | 3300025981 | Ga0207640_10470205 | Ga0207640_104702051 | 265 |
| 467 | 3300025986 | Ga0207658_10269876 | Ga0207658_102698761 | 265 |
| 468 | 3300026023 | Ga0207677_10037715 | Ga0207677_100377153 | 265 |
| 469 | 3300026088 | Ga0207641_10041711 | Ga0207641_100417113 | 265 |
| 470 | 3300026089 | Ga0207648_10017634 | Ga0207648_100176348 | 265 |
| 471 | 3300026095 | Ga0207676_10098527 | Ga0207676_100985273 | 265 |
| 472 | 3300026116 | Ga0207674_10037482 | Ga0207674_100374824 | 265 |
| 473 | 3300028786 | Ga0307517_10000052 | Ga0307517_1000005289 | 265 |
| 474 | 3300028794 | Ga0307515_10003504 | Ga0307515_1000350418 | 265 |
| 475 | 3300028794 | Ga0307515_10028554 | Ga0307515_100285546 | 265 |
| 476 | 3300028794 | Ga0307515_10104667 | Ga0307515_101046672 | 265 |
| 477 | 3300031507 | Ga0307509_10013408 | Ga0307509_100134089 | 265 |
| 478 | 3300031507 | Ga0307509_10029302 | Ga0307509_100293024 | 265 |
| 479 | 3300031507 | Ga0307509_10216644 | Ga0307509_102166441 | 265 |
| 480 | 3300031616 | Ga0307508_10000053 | Ga0307508_1000005323 | 265 |
| 481 | 3300031649 | Ga0307514_10009268 | Ga0307514_1000926811 | 265 |
| 482 | 3300031649 | Ga0307514_10260914 | Ga0307514_102609141 | 265 |
| 483 | 3300031730 | Ga0307516_10034119 | Ga0307516_100341192 | 265 |
| 484 | 3300031824 | Ga0307413_10101936 | Ga0307413_101019362 | 265 |
| 485 | 3300031901 | Ga0307406_10066072 | Ga0307406_100660722 | 265 |
| 486 | 3300032002 | Ga0307416_100135747 | Ga0307416_1001357472 | 265 |
| 487 | 3300033179 | Ga0307507_10166568 | Ga0307507_101665683 | 265 |
| 488 | 3300033180 | Ga0307510_10001123 | Ga0307510_1000112323 | 265 |
| 489 | 3300033180 | Ga0307510_10125131 | Ga0307510_101251312 | 265 |
| 490 | 3300035114 | Ga0373939_0000239 | Ga0373939_0000239_2196_2999 | 265 |
| 491 | 3300035121 | Ga0373960_0001500 | Ga0373960_0001500_2039_2842 | 265 |
| 492 | 3300035691 | Ga0373931_0028290 | Ga0373931_0028290_1846_2649 | 265 |
| 493 | 3300041999 | Ga0439433_0014717 | Ga0439433_0014717_416_1219 | 265 |
| 494 | 3300042002 | Ga0439442_005368 | Ga0439442_005368_1200_2003 | 265 |
| 495 | 3300042004 | Ga0439445_0006810 | Ga0439445_0006810_50_853 | 265 |
| 496 | 3300042006 | Ga0439432_002542 | Ga0439432_002542_1260_2063 | 265 |
| 497 | 3300042010 | Ga0439452_008154 | Ga0439452_008154_158_961 | 265 |
| 498 | 3300042015 | Ga0439462_0007813 | Ga0439462_0007813_1722_2525 | 265 |
| 499 | 3300042435 | Ga0439434_0005056 | Ga0439434_0005056_1062_1865 | 265 |
| 500 | 3300045051 | Ga0451576_0212818 | Ga0451576_0212818_1125_1928 | 265 |
| 501 | 3300046454 | Ga0495592_0000370 | Ga0495592_0000370_17433_18236 | 265 |
| 502 | 3300046459 | Ga0495629_0133852 | Ga0495629_0133852_546_1349 | 265 |
| 503 | 3300046471 | Ga0495650_0004943 | Ga0495650_0004943_4638_5441 | 265 |
| 504 | 3300046517 | Ga0495630_0226860 | Ga0495630_0226860_186_989 | 265 |
| 505 | 3300046519 | Ga0495632_0120244 | Ga0495632_0120244_312_1115 | 265 |
| 506 | 3300046690 | Ga0495624_0057406 | Ga0495624_0057406_851_1654 | 265 |
| 507 | 3300047321 | Ga0495676_0037805 | Ga0495676_0037805_2247_3050 | 265 |
| 508 | 3300047673 | Ga0495593_0025281 | Ga0495593_0025281_2345_3148 | 265 |
| 509 | 3300048089 | Ga0495614_0127394 | Ga0495614_0127394_239_1042 | 265 |
| 510 | 3300048917 | Ga0496114_0226734 | Ga0496114_0226734_661_1464 | 265 |
| 511 | 3300053093 | Ga0500651_0067977 | Ga0500651_0067977_1026_1829 | 265 |
| 512 | 3300053098 | Ga0500650_0101848 | Ga0500650_0101848_343_1146 | 265 |
| 513 | 3300053121 | Ga0500607_071221 | Ga0500607_071221_204_1007 | 265 |
| 514 | 3300053131 | Ga0500652_074936 | Ga0500652_074936_304_1149 | 265 |
| 515 | 3300053136 | Ga0500559_0000041 | Ga0500559_0000041_93265_94068 | 265 |
| 516 | 3300053156 | Ga0500622_0003555 | Ga0500622_0003555_6534_7337 | 265 |
| 517 | 3300005328 | Ga0070676_10236586 | Ga0070676_102365862 | 266 |
| 518 | 3300005331 | Ga0070670_100003540 | Ga0070670_1000035407 | 266 |
| 519 | 3300005353 | Ga0070669_100009428 | Ga0070669_1000094283 | 266 |
| 520 | 3300005355 | Ga0070671_100049480 | Ga0070671_1000494803 | 266 |
| 521 | 3300005356 | Ga0070674_100043910 | Ga0070674_1000439103 | 266 |
| 522 | 3300005364 | Ga0070673_100003906 | Ga0070673_1000039063 | 266 |
| 523 | 3300005459 | Ga0068867_100112111 | Ga0068867_1001121112 | 266 |
| 524 | 3300005543 | Ga0070672_100002849 | Ga0070672_1000028495 | 266 |
| 525 | 3300005548 | Ga0070665_100771222 | Ga0070665_1007712221 | 266 |
| 526 | 3300005564 | Ga0070664_100307214 | Ga0070664_1003072142 | 266 |
| 527 | 3300005578 | Ga0068854_100120914 | Ga0068854_1001209142 | 266 |
| 528 | 3300006358 | Ga0068871_100482833 | Ga0068871_1004828331 | 266 |
| 529 | 3300013308 | Ga0157375_10273435 | Ga0157375_102734352 | 266 |
| 530 | 3300014969 | Ga0157376_10048419 | Ga0157376_100484192 | 266 |
| 531 | 3300025907 | Ga0207645_10306430 | Ga0207645_103064302 | 266 |
| 532 | 3300025925 | Ga0207650_10003576 | Ga0207650_100035765 | 266 |
| 533 | 3300025926 | Ga0207659_10002431 | Ga0207659_100024316 | 266 |
| 534 | 3300025937 | Ga0207669_10036389 | Ga0207669_100363892 | 266 |
| 535 | 3300025937 | Ga0207669_10044857 | Ga0207669_100448573 | 266 |
| 536 | 3300025940 | Ga0207691_10003752 | Ga0207691_100037527 | 266 |
| 537 | 3300025945 | Ga0207679_10290667 | Ga0207679_102906672 | 266 |
| 538 | 3300026089 | Ga0207648_10160206 | Ga0207648_101602062 | 266 |
| 539 | 3300026095 | Ga0207676_10585059 | Ga0207676_105850591 | 266 |
| 540 | 3300026121 | Ga0207683_10030377 | Ga0207683_100303773 | 266 |
| 541 | 3300028379 | Ga0268266_10195253 | Ga0268266_101952532 | 266 |
| 542 | 3300031548 | Ga0307408_100333935 | Ga0307408_1003339352 | 266 |
| 543 | 3300031731 | Ga0307405_10008662 | Ga0307405_100086622 | 266 |
| 544 | 3300031824 | Ga0307413_10152944 | Ga0307413_101529442 | 266 |
| 545 | 3300031852 | Ga0307410_10013807 | Ga0307410_100138072 | 266 |
| 546 | 3300031903 | Ga0307407_10034564 | Ga0307407_100345641 | 266 |
| 547 | 3300031995 | Ga0307409_100097537 | Ga0307409_1000975372 | 266 |
| 548 | 3300032002 | Ga0307416_100039700 | Ga0307416_1000397002 | 266 |
| 549 | 3300032004 | Ga0307414_10015531 | Ga0307414_100155314 | 266 |
| 550 | 3300032005 | Ga0307411_10017113 | Ga0307411_100171134 | 266 |
| 551 | 3300003322 | rootL2_10011839 | rootL2_100118394 | 267 |
| 552 | 3300005334 | Ga0068869_100103617 | Ga0068869_1001036173 | 267 |
| 553 | 3300005338 | Ga0068868_100064919 | Ga0068868_1000649192 | 267 |
| 554 | 3300005445 | Ga0070708_100276277 | Ga0070708_1002762772 | 267 |
| 555 | 3300005456 | Ga0070678_100272185 | Ga0070678_1002721852 | 267 |
| 556 | 3300005459 | Ga0068867_100047752 | Ga0068867_1000477522 | 267 |
| 557 | 3300005467 | Ga0070706_100003542 | Ga0070706_1000035429 | 267 |
| 558 | 3300005518 | Ga0070699_100164192 | Ga0070699_1001641921 | 267 |
| 559 | 3300005548 | Ga0070665_100006913 | Ga0070665_1000069134 | 267 |
| 560 | 3300005617 | Ga0068859_100091539 | Ga0068859_1000915392 | 267 |
| 561 | 3300005618 | Ga0068864_100010268 | Ga0068864_1000102683 | 267 |
| 562 | 3300005841 | Ga0068863_100054240 | Ga0068863_1000542403 | 267 |
| 563 | 3300006178 | Ga0075367_10050285 | Ga0075367_100502852 | 267 |
| 564 | 3300006195 | Ga0075366_10016865 | Ga0075366_100168652 | 267 |
| 565 | 3300006353 | Ga0075370_10121926 | Ga0075370_101219262 | 267 |
| 566 | 3300006881 | Ga0068865_100292811 | Ga0068865_1002928112 | 267 |
| 567 | 3300006931 | Ga0097620_100091538 | Ga0097620_1000915382 | 267 |
| 568 | 3300009098 | Ga0105245_10071927 | Ga0105245_100719272 | 267 |
| 569 | 3300009177 | Ga0105248_10531267 | Ga0105248_105312671 | 267 |
| 570 | 3300014968 | Ga0157379_10091558 | Ga0157379_100915583 | 267 |
| 571 | 3300025910 | Ga0207684_10021243 | Ga0207684_100212434 | 267 |
| 572 | 3300025922 | Ga0207646_10073512 | Ga0207646_100735123 | 267 |
| 573 | 3300025931 | Ga0207644_10027999 | Ga0207644_100279992 | 267 |
| 574 | 3300025935 | Ga0207709_10376947 | Ga0207709_103769471 | 267 |
| 575 | 3300025938 | Ga0207704_10487739 | Ga0207704_104877391 | 267 |
| 576 | 3300025942 | Ga0207689_10114295 | Ga0207689_101142952 | 267 |
| 577 | 3300026088 | Ga0207641_10187746 | Ga0207641_101877463 | 267 |
| 578 | 3300026089 | Ga0207648_10059758 | Ga0207648_100597582 | 267 |
| 579 | 3300026121 | Ga0207683_10238570 | Ga0207683_102385702 | 267 |
| 580 | 3300028379 | Ga0268266_10039553 | Ga0268266_100395534 | 267 |
| 581 | 3300046512 | Ga0495610_0035524 | Ga0495610_0035524_111_980 | 267 |
| 582 | 3300046616 | Ga0495668_0120190 | Ga0495668_0120190_244_1059 | 267 |
| 583 | 3300050494 | nmdc:mga06z11_252922_c1 | nmdc:mga06z11_252922_c1_49_852 | 267 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4fzw-assembly1.cif.gz_D | crystal structure of the paaf-paag hydratase-isomerase complex from e.coli | 0.9757 | 8 | 267 |
| 4fzw-assembly1.cif.gz_C | crystal structure of the paaf-paag hydratase-isomerase complex from e.coli | 0.9753 | 8 | 267 |
| 4fzw-assembly1.cif.gz_D | crystal structure of the paaf-paag hydratase-isomerase complex from e.coli | 0.9681 | 8 | 267 |
| 4fzw-assembly1.cif.gz_C | crystal structure of the paaf-paag hydratase-isomerase complex from e.coli | 0.9676 | 8 | 267 |
| 6sla-assembly2.cif.gz_FFF | crystal structure of isomerase paag mutant - d136n with oxepin-coa | 0.9672 | 8 | 267 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2ej5A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.979 | 6 | 209 | 3.90.226.10 |
| 4fzwD01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9785 | 8 | 207 | 3.90.226.10 |
| af_P77467_205_262_1.10.12.10 | Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain | 0.9676 | 214 | 267 | 1.10.12.10 |
| 3rsiC01 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; | 0.9669 | 7 | 63 | 3.30.300.220 |
| 2ej5A01 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.964 | 6 | 209 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2M8WYE0-F1-model_v4 | 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase | 0.9926 | 5 | 267 |
GO:0016853
|
| AF-A0A257LKI2-F1-model_v4 | 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 4.2.1.17) | 0.9894 | 5 | 267 |
GO:0004300
GO:0016853 |
| AF-A0A382IFT0-F1-model_v4 | Enoyl-CoA hydratase | 0.9843 | 7 | 267 |
GO:0006635
GO:0010124 GO:0016829 |
| AF-A0A2S5GP16-F1-model_v4 | 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase | 0.983 | 6 | 267 |
GO:0016853
|
| AF-A0A6J4SVT8-F1-model_v4 | 1,2-epoxyphenylacetyl-CoA isomerase (EC 5.3.3.18) | 0.9826 | 6 | 267 |
GO:0010124
GO:0016853 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar