F466302

General Info

Members Datasets Scaffolds Average Seq Length
583 301 567 260

Family's Representative Sequence

Representative Sequence 3300046512|Ga0495610_0035524|Ga0495610_0035524_111_980
Length 289
Sequence LVNSNVCFTTAHSRKNNDKEEAVDTSLVTTEIREGYRVLTLNRPDRLNSFSAAMHAELMAALVAAEADTSCRALLLTGAGRGFCAGQDLADPAVAPDLTPGAKPTDVGNVIERFYKPLALRLRAMPIPVIAAVNGVAAGAGASIALGCDMVIAARSASFIQAFSKIGLVPDAGGTWLLPRLVGRANALALAMTGDKLSADDAQRMGLIWKCVDDAAFTDEVSTTAARLAAMPVKALAATRAVIDASAQLSYADALSLEGEWQSRLSASHDYLEGVAAFLAKRPATFSDR

Samples

Sample ID Description Type Environment
1 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
2 2643221569 Achromobacter sp. Root565 Isolate Unclassified
3 2643221594 Achromobacter sp. Root170 Isolate Unclassified
4 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
5 2643221609 Acidovorax sp. Root217 Isolate Unclassified
6 2643221611 Acidovorax sp. Root219 Isolate Unclassified
7 2643221621 Achromobacter sp. Root83 Isolate Unclassified
8 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
9 2643221660 Methylibium sp. Root1272 Isolate Unclassified
10 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
11 2816332133 Acidovorax radicis 2721A Isolate Unclassified
12 2857537821 Achromobacter sp. R-71975 Isolate Unclassified
13 2858950400 Achromobacter sp. K91 Isolate Unclassified
14 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
15 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
16 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
17 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
70 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
78 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
88 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
101 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
102 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
103 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
152 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
157 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
163 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
164 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
165 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
169 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
184 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
198 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
199 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
200 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
201 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
202 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
203 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
204 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
205 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
206 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
207 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
210 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
211 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
212 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
215 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
216 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
217 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
218 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
219 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
220 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
223 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
233 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
236 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
240 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
241 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
245 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
246 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
247 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
248 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
249 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
250 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
251 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
252 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
253 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
270 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
271 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
280 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
281 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
282 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
283 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
284 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
285 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
286 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
289 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
290 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
291 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
292 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
293 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
294 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
295 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
296 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
299 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
300 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
301 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 0
Isolates 2.74

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.49
Nodule 0.34
Rhizoplane 1.37
Rhizosphere 82.16
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10011839 3300003322 Bacteria 2378
2 Ga0055529_1000970 3300003763 Bacteria 14586
3 Ga0070676_10004590 3300005328 Bacteria 7280
4 Ga0070676_10009109 3300005328 Bacteria 5369
5 Ga0070676_10060916 3300005328 Bacteria 2242
6 Ga0070676_10104959 3300005328 Bacteria 1751
7 Ga0070676_10236586 3300005328 Bacteria 1213
8 Ga0070683_100170703 3300005329 Bacteria 2064
9 Ga0070690_100216120 3300005330 Bacteria 1341
10 Ga0070670_100003540 3300005331 Bacteria 12986
11 Ga0070670_100030342 3300005331 Bacteria 4656
12 Ga0070670_100039813 3300005331 Bacteria 4041
13 Ga0070670_100078217 3300005331 Bacteria 2841
14 Ga0070670_100154247 3300005331 Bacteria 1988
15 Ga0070670_100574006 3300005331 Bacteria 1008
16 Ga0070677_10009873 3300005333 Bacteria 3250
17 Ga0070677_10071266 3300005333 Bacteria 1463
18 Ga0068869_100058292 3300005334 Bacteria 2823
19 Ga0068869_100103617 3300005334 Bacteria 2156
20 Ga0068869_100215260 3300005334 Bacteria 1520
21 Ga0070666_10060734 3300005335 Bacteria 2558
22 Ga0068868_100023248 3300005338 Bacteria 4690
23 Ga0068868_100064919 3300005338 Bacteria 2899
24 Ga0068868_100075800 3300005338 Bacteria 2688
25 Ga0068868_100185742 3300005338 Bacteria 1727
26 Ga0070687_100099758 3300005343 Bacteria 1623
27 Ga0070661_100119433 3300005344 Bacteria 1973
28 Ga0070661_100301707 3300005344 Bacteria 1247
29 Ga0070668_100004039 3300005347 Bacteria 10856
30 Ga0070668_100010211 3300005347 Bacteria 6964
31 Ga0070668_100096386 3300005347 Bacteria 2338
32 Ga0070668_100269107 3300005347 Bacteria 1420
33 Ga0070669_100009428 3300005353 Bacteria 6951
34 Ga0070669_100040781 3300005353 Bacteria 3375
35 Ga0070669_100045564 3300005353 Bacteria 3196
36 Ga0070669_100073387 3300005353 Bacteria 2535
37 Ga0070675_100000968 3300005354 Bacteria 20525
38 Ga0070675_100051959 3300005354 Bacteria 3368
39 Ga0070675_100053171 3300005354 Bacteria 3330
40 Ga0070671_100003531 3300005355 Bacteria 12223
41 Ga0070671_100049480 3300005355 Bacteria 3497
42 Ga0070671_100077017 3300005355 Bacteria 2787
43 Ga0070674_100011101 3300005356 Bacteria 5470
44 Ga0070674_100015723 3300005356 Bacteria 4731
45 Ga0070674_100043910 3300005356 Bacteria 3043
46 Ga0070674_100052253 3300005356 Bacteria 2818
47 Ga0070674_100052928 3300005356 Bacteria 2801
48 Ga0070673_100003906 3300005364 Bacteria 9368
49 Ga0070673_100004627 3300005364 Bacteria 8724
50 Ga0070673_100163849 3300005364 Bacteria 1892
51 Ga0070673_100283936 3300005364 Bacteria 1453
52 Ga0070659_100075953 3300005366 Bacteria 2679
53 Ga0070659_100212422 3300005366 Bacteria 1595
54 Ga0070667_100033806 3300005367 Bacteria 4277
55 Ga0070667_100050187 3300005367 Bacteria 3516
56 Ga0070667_100052812 3300005367 Bacteria 3430
57 Ga0070667_100058139 3300005367 Bacteria 3269
58 Ga0070667_100086665 3300005367 Bacteria 2687
59 Ga0070667_100195856 3300005367 Bacteria 1791
60 Ga0070667_100369256 3300005367 Bacteria 1301
61 Ga0070667_100717555 3300005367 Bacteria 926
62 Ga0070713_100080286 3300005436 Bacteria 2781
63 Ga0070701_10084876 3300005438 Bacteria 1723
64 Ga0070700_100035579 3300005441 Bacteria 3015
65 Ga0070708_100276277 3300005445 Bacteria 1581
66 Ga0070663_100031220 3300005455 Bacteria 3660
67 Ga0070678_100005397 3300005456 Bacteria 7375
68 Ga0070678_100086435 3300005456 Bacteria 2392
69 Ga0070678_100272185 3300005456 Bacteria 1429
70 Ga0070662_100048626 3300005457 Bacteria 3055
71 Ga0068867_100002610 3300005459 Bacteria 12706
72 Ga0068867_100012813 3300005459 Bacteria 5933
73 Ga0068867_100047752 3300005459 Bacteria 3148
74 Ga0068867_100112111 3300005459 Bacteria 2097
75 Ga0070685_10330626 3300005466 Bacteria 1036
76 Ga0070706_100003542 3300005467 Bacteria 15348
77 Ga0070698_100150529 3300005471 Bacteria 2274
78 Ga0070699_100164192 3300005518 Bacteria 1967
79 Ga0070684_100430777 3300005535 Bacteria 1218
80 Ga0070672_100002849 3300005543 Bacteria 11093
81 Ga0070672_100010466 3300005543 Bacteria 6434
82 Ga0070672_100036184 3300005543 Bacteria 3759
83 Ga0070672_100092454 3300005543 Bacteria 2442
84 Ga0070672_100113678 3300005543 Bacteria 2209
85 Ga0070696_100003110 3300005546 Bacteria 11041
86 Ga0070665_100006913 3300005548 Bacteria 11529
87 Ga0070665_100025455 3300005548 Bacteria 5961
88 Ga0070665_100389898 3300005548 Bacteria 1400
89 Ga0070665_100771222 3300005548 Bacteria 974
90 Ga0070664_100307214 3300005564 Bacteria 1434
91 Ga0068857_100121642 3300005577 Bacteria 2350
92 Ga0068857_100383297 3300005577 Bacteria 1306
93 Ga0068857_100406967 3300005577 Bacteria 1267
94 Ga0068854_100120914 3300005578 Bacteria 1988
95 Ga0068856_100181045 3300005614 Bacteria 2120
96 Ga0068852_100247236 3300005616 Bacteria 1707
97 Ga0068859_100018309 3300005617 Bacteria 7042
98 Ga0068859_100073756 3300005617 Bacteria 3450
99 Ga0068859_100091539 3300005617 Bacteria 3092
100 Ga0068859_100121002 3300005617 Bacteria 2684
101 Ga0068864_100010268 3300005618 Bacteria 7732
102 Ga0068864_100055639 3300005618 Bacteria 3416
103 Ga0068864_100118256 3300005618 Bacteria 2366
104 Ga0068864_100122304 3300005618 Bacteria 2328
105 Ga0068864_100315586 3300005618 Bacteria 1467
106 Ga0068866_10028786 3300005718 Bacteria 2650
107 Ga0068861_100002798 3300005719 Bacteria 11463
108 Ga0068861_100008169 3300005719 Bacteria 7202
109 Ga0068851_10001307 3300005834 Bacteria 10851
110 Ga0068851_10058040 3300005834 Bacteria 1977
111 Ga0068851_10234962 3300005834 Bacteria 1034
112 Ga0068863_100007247 3300005841 Bacteria 10867
113 Ga0068863_100014591 3300005841 Bacteria 7564
114 Ga0068863_100022212 3300005841 Bacteria 6059
115 Ga0068863_100031218 3300005841 Bacteria 5085
116 Ga0068863_100033017 3300005841 Bacteria 4931
117 Ga0068863_100041906 3300005841 Bacteria 4351
118 Ga0068863_100054240 3300005841 Bacteria 3798
119 Ga0068858_100001501 3300005842 Bacteria 24053
120 Ga0068858_100014852 3300005842 Bacteria 7325
121 Ga0068858_100145986 3300005842 Bacteria 2222
122 Ga0068860_100000887 3300005843 Bacteria 33240
123 Ga0068860_100001383 3300005843 Bacteria 26323
124 Ga0068862_100003804 3300005844 Bacteria 12855
125 Ga0068862_100041402 3300005844 Bacteria 3919
126 Ga0075367_10050285 3300006178 Bacteria 2460
127 Ga0075366_10016865 3300006195 Bacteria 4199
128 Ga0097621_100013309 3300006237 Bacteria 6128
129 Ga0097621_100379163 3300006237 Bacteria 1263
130 Ga0075370_10093959 3300006353 Bacteria 1731
131 Ga0075370_10121926 3300006353 Bacteria 1518
132 Ga0068871_100043036 3300006358 Bacteria 3627
133 Ga0068871_100365582 3300006358 Bacteria 1279
134 Ga0068871_100482833 3300006358 Bacteria 1115
135 Ga0068871_100520716 3300006358 Bacteria 1074
136 Ga0075428_100020551 3300006844 Bacteria 7311
137 Ga0075428_100034174 3300006844 Bacteria 5609
138 Ga0075428_100035932 3300006844 Bacteria 5460
139 Ga0075431_100023575 3300006847 Bacteria 6299
140 Ga0075431_100026802 3300006847 Bacteria 5911
141 Ga0075433_10008299 3300006852 Bacteria 8280
142 Ga0075429_100021214 3300006880 Bacteria 5631
143 Ga0068865_100017925 3300006881 Bacteria 4561
144 Ga0068865_100043261 3300006881 Bacteria 3076
145 Ga0068865_100107372 3300006881 Bacteria 2053
146 Ga0068865_100213184 3300006881 Bacteria 1506
147 Ga0068865_100292811 3300006881 Bacteria 1300
148 Ga0097620_100018309 3300006931 Bacteria 7042
149 Ga0097620_100073756 3300006931 Bacteria 3450
150 Ga0097620_100091538 3300006931 Bacteria 3092
151 Ga0097620_100121007 3300006931 Bacteria 2684
152 Ga0079104_1007715 3300006946 Bacteria 3855
153 Ga0111539_10017029 3300009094 Bacteria 8996
154 Ga0105245_10071927 3300009098 Bacteria 3141
155 Ga0105245_10463696 3300009098 Bacteria 1277
156 Ga0105245_10698287 3300009098 Bacteria 1048
157 Ga0105247_10104332 3300009101 Bacteria 1816
158 Ga0114129_10044298 3300009147 Bacteria 6260
159 Ga0105243_10051938 3300009148 Bacteria 3244
160 Ga0105243_10118602 3300009148 Bacteria 2227
161 Ga0105241_10342665 3300009174 Bacteria 1295
162 Ga0105242_10072383 3300009176 Bacteria 2862
163 Ga0105242_10099151 3300009176 Bacteria 2466
164 Ga0105242_10342584 3300009176 Bacteria 1378
165 Ga0105248_10044692 3300009177 Bacteria 4968
166 Ga0105248_10053979 3300009177 Bacteria 4507
167 Ga0105248_10088842 3300009177 Bacteria 3478
168 Ga0105248_10134212 3300009177 Bacteria 2793
169 Ga0105248_10531267 3300009177 Bacteria 1327
170 Ga0105248_10738669 3300009177 Bacteria 1110
171 Ga0105237_10077421 3300009545 Bacteria 3315
172 Ga0105237_10211855 3300009545 Bacteria 1937
173 Ga0105238_10056685 3300009551 Bacteria 3930
174 Ga0105238_10241694 3300009551 Bacteria 1783
175 Ga0105249_10016954 3300009553 Bacteria 6463
176 Ga0105249_10561140 3300009553 Bacteria 1193
177 Ga0105246_10046791 3300011119 Bacteria 2952
178 Ga0157371_10211600 3300013102 Bacteria 1391
179 Ga0157370_10103811 3300013104 Bacteria 2660
180 Ga0157374_10388059 3300013296 Bacteria 1392
181 Ga0157374_10790492 3300013296 Bacteria 964
182 Ga0157378_10002940 3300013297 Bacteria 15150
183 Ga0157378_10174393 3300013297 Bacteria 2019
184 Ga0157378_10832349 3300013297 Bacteria 950
185 Ga0163162_10009038 3300013306 Bacteria 9685
186 Ga0163162_10156902 3300013306 Bacteria 2396
187 Ga0163162_10172071 3300013306 Bacteria 2290
188 Ga0163162_10348497 3300013306 Bacteria 1614
189 Ga0157375_10045415 3300013308 Bacteria 4275
190 Ga0157375_10077149 3300013308 Bacteria 3361
191 Ga0157375_10113828 3300013308 Bacteria 2807
192 Ga0157375_10273435 3300013308 Bacteria 1852
193 Ga0157375_10291216 3300013308 Bacteria 1796
194 Ga0157375_10814436 3300013308 Bacteria 1082
195 Ga0163163_10144317 3300014325 Bacteria 2423
196 Ga0163163_10246843 3300014325 Bacteria 1835
197 Ga0163163_10913788 3300014325 Bacteria 941
198 Ga0157380_10064520 3300014326 Bacteria 2940
199 Ga0157380_10078021 3300014326 Bacteria 2701
200 Ga0157380_10101086 3300014326 Bacteria 2402
201 Ga0157380_10617269 3300014326 Bacteria 1076
202 Ga0157380_10899910 3300014326 Bacteria 911
203 Ga0157379_10091558 3300014968 Bacteria 2728
204 Ga0157379_10176324 3300014968 Bacteria 1930
205 Ga0157379_10765113 3300014968 Bacteria 910
206 Ga0157376_10018173 3300014969 Bacteria 5382
207 Ga0157376_10048419 3300014969 Bacteria 3514
208 Ga0157376_10064677 3300014969 Bacteria 3086
209 Ga0157376_10099751 3300014969 Bacteria 2534
210 Ga0163161_10032563 3300017792 Bacteria 3723
211 Ga0163161_10181671 3300017792 Bacteria 1613
212 Ga0163161_10256007 3300017792 Bacteria 1366
213 Ga0213876_10102858 3300021384 Bacteria 1514
214 Ga0213871_10009898 3300021441 Bacteria 2148
215 Ga0209455_1000566 3300025272 Bacteria 24635
216 Ga0209676_1009602 3300025292 Bacteria 4152
217 Ga0209050_1005397 3300025298 Bacteria 8070
218 Ga0207697_10076530 3300025315 Bacteria 1406
219 Ga0207656_10004179 3300025321 Bacteria 5026
220 Ga0207682_10000207 3300025893 Bacteria 26681
221 Ga0207682_10034026 3300025893 Bacteria 2053
222 Ga0207688_10048803 3300025901 Bacteria 2365
223 Ga0207647_10141996 3300025904 Bacteria 1407
224 Ga0207645_10001642 3300025907 Bacteria 18222
225 Ga0207645_10003256 3300025907 Bacteria 12402
226 Ga0207645_10012366 3300025907 Bacteria 5791
227 Ga0207645_10031204 3300025907 Bacteria 3430
228 Ga0207645_10306430 3300025907 Bacteria 1058
229 Ga0207705_10206106 3300025909 Bacteria 1491
230 Ga0207684_10021243 3300025910 Bacteria 5542
231 Ga0207695_10026298 3300025913 Bacteria 6496
232 Ga0207662_10030867 3300025918 Bacteria 3113
233 Ga0207657_10208705 3300025919 Bacteria 1568
234 Ga0207646_10073512 3300025922 Bacteria 3054
235 Ga0207681_10043502 3300025923 Bacteria 3006
236 Ga0207681_10121812 3300025923 Bacteria 1914
237 Ga0207650_10003576 3300025925 Bacteria 10659
238 Ga0207650_10009488 3300025925 Bacteria 6650
239 Ga0207650_10043702 3300025925 Bacteria 3290
240 Ga0207650_10045594 3300025925 Bacteria 3226
241 Ga0207650_10629527 3300025925 Bacteria 903
242 Ga0207659_10002431 3300025926 Bacteria 11095
243 Ga0207659_10009509 3300025926 Bacteria 6079
244 Ga0207659_10017151 3300025926 Bacteria 4728
245 Ga0207659_10037827 3300025926 Bacteria 3353
246 Ga0207659_10120428 3300025926 Bacteria 2010
247 Ga0207687_10486668 3300025927 Bacteria 1028
248 Ga0207687_10595296 3300025927 Bacteria 931
249 Ga0207687_10631643 3300025927 Bacteria 905
250 Ga0207644_10001589 3300025931 Bacteria 14679
251 Ga0207644_10027999 3300025931 Bacteria 3897
252 Ga0207690_10184558 3300025932 Bacteria 1573
253 Ga0207706_10001508 3300025933 Bacteria 23112
254 Ga0207706_10032850 3300025933 Bacteria 4617
255 Ga0207686_10161849 3300025934 Bacteria 1569
256 Ga0207686_10350385 3300025934 Bacteria 1111
257 Ga0207686_10357182 3300025934 Bacteria 1102
258 Ga0207709_10073150 3300025935 Bacteria 2183
259 Ga0207709_10376947 3300025935 Bacteria 1078
260 Ga0207669_10023991 3300025937 Bacteria 3270
261 Ga0207669_10029166 3300025937 Bacteria 3047
262 Ga0207669_10036389 3300025937 Bacteria 2812
263 Ga0207669_10039938 3300025937 Bacteria 2717
264 Ga0207669_10044857 3300025937 Bacteria 2601
265 Ga0207704_10002656 3300025938 Bacteria 8071
266 Ga0207704_10451306 3300025938 Bacteria 1026
267 Ga0207704_10487739 3300025938 Bacteria 991
268 Ga0207691_10000127 3300025940 Bacteria 69355
269 Ga0207691_10000846 3300025940 Bacteria 30480
270 Ga0207691_10003752 3300025940 Bacteria 14739
271 Ga0207691_10013729 3300025940 Bacteria 7739
272 Ga0207691_10018677 3300025940 Bacteria 6567
273 Ga0207691_10045169 3300025940 Bacteria 4051
274 Ga0207691_10056758 3300025940 Bacteria 3566
275 Ga0207691_10121274 3300025940 Bacteria 2317
276 Ga0207711_10029923 3300025941 Bacteria 4593
277 Ga0207711_10042409 3300025941 Bacteria 3877
278 Ga0207711_10067651 3300025941 Bacteria 3093
279 Ga0207689_10048147 3300025942 Bacteria 3516
280 Ga0207689_10114295 3300025942 Bacteria 2219
281 Ga0207689_10137975 3300025942 Bacteria 2008
282 Ga0207661_10247635 3300025944 Bacteria 1583
283 Ga0207679_10290667 3300025945 Bacteria 1405
284 Ga0207651_10010844 3300025960 Bacteria 5071
285 Ga0207651_10033176 3300025960 Bacteria 3327
286 Ga0207651_10043856 3300025960 Bacteria 2988
287 Ga0207712_10031620 3300025961 Bacteria 3566
288 Ga0207712_10065389 3300025961 Bacteria 2595
289 Ga0207712_10322642 3300025961 Bacteria 1275
290 Ga0207640_10409670 3300025981 Bacteria 1106
291 Ga0207640_10470205 3300025981 Bacteria 1040
292 Ga0207658_10034200 3300025986 Bacteria 3630
293 Ga0207658_10087441 3300025986 Bacteria 2407
294 Ga0207658_10115526 3300025986 Bacteria 2130
295 Ga0207658_10269876 3300025986 Bacteria 1454
296 Ga0207658_10320471 3300025986 Bacteria 1341
297 Ga0207658_10334252 3300025986 Bacteria 1315
298 Ga0207677_10037715 3300026023 Bacteria 3161
299 Ga0207703_10000318 3300026035 Bacteria 52249
300 Ga0207703_10015668 3300026035 Bacteria 5912
301 Ga0207639_10123454 3300026041 Bacteria 2132
302 Ga0207678_10463234 3300026067 Bacteria 1103
303 Ga0207708_10037978 3300026075 Bacteria 3669
304 Ga0207708_10139170 3300026075 Bacteria 1903
305 Ga0207702_10059528 3300026078 Bacteria 3253
306 Ga0207641_10000721 3300026088 Bacteria 35497
307 Ga0207641_10008611 3300026088 Bacteria 8421
308 Ga0207641_10041711 3300026088 Bacteria 3847
309 Ga0207641_10081807 3300026088 Bacteria 2805
310 Ga0207641_10187746 3300026088 Bacteria 1897
311 Ga0207648_10000799 3300026089 Bacteria 35474
312 Ga0207648_10003102 3300026089 Bacteria 17547
313 Ga0207648_10017634 3300026089 Bacteria 6484
314 Ga0207648_10059758 3300026089 Bacteria 3325
315 Ga0207648_10088738 3300026089 Bacteria 2700
316 Ga0207648_10160206 3300026089 Bacteria 1987
317 Ga0207648_10223184 3300026089 Bacteria 1675
318 Ga0207648_10366587 3300026089 Bacteria 1300
319 Ga0207676_10098527 3300026095 Bacteria 2417
320 Ga0207676_10110071 3300026095 Bacteria 2303
321 Ga0207676_10111808 3300026095 Bacteria 2287
322 Ga0207676_10285128 3300026095 Bacteria 1501
323 Ga0207676_10585059 3300026095 Bacteria 1070
324 Ga0207674_10037482 3300026116 Bacteria 5042
325 Ga0207675_100000205 3300026118 Bacteria 54926
326 Ga0207675_100003220 3300026118 Bacteria 16019
327 Ga0207675_100012363 3300026118 Bacteria 7973
328 Ga0207675_100308285 3300026118 Bacteria 1543
329 Ga0207675_100318722 3300026118 Bacteria 1517
330 Ga0207683_10003804 3300026121 Bacteria 13074
331 Ga0207683_10008294 3300026121 Bacteria 8888
332 Ga0207683_10030377 3300026121 Bacteria 4682
333 Ga0207683_10039136 3300026121 Bacteria 4136
334 Ga0207683_10100452 3300026121 Bacteria 2583
335 Ga0207683_10238570 3300026121 Bacteria 1658
336 Ga0207683_10296538 3300026121 Bacteria 1479
337 Ga0207698_10170172 3300026142 Bacteria 1917
338 Ga0207698_10553696 3300026142 Bacteria 1128
339 Ga0209281_1004875 3300027111 Bacteria 3883
340 Ga0209371_1006575 3300027312 Bacteria 4270
341 Ga0209983_1000057 3300027665 Bacteria 16946
342 Ga0209998_10000641 3300027717 Bacteria 9378
343 Ga0209974_10010235 3300027876 Bacteria 3166
344 Ga0207428_10061282 3300027907 Bacteria 2979
345 Ga0207428_10163081 3300027907 Bacteria 1692
346 Ga0268266_10014568 3300028379 Bacteria 6756
347 Ga0268266_10039553 3300028379 Bacteria 4017
348 Ga0268266_10195253 3300028379 Bacteria 1850
349 Ga0268266_10242918 3300028379 Bacteria 1663
350 Ga0268265_10034022 3300028380 Bacteria 3711
351 Ga0268265_10039450 3300028380 Bacteria 3481
352 Ga0268265_10371914 3300028380 Bacteria 1312
353 Ga0268264_10000373 3300028381 Bacteria 65793
354 Ga0268264_10002625 3300028381 Bacteria 15693
355 Ga0268264_10099782 3300028381 Bacteria 2520
356 Ga0307517_10000052 3300028786 Bacteria 155904
357 Ga0307515_10000358 3300028794 Bacteria 112133
358 Ga0307515_10003504 3300028794 Bacteria 32990
359 Ga0307515_10017024 3300028794 Bacteria 13278
360 Ga0307515_10028554 3300028794 Bacteria 9479
361 Ga0307515_10104667 3300028794 Bacteria 3378
362 Ga0268256_1006625 3300030500 Bacteria 4270
363 Ga0307512_10012320 3300030522 Bacteria 8075
364 Ga0307513_10037344 3300031456 Bacteria 5407
365 Ga0307509_10002117 3300031507 Bacteria 32688
366 Ga0307509_10013408 3300031507 Bacteria 9709
367 Ga0307509_10024236 3300031507 Bacteria 6797
368 Ga0307509_10029302 3300031507 Bacteria 6112
369 Ga0307509_10216644 3300031507 Bacteria 1732
370 Ga0307509_10267057 3300031507 Bacteria 1481
371 Ga0307408_100124380 3300031548 Bacteria 2003
372 Ga0307408_100333935 3300031548 Bacteria 1281
373 Ga0307508_10000053 3300031616 Bacteria 128020
374 Ga0307508_10244006 3300031616 Bacteria 1393
375 Ga0307514_10009268 3300031649 Bacteria 8293
376 Ga0307514_10260914 3300031649 Bacteria 1014
377 Ga0307516_10034119 3300031730 Bacteria 5116
378 Ga0307405_10008662 3300031731 Bacteria 5171
379 Ga0307405_10142693 3300031731 Bacteria 1672
380 Ga0307413_10101936 3300031824 Bacteria 1899
381 Ga0307413_10152944 3300031824 Bacteria 1610
382 Ga0307413_10175090 3300031824 Bacteria 1523
383 Ga0307410_10013807 3300031852 Bacteria 4727
384 Ga0307410_10142019 3300031852 Bacteria 1777
385 Ga0307406_10066072 3300031901 Bacteria 2353
386 Ga0307407_10034564 3300031903 Bacteria 2769
387 Ga0307407_10162104 3300031903 Bacteria 1464
388 Ga0307412_10001167 3300031911 Bacteria 15025
389 Ga0307412_10013973 3300031911 Bacteria 4724
390 Ga0307412_10272645 3300031911 Bacteria 1325
391 Ga0307409_100095983 3300031995 Bacteria 2444
392 Ga0307409_100097537 3300031995 Bacteria 2428
393 Ga0307416_100001303 3300032002 Bacteria 13464
394 Ga0307416_100035126 3300032002 Bacteria 3824
395 Ga0307416_100039700 3300032002 Bacteria 3648
396 Ga0307416_100135747 3300032002 Bacteria 2225
397 Ga0307416_100542778 3300032002 Bacteria 1235
398 Ga0307416_100633299 3300032002 Bacteria 1152
399 Ga0307414_10015531 3300032004 Bacteria 4597
400 Ga0307414_10081091 3300032004 Bacteria 2375
401 Ga0307411_10017113 3300032005 Bacteria 4119
402 Ga0307411_10093622 3300032005 Bacteria 2104
403 Ga0307415_100005445 3300032126 Bacteria 6762
404 Ga0307415_100338432 3300032126 Bacteria 1262
405 Ga0307507_10136927 3300033179 Bacteria 1893
406 Ga0307507_10166568 3300033179 Bacteria 1613
407 Ga0307510_10001123 3300033180 Bacteria 28660
408 Ga0307510_10125131 3300033180 Bacteria 2262
409 Ga0307510_10254894 3300033180 Bacteria 1239
410 Ga0373939_0000239 3300035114 Bacteria 14843
411 Ga0373960_0001500 3300035121 Bacteria 5188
412 Ga0373931_0028290 3300035691 Bacteria 2868
413 Ga0373935_0507337 3300035692 Bacteria 876
414 Ga0373927_0031321 3300035695 Bacteria 3467
415 Ga0373937_0104007 3300036401 Bacteria 2638
416 Ga0373925_0003598 3300037068 Bacteria 11945
417 Ga0373925_0294504 3300037068 Bacteria 1309
418 Ga0395899_0087461 3300037312 Bacteria 2262
419 Ga0395900_0044064 3300037418 Bacteria 4599
420 Ga0395898_0041312 3300037466 Bacteria 4556
421 Ga0395905_0011306 3300037471 Bacteria 8631
422 Ga0436364_0804269 3300037853 Bacteria 3901
423 Ga0436365_0116034 3300039437 Bacteria 3825
424 Ga0436360_0217520 3300039438 Bacteria 3182
425 Ga0436363_0090351 3300039450 Bacteria 4290
426 Ga0436363_0818447 3300039450 Bacteria 743
427 Ga0439433_0014717 3300041999 Bacteria 1724
428 Ga0439442_005368 3300042002 Bacteria 2564
429 Ga0439445_0006810 3300042004 Bacteria 2635
430 Ga0439432_002542 3300042006 Bacteria 6875
431 Ga0439449_0006606 3300042007 Bacteria 4435
432 Ga0439452_008154 3300042010 Bacteria 3168
433 Ga0439462_0007813 3300042015 Bacteria 2684
434 Ga0450923_004013 3300042125 Bacteria 2278
435 Ga0450895_004569 3300042132 Bacteria 1095
436 Ga0450896_002017 3300042133 Bacteria 2585
437 Ga0439446_0021365 3300042156 Bacteria 1829
438 Ga0439434_0005056 3300042435 Bacteria 3856
439 Ga0439434_0095636 3300042435 Bacteria 953
440 Ga0439444_0004016 3300042437 Bacteria 2111
441 Ga0439460_0041366 3300042461 Bacteria 1354
442 Ga0451577_0003401 3300042876 Bacteria 17770
443 Ga0451577_0083821 3300042876 Bacteria 2844
444 Ga0451577_0397719 3300042876 Bacteria 1250
445 Ga0451576_0212818 3300045051 Bacteria 2018
446 Ga0451576_0259420 3300045051 Bacteria 1816
447 Ga0495592_0000370 3300046454 Bacteria 35460
448 Ga0495590_0018473 3300046457 Bacteria 2496
449 Ga0495590_0077918 3300046457 Bacteria 1166
450 Ga0495629_0133852 3300046459 Bacteria 1726
451 Ga0495641_0154252 3300046461 Bacteria 1027
452 Ga0495650_0004943 3300046471 Bacteria 8892
453 Ga0495606_0042220 3300046507 Bacteria 3052
454 Ga0495610_0035524 3300046512 Bacteria 2558
455 Ga0495630_0226860 3300046517 Bacteria 1426
456 Ga0495632_0120244 3300046519 Bacteria 1228
457 Ga0495598_0015509 3300046537 Bacteria 1926
458 Ga0495621_0017012 3300046539 Bacteria 2343
459 Ga0495621_0129707 3300046539 Bacteria 980
460 Ga0495668_0120190 3300046616 Bacteria 1437
461 Ga0495658_0021511 3300046683 Bacteria 3401
462 Ga0495658_0046760 3300046683 Bacteria 2434
463 Ga0495624_0057406 3300046690 Bacteria 2447
464 Ga0495660_0087825 3300046810 Bacteria 1621
465 Ga0495674_0283840 3300047319 Bacteria 1356
466 Ga0495672_0033634 3300047320 Bacteria 3175
467 Ga0495676_0037805 3300047321 Bacteria 4014
468 Ga0495687_007340 3300047443 Bacteria 6515
469 Ga0495681_0134308 3300047470 Bacteria 1051
470 Ga0495684_0084233 3300047471 Bacteria 2412
471 Ga0495686_0013777 3300047472 Bacteria 5602
472 Ga0495593_0025281 3300047673 Bacteria 3286
473 Ga0495614_0087608 3300048089 Bacteria 1352
474 Ga0495614_0127394 3300048089 Bacteria 1125
475 Ga0496100_0259363 3300048903 Bacteria 1289
476 Ga0496102_0445177 3300048905 Bacteria 1215
477 Ga0496103_0161945 3300048906 Bacteria 1435
478 Ga0496108_0489606 3300048911 Bacteria 1074
479 Ga0496110_0026602 3300048913 Bacteria 4953
480 Ga0496114_0226734 3300048917 Bacteria 1641
481 Ga0496114_1049779 3300048917 Bacteria 699
482 Ga0496116_0008170 3300048919 Bacteria 9134
483 Ga0496116_0030720 3300048919 Bacteria 3855
484 Ga0496117_0022859 3300048920 Bacteria 5007
485 Ga0496118_0005781 3300048921 Bacteria 13889
486 Ga0496118_0032451 3300048921 Bacteria 4301
487 Ga0496119_0018081 3300048922 Bacteria 5266
488 Ga0496120_0063561 3300048923 Bacteria 2052
489 Ga0496121_0000314 3300048924 Bacteria 100909
490 Ga0496121_0025188 3300048924 Bacteria 5657
491 Ga0496122_0000046 3300048925 Bacteria 274640
492 Ga0496122_0038261 3300048925 Bacteria 3847
493 Ga0496123_0000082 3300048926 Bacteria 188909
494 Ga0496124_0254698 3300048927 Bacteria 1295
495 Ga0496125_0000028 3300048928 Bacteria 387222
496 Ga0496125_0000854 3300048928 Bacteria 48916
497 Ga0496125_0009558 3300048928 Bacteria 9941
498 Ga0496126_0021467 3300048929 Bacteria 6305
499 Ga0496126_0031548 3300048929 Bacteria 5004
500 Ga0496126_0035484 3300048929 Bacteria 4674
501 Ga0501032_0294285 3300049569 Bacteria 1050
502 Ga0501033_0022359 3300049570 Bacteria 4771
503 Ga0501034_0147189 3300049571 Bacteria 2332
504 Ga0501036_0001323 3300049572 Bacteria 19023
505 Ga0501038_0023395 3300049574 Bacteria 5524
506 Ga0501038_0031829 3300049574 Bacteria 4659
507 Ga0501039_0001406 3300049575 Bacteria 17703
508 Ga0501039_0032244 3300049575 Bacteria 4039
509 Ga0501040_0126635 3300049576 Bacteria 1794
510 Ga0501042_0007611 3300049578 Bacteria 7107
511 Ga0501043_0711032 3300049579 Bacteria 733
512 Ga0501046_0030231 3300049580 Bacteria 4398
513 Ga0501046_0172036 3300049580 Bacteria 1625
514 Ga0501047_0002464 3300049581 Bacteria 17651
515 Ga0501048_0017159 3300049582 Bacteria 5336
516 Ga0501068_0005693 3300049584 Bacteria 6824
517 Ga0501071_0026671 3300049587 Bacteria 4058
518 Ga0501074_0206344 3300049590 Bacteria 1400
519 Ga0501076_0003858 3300049592 Bacteria 10557
520 Ga0501076_0102992 3300049592 Bacteria 2302
521 Ga0501079_0295658 3300049741 Bacteria 1267
522 Ga0501081_0017702 3300049743 Bacteria 4722
523 Ga0501035_0008851 3300049822 Bacteria 9366
524 Ga0501035_0019386 3300049822 Bacteria 6256
525 Ga0501035_0029433 3300049822 Bacteria 5008
526 Ga0501044_0000022 3300049823 Bacteria 201689
527 Ga0501044_0040830 3300049823 Bacteria 4833
528 Ga0501044_0059324 3300049823 Bacteria 3920
529 Ga0501045_0012264 3300049824 Bacteria 6036
530 nmdc:mga06z11_252922_c1 3300050494 Bacteria 1038
531 nmdc:mga07m45_79236_c1 3300050496 Bacteria 1875
532 nmdc:mga05p37_43331_c1 3300050507 Bacteria 5536
533 nmdc:mga05p37_835647_c1 3300050507 Bacteria 1002
534 nmdc:mga09592_43177_c1 3300050508 Bacteria 3794
535 nmdc:mga06r32_102907_c1 3300050510 Bacteria 2804
536 nmdc:mga06r32_32080_c1 3300050510 Bacteria 4939
537 nmdc:mga08y16_222889_c1 3300050511 Bacteria 1952
538 nmdc:mga08y16_85784_c1 3300050511 Bacteria 3282
539 nmdc:mga0n895_2463_c1 3300050512 Bacteria 14477
540 nmdc:mga08x19_176731_c1 3300050514 Bacteria 1456
541 nmdc:mga0a205_2569_c1 3300050515 Bacteria 16006
542 Ga0500578_0011753 3300053086 Bacteria 5654
543 Ga0500643_000258 3300053087 Bacteria 47298
544 Ga0500651_0067977 3300053093 Bacteria 2219
545 Ga0500641_0000180 3300053096 Bacteria 23776
546 Ga0500650_0101848 3300053098 Bacteria 1343
547 Ga0500556_0010134 3300053104 Bacteria 2757
548 Ga0500557_058593 3300053105 Bacteria 1247
549 Ga0500607_071221 3300053121 Bacteria 1795
550 Ga0500652_074936 3300053131 Bacteria 1406
551 Ga0500652_077904 3300053131 Bacteria 1379
552 Ga0500658_0003162 3300053134 Bacteria 6280
553 Ga0500559_0000041 3300053136 Bacteria 104877
554 Ga0500568_0039618 3300053139 Bacteria 1901
555 Ga0500568_0089800 3300053139 Bacteria 1159
556 Ga0500616_0005445 3300053153 Bacteria 8637
557 Ga0500616_0008837 3300053153 Bacteria 6196
558 Ga0500622_0003555 3300053156 Bacteria 10302
559 Ga0500622_0003593 3300053156 Bacteria 10221
560 Ga0500622_0005836 3300053156 Bacteria 7292
561 Ga0500645_000789 3300053730 Bacteria 19068
562 Ga0500645_001374 3300053730 Bacteria 12490
563 Ga0500645_016606 3300053730 Bacteria 2316
564 Ga0501082_0005387 3300060353 Bacteria 11102
565 Ga0501082_0026969 3300060353 Bacteria 4949
566 Ga0501082_0414680 3300060353 Bacteria 1176
567 Ga0530510_0051497 3300061734 Bacteria 2975

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053131 Ga0500652_077904 Ga0500652_077904_393_1076 210
2 3300048903 Ga0496100_0259363 Ga0496100_0259363_603_1268 221
3 3300048917 Ga0496114_1049779 Ga0496114_1049779_10_675 221
4 3300005367 Ga0070667_100052812 Ga0070667_1000528122 230
5 3300014969 Ga0157376_10099751 Ga0157376_100997512 230
6 3300025940 Ga0207691_10018677 Ga0207691_100186775 230
7 3300025986 Ga0207658_10115526 Ga0207658_101155262 230
8 3300026121 Ga0207683_10008294 Ga0207683_100082946 230
9 3300005456 Ga0070678_100005397 Ga0070678_1000053974 231
10 3300039450 Ga0436363_0818447 Ga0436363_0818447_16_711 231
11 3300050507 nmdc:mga05p37_43331_c1 nmdc:mga05p37_43331_c1_4814_5509 231
12 3300025925 Ga0207650_10629527 Ga0207650_106295271 232
13 3300005347 Ga0070668_100096386 Ga0070668_1000963862 234
14 3300005353 Ga0070669_100040781 Ga0070669_1000407813 234
15 3300005367 Ga0070667_100050187 Ga0070667_1000501873 234
16 3300005459 Ga0068867_100002610 Ga0068867_1000026108 234
17 3300005617 Ga0068859_100121002 Ga0068859_1001210022 234
18 3300005719 Ga0068861_100002798 Ga0068861_1000027986 234
19 3300005843 Ga0068860_100001383 Ga0068860_10000138318 234
20 3300005844 Ga0068862_100041402 Ga0068862_1000414022 234
21 3300006881 Ga0068865_100017925 Ga0068865_1000179252 234
22 3300006931 Ga0097620_100121007 Ga0097620_1001210072 234
23 3300009174 Ga0105241_10342665 Ga0105241_103426652 234
24 3300009553 Ga0105249_10016954 Ga0105249_100169545 234
25 3300013297 Ga0157378_10002940 Ga0157378_100029402 234
26 3300013306 Ga0163162_10009038 Ga0163162_100090382 234
27 3300013308 Ga0157375_10113828 Ga0157375_101138282 234
28 3300017792 Ga0163161_10256007 Ga0163161_102560072 234
29 3300025923 Ga0207681_10043502 Ga0207681_100435023 234
30 3300025938 Ga0207704_10002656 Ga0207704_100026564 234
31 3300025940 Ga0207691_10121274 Ga0207691_101212742 234
32 3300025961 Ga0207712_10065389 Ga0207712_100653892 234
33 3300026067 Ga0207678_10463234 Ga0207678_104632342 234
34 3300026089 Ga0207648_10000799 Ga0207648_1000079918 234
35 3300026118 Ga0207675_100003220 Ga0207675_10000322010 234
36 3300028380 Ga0268265_10039450 Ga0268265_100394502 234
37 3300028381 Ga0268264_10002625 Ga0268264_100026259 234
38 3300014326 Ga0157380_10078021 Ga0157380_100780213 235
39 3300049579 Ga0501043_0711032 Ga0501043_0711032_11_721 236
40 3300053730 Ga0500645_016606 Ga0500645_016606_1235_2023 236
41 3300005329 Ga0070683_100170703 Ga0070683_1001707032 237
42 3300005344 Ga0070661_100119433 Ga0070661_1001194332 237
43 3300005366 Ga0070659_100212422 Ga0070659_1002124223 237
44 3300005616 Ga0068852_100247236 Ga0068852_1002472362 237
45 3300013102 Ga0157371_10211600 Ga0157371_102116002 237
46 3300013297 Ga0157378_10174393 Ga0157378_101743932 237
47 3300025944 Ga0207661_10247635 Ga0207661_102476352 237
48 3300035692 Ga0373935_0507337 Ga0373935_0507337_14_817 238
49 3300046683 Ga0495658_0046760 Ga0495658_0046760_297_1100 238
50 3300047319 Ga0495674_0283840 Ga0495674_0283840_479_1282 238
51 3300049741 Ga0501079_0295658 Ga0501079_0295658_325_1113 238
52 3300005331 Ga0070670_100078217 Ga0070670_1000782173 239
53 3300005333 Ga0070677_10071266 Ga0070677_100712662 239
54 3300005354 Ga0070675_100051959 Ga0070675_1000519593 239
55 3300005456 Ga0070678_100086435 Ga0070678_1000864353 239
56 3300005543 Ga0070672_100092454 Ga0070672_1000924543 239
57 3300014325 Ga0163163_10144317 Ga0163163_101443172 239
58 3300025925 Ga0207650_10009488 Ga0207650_100094884 239
59 3300025926 Ga0207659_10037827 Ga0207659_100378272 239
60 3300026089 Ga0207648_10223184 Ga0207648_102231841 239
61 3300026121 Ga0207683_10100452 Ga0207683_101004523 239
62 3300060353 Ga0501082_0005387 Ga0501082_0005387_9908_10699 239
63 3300005834 Ga0068851_10234962 Ga0068851_102349621 240
64 3300025926 Ga0207659_10120428 Ga0207659_101204283 240
65 3300026089 Ga0207648_10366587 Ga0207648_103665871 240
66 3300028379 Ga0268266_10242918 Ga0268266_102429182 240
67 3300046457 Ga0495590_0018473 Ga0495590_0018473_695_1534 240
68 3300046810 Ga0495660_0087825 Ga0495660_0087825_284_1123 240
69 3300060353 Ga0501082_0414680 Ga0501082_0414680_161_958 240
70 3300005328 Ga0070676_10104959 Ga0070676_101049591 241
71 3300009098 Ga0105245_10463696 Ga0105245_104636962 241
72 3300013104 Ga0157370_10103811 Ga0157370_101038113 241
73 3300025909 Ga0207705_10206106 Ga0207705_102061062 241
74 3300032002 Ga0307416_100542778 Ga0307416_1005427782 241
75 3300048089 Ga0495614_0087608 Ga0495614_0087608_195_1031 241
76 3300005334 Ga0068869_100215260 Ga0068869_1002152602 242
77 3300005338 Ga0068868_100075800 Ga0068868_1000758002 242
78 3300005343 Ga0070687_100099758 Ga0070687_1000997582 242
79 3300005355 Ga0070671_100003531 Ga0070671_1000035313 242
80 3300005356 Ga0070674_100052253 Ga0070674_1000522534 242
81 3300005367 Ga0070667_100195856 Ga0070667_1001958562 242
82 3300005438 Ga0070701_10084876 Ga0070701_100848762 242
83 3300005441 Ga0070700_100035579 Ga0070700_1000355793 242
84 3300005617 Ga0068859_100073756 Ga0068859_1000737564 242
85 3300005618 Ga0068864_100118256 Ga0068864_1001182562 242
86 3300005841 Ga0068863_100033017 Ga0068863_1000330172 242
87 3300005841 Ga0068863_100041906 Ga0068863_1000419063 242
88 3300005842 Ga0068858_100014852 Ga0068858_1000148524 242
89 3300006931 Ga0097620_100073756 Ga0097620_1000737562 242
90 3300009098 Ga0105245_10698287 Ga0105245_106982871 242
91 3300009148 Ga0105243_10118602 Ga0105243_101186022 242
92 3300009176 Ga0105242_10072383 Ga0105242_100723832 242
93 3300009177 Ga0105248_10738669 Ga0105248_107386691 242
94 3300013308 Ga0157375_10814436 Ga0157375_108144361 242
95 3300017792 Ga0163161_10181671 Ga0163161_101816712 242
96 3300025901 Ga0207688_10048803 Ga0207688_100488032 242
97 3300025907 Ga0207645_10031204 Ga0207645_100312042 242
98 3300025918 Ga0207662_10030867 Ga0207662_100308673 242
99 3300025925 Ga0207650_10043702 Ga0207650_100437022 242
100 3300025927 Ga0207687_10486668 Ga0207687_104866682 242
101 3300025931 Ga0207644_10001589 Ga0207644_100015899 242
102 3300025933 Ga0207706_10032850 Ga0207706_100328503 242
103 3300025934 Ga0207686_10350385 Ga0207686_103503851 242
104 3300025940 Ga0207691_10045169 Ga0207691_100451694 242
105 3300025942 Ga0207689_10137975 Ga0207689_101379753 242
106 3300025961 Ga0207712_10031620 Ga0207712_100316203 242
107 3300025986 Ga0207658_10320471 Ga0207658_103204711 242
108 3300026075 Ga0207708_10037978 Ga0207708_100379783 242
109 3300026088 Ga0207641_10081807 Ga0207641_100818072 242
110 3300026118 Ga0207675_100012363 Ga0207675_1000123636 242
111 3300026142 Ga0207698_10170172 Ga0207698_101701723 242
112 3300046537 Ga0495598_0015509 Ga0495598_0015509_733_1536 242
113 3300049580 Ga0501046_0030231 Ga0501046_0030231_3285_4076 242
114 3300005331 Ga0070670_100154247 Ga0070670_1001542471 243
115 3300005354 Ga0070675_100053171 Ga0070675_1000531712 243
116 3300005356 Ga0070674_100052928 Ga0070674_1000529282 243
117 3300005364 Ga0070673_100163849 Ga0070673_1001638491 243
118 3300005718 Ga0068866_10028786 Ga0068866_100287862 243
119 3300017792 Ga0163161_10032563 Ga0163161_100325633 243
120 3300025893 Ga0207682_10034026 Ga0207682_100340263 243
121 3300025937 Ga0207669_10029166 Ga0207669_100291663 243
122 3300026118 Ga0207675_100318722 Ga0207675_1003187222 243
123 3300026121 Ga0207683_10039136 Ga0207683_100391363 243
124 3300047471 Ga0495684_0084233 Ga0495684_0084233_636_1439 244
125 3300053156 Ga0500622_0005836 Ga0500622_0005836_789_1580 244
126 3300049572 Ga0501036_0001323 Ga0501036_0001323_7149_7946 245
127 3300049574 Ga0501038_0023395 Ga0501038_0023395_3028_3825 245
128 3300049575 Ga0501039_0001406 Ga0501039_0001406_7006_7803 245
129 3300049576 Ga0501040_0126635 Ga0501040_0126635_938_1735 245
130 3300049578 Ga0501042_0007611 Ga0501042_0007611_3791_4588 245
131 3300049582 Ga0501048_0017159 Ga0501048_0017159_1256_2053 245
132 3300049590 Ga0501074_0206344 Ga0501074_0206344_180_977 245
133 3300049592 Ga0501076_0003858 Ga0501076_0003858_5345_6142 245
134 3300049743 Ga0501081_0017702 Ga0501081_0017702_947_1744 245
135 3300049822 Ga0501035_0029433 Ga0501035_0029433_2968_3765 245
136 3300049824 Ga0501045_0012264 Ga0501045_0012264_1006_1803 245
137 3300053139 Ga0500568_0039618 Ga0500568_0039618_143_934 245
138 3300053139 Ga0500568_0089800 Ga0500568_0089800_146_937 245
139 3300060353 Ga0501082_0026969 Ga0501082_0026969_1481_2278 245
140 3300061734 Ga0530510_0051497 Ga0530510_0051497_892_1689 245
141 3300021441 Ga0213871_10009898 Ga0213871_100098982 246
142 3300039438 Ga0436360_0217520 Ga0436360_0217520_1918_2712 246
143 3300046683 Ga0495658_0021511 Ga0495658_0021511_301_1104 246
144 3300009176 Ga0105242_10099151 Ga0105242_100991512 247
145 3300025934 Ga0207686_10357182 Ga0207686_103571821 247
146 3300053087 Ga0500643_000258 Ga0500643_000258_16554_17342 248
147 3300053096 Ga0500641_0000180 Ga0500641_0000180_21907_22695 248
148 3300053104 Ga0500556_0010134 Ga0500556_0010134_1785_2573 248
149 3300053105 Ga0500557_058593 Ga0500557_058593_370_1158 248
150 3300053153 Ga0500616_0008837 Ga0500616_0008837_3239_4027 248
151 3300053156 Ga0500622_0003593 Ga0500622_0003593_1621_2409 248
152 3300053730 Ga0500645_000789 Ga0500645_000789_2324_3112 248
153 3300042132 Ga0450895_004569 Ga0450895_004569_334_1083 249
154 3300049569 Ga0501032_0294285 Ga0501032_0294285_237_1034 249
155 3300049570 Ga0501033_0022359 Ga0501033_0022359_3586_4383 249
156 3300049571 Ga0501034_0147189 Ga0501034_0147189_1109_1906 249
157 3300049575 Ga0501039_0032244 Ga0501039_0032244_3062_3859 249
158 3300049581 Ga0501047_0002464 Ga0501047_0002464_10482_11279 249
159 3300049822 Ga0501035_0008851 Ga0501035_0008851_2184_2981 249
160 3300049823 Ga0501044_0040830 Ga0501044_0040830_709_1506 249
161 3300005546 Ga0070696_100003110 Ga0070696_1000031108 251
162 3300047443 Ga0495687_007340 Ga0495687_007340_3183_3986 251
163 3300053134 Ga0500658_0003162 Ga0500658_0003162_2660_3463 251
164 3300005331 Ga0070670_100039813 Ga0070670_1000398133 252
165 3300005618 Ga0068864_100055639 Ga0068864_1000556393 252
166 3300006358 Ga0068871_100043036 Ga0068871_1000430362 252
167 3300009177 Ga0105248_10044692 Ga0105248_100446922 252
168 3300025941 Ga0207711_10029923 Ga0207711_100299232 252
169 3300026095 Ga0207676_10110071 Ga0207676_101100712 252
170 3300031911 Ga0307412_10272645 Ga0307412_102726452 252
171 3300042007 Ga0439449_0006606 Ga0439449_0006606_1120_1923 252
172 3300046457 Ga0495590_0077918 Ga0495590_0077918_343_1149 254
173 3300005367 Ga0070667_100717555 Ga0070667_1007175551 255
174 3300009176 Ga0105242_10342584 Ga0105242_103425842 255
175 3300025927 Ga0207687_10595296 Ga0207687_105952962 255
176 3300026095 Ga0207676_10285128 Ga0207676_102851282 255
177 3300047472 Ga0495686_0013777 Ga0495686_0013777_2489_3286 255
178 3300049574 Ga0501038_0031829 Ga0501038_0031829_787_1572 255
179 3300005436 Ga0070713_100080286 Ga0070713_1000802862 256
180 3300014969 Ga0157376_10064677 Ga0157376_100646773 256
181 3300006881 Ga0068865_100213184 Ga0068865_1002131843 257
182 3300030522 Ga0307512_10012320 Ga0307512_100123204 258
183 3300031507 Ga0307509_10002117 Ga0307509_1000211727 258
184 3300032004 Ga0307414_10081091 Ga0307414_100810912 258
185 3300035695 Ga0373927_0031321 Ga0373927_0031321_539_1315 258
186 3300037068 Ga0373925_0003598 Ga0373925_0003598_4918_5694 258
187 3300046461 Ga0495641_0154252 Ga0495641_0154252_229_1005 258
188 3300046507 Ga0495606_0042220 Ga0495606_0042220_2151_2954 258
189 3300053086 Ga0500578_0011753 Ga0500578_0011753_3187_3990 258
190 3300053730 Ga0500645_001374 Ga0500645_001374_2235_3038 258
191 3300005471 Ga0070698_100150529 Ga0070698_1001505292 259
192 3300013297 Ga0157378_10832349 Ga0157378_108323491 259
193 3300028794 Ga0307515_10017024 Ga0307515_1001702410 259
194 3300031507 Ga0307509_10024236 Ga0307509_100242363 259
195 3300031507 Ga0307509_10267057 Ga0307509_102670571 259
196 3300031616 Ga0307508_10244006 Ga0307508_102440062 259
197 3300033179 Ga0307507_10136927 Ga0307507_101369272 259
198 3300033180 Ga0307510_10254894 Ga0307510_102548941 259
199 3300036401 Ga0373937_0104007 Ga0373937_0104007_699_1535 259
200 3300037068 Ga0373925_0294504 Ga0373925_0294504_58_894 259
201 3300050496 nmdc:mga07m45_79236_c1 nmdc:mga07m45_79236_c1_895_1692 259
202 iso_pu_bacteria 2643221603 2644028815 259
203 3300042876 Ga0451577_0083821 Ga0451577_0083821_932_1714 260
204 3300042876 Ga0451577_0397719 Ga0451577_0397719_231_1013 260
205 3300045051 Ga0451576_0259420 Ga0451576_0259420_175_957 260
206 3300047470 Ga0495681_0134308 Ga0495681_0134308_172_954 260
207 iso_pu_bacteria 2928115317 2928116268 260
208 3300025292 Ga0209676_1009602 Ga0209676_10096023 261
209 3300025298 Ga0209050_1005397 Ga0209050_10053972 261
210 3300025961 Ga0207712_10322642 Ga0207712_103226422 261
211 3300046539 Ga0495621_0129707 Ga0495621_0129707_175_960 261
212 3300049822 Ga0501035_0019386 Ga0501035_0019386_3516_4319 261
213 3300049823 Ga0501044_0059324 Ga0501044_0059324_1662_2465 261
214 iso_pu_bacteria 2599185292 2599906434 261
215 iso_pu_bacteria 2643221594 2643980295 261
216 iso_pu_bacteria 2643221609 2644061596 261
217 iso_pu_bacteria 2643221611 2644075128 261
218 iso_pu_bacteria 2643221621 2644121925 261
219 iso_pu_bacteria 2643221660 2644341317 261
220 iso_pu_bacteria 2808606395 2809032392 261
221 iso_pu_bacteria 2816332133 2816473870 261
222 iso_pu_bacteria 2857537821 2857542470 261
223 iso_pu_bacteria 2885192300 2885195308 261
224 iso_pu_bacteria 2941479691 2941485192 261
225 3300005328 Ga0070676_10009109 Ga0070676_100091094 262
226 3300005331 Ga0070670_100574006 Ga0070670_1005740062 262
227 3300005333 Ga0070677_10009873 Ga0070677_100098731 262
228 3300005347 Ga0070668_100004039 Ga0070668_10000403911 262
229 3300005353 Ga0070669_100045564 Ga0070669_1000455643 262
230 3300005354 Ga0070675_100000968 Ga0070675_10000096819 262
231 3300005356 Ga0070674_100015723 Ga0070674_1000157233 262
232 3300005364 Ga0070673_100283936 Ga0070673_1002839362 262
233 3300005366 Ga0070659_100075953 Ga0070659_1000759533 262
234 3300005367 Ga0070667_100369256 Ga0070667_1003692562 262
235 3300005457 Ga0070662_100048626 Ga0070662_1000486263 262
236 3300005466 Ga0070685_10330626 Ga0070685_103306261 262
237 3300005543 Ga0070672_100036184 Ga0070672_1000361842 262
238 3300005577 Ga0068857_100383297 Ga0068857_1003832972 262
239 3300005577 Ga0068857_100406967 Ga0068857_1004069672 262
240 3300005614 Ga0068856_100181045 Ga0068856_1001810452 262
241 3300005617 Ga0068859_100018309 Ga0068859_1000183098 262
242 3300005618 Ga0068864_100315586 Ga0068864_1003155862 262
243 3300005719 Ga0068861_100008169 Ga0068861_1000081693 262
244 3300005834 Ga0068851_10058040 Ga0068851_100580402 262
245 3300005841 Ga0068863_100007247 Ga0068863_1000072479 262
246 3300005842 Ga0068858_100001501 Ga0068858_1000015018 262
247 3300005843 Ga0068860_100000887 Ga0068860_10000088710 262
248 3300005844 Ga0068862_100003804 Ga0068862_10000380414 262
249 3300006844 Ga0075428_100020551 Ga0075428_1000205515 262
250 3300006844 Ga0075428_100034174 Ga0075428_1000341742 262
251 3300006844 Ga0075428_100035932 Ga0075428_1000359325 262
252 3300006847 Ga0075431_100023575 Ga0075431_1000235752 262
253 3300006847 Ga0075431_100026802 Ga0075431_1000268026 262
254 3300006852 Ga0075433_10008299 Ga0075433_100082995 262
255 3300006880 Ga0075429_100021214 Ga0075429_1000212143 262
256 3300006931 Ga0097620_100018309 Ga0097620_1000183098 262
257 3300009094 Ga0111539_10017029 Ga0111539_100170298 262
258 3300009101 Ga0105247_10104332 Ga0105247_101043323 262
259 3300009147 Ga0114129_10044298 Ga0114129_100442984 262
260 3300009177 Ga0105248_10088842 Ga0105248_100888422 262
261 3300009545 Ga0105237_10077421 Ga0105237_100774212 262
262 3300009545 Ga0105237_10211855 Ga0105237_102118552 262
263 3300009551 Ga0105238_10056685 Ga0105238_100566853 262
264 3300009551 Ga0105238_10241694 Ga0105238_102416942 262
265 3300009553 Ga0105249_10561140 Ga0105249_105611402 262
266 3300011119 Ga0105246_10046791 Ga0105246_100467912 262
267 3300013306 Ga0163162_10156902 Ga0163162_101569022 262
268 3300014326 Ga0157380_10064520 Ga0157380_100645202 262
269 3300014326 Ga0157380_10101086 Ga0157380_101010863 262
270 3300014326 Ga0157380_10617269 Ga0157380_106172692 262
271 3300021384 Ga0213876_10102858 Ga0213876_101028581 262
272 3300025904 Ga0207647_10141996 Ga0207647_101419962 262
273 3300025907 Ga0207645_10003256 Ga0207645_100032568 262
274 3300025913 Ga0207695_10026298 Ga0207695_100262982 262
275 3300025919 Ga0207657_10208705 Ga0207657_102087052 262
276 3300025933 Ga0207706_10001508 Ga0207706_100015085 262
277 3300025937 Ga0207669_10023991 Ga0207669_100239913 262
278 3300025938 Ga0207704_10451306 Ga0207704_104513061 262
279 3300025940 Ga0207691_10000846 Ga0207691_1000084628 262
280 3300025986 Ga0207658_10334252 Ga0207658_103342522 262
281 3300026035 Ga0207703_10000318 Ga0207703_1000031814 262
282 3300026078 Ga0207702_10059528 Ga0207702_100595283 262
283 3300026088 Ga0207641_10000721 Ga0207641_100007212 262
284 3300026089 Ga0207648_10003102 Ga0207648_1000310215 262
285 3300026118 Ga0207675_100000205 Ga0207675_10000020533 262
286 3300027665 Ga0209983_1000057 Ga0209983_100005718 262
287 3300027717 Ga0209998_10000641 Ga0209998_100006418 262
288 3300027876 Ga0209974_10010235 Ga0209974_100102354 262
289 3300027907 Ga0207428_10061282 Ga0207428_100612823 262
290 3300027907 Ga0207428_10163081 Ga0207428_101630812 262
291 3300028380 Ga0268265_10034022 Ga0268265_100340224 262
292 3300028381 Ga0268264_10000373 Ga0268264_1000037315 262
293 3300031456 Ga0307513_10037344 Ga0307513_100373443 262
294 3300031548 Ga0307408_100124380 Ga0307408_1001243802 262
295 3300031731 Ga0307405_10142693 Ga0307405_101426933 262
296 3300031824 Ga0307413_10175090 Ga0307413_101750903 262
297 3300031852 Ga0307410_10142019 Ga0307410_101420192 262
298 3300031903 Ga0307407_10162104 Ga0307407_101621042 262
299 3300031911 Ga0307412_10013973 Ga0307412_100139733 262
300 3300031995 Ga0307409_100095983 Ga0307409_1000959833 262
301 3300032002 Ga0307416_100001303 Ga0307416_10000130311 262
302 3300032002 Ga0307416_100633299 Ga0307416_1006332992 262
303 3300032005 Ga0307411_10093622 Ga0307411_100936222 262
304 3300032126 Ga0307415_100005445 Ga0307415_1000054453 262
305 3300037312 Ga0395899_0087461 Ga0395899_0087461_1404_2192 262
306 3300037418 Ga0395900_0044064 Ga0395900_0044064_984_1772 262
307 3300037466 Ga0395898_0041312 Ga0395898_0041312_1815_2603 262
308 3300037853 Ga0436364_0804269 Ga0436364_0804269_1043_1837 262
309 3300039437 Ga0436365_0116034 Ga0436365_0116034_2023_2817 262
310 3300039450 Ga0436363_0090351 Ga0436363_0090351_2941_3735 262
311 3300042125 Ga0450923_004013 Ga0450923_004013_46_834 262
312 3300042133 Ga0450896_002017 Ga0450896_002017_834_1622 262
313 3300042156 Ga0439446_0021365 Ga0439446_0021365_807_1595 262
314 3300042435 Ga0439434_0095636 Ga0439434_0095636_99_887 262
315 3300042437 Ga0439444_0004016 Ga0439444_0004016_686_1474 262
316 3300042461 Ga0439460_0041366 Ga0439460_0041366_540_1328 262
317 3300047320 Ga0495672_0033634 Ga0495672_0033634_402_1190 262
318 3300048911 Ga0496108_0489606 Ga0496108_0489606_134_922 262
319 3300048928 Ga0496125_0000854 Ga0496125_0000854_17053_17841 262
320 3300048929 Ga0496126_0031548 Ga0496126_0031548_579_1367 262
321 3300049580 Ga0501046_0172036 Ga0501046_0172036_69_857 262
322 3300049584 Ga0501068_0005693 Ga0501068_0005693_3452_4240 262
323 3300049587 Ga0501071_0026671 Ga0501071_0026671_1766_2554 262
324 3300049592 Ga0501076_0102992 Ga0501076_0102992_1295_2083 262
325 3300050507 nmdc:mga05p37_835647_c1 nmdc:mga05p37_835647_c1_16_804 262
326 3300050508 nmdc:mga09592_43177_c1 nmdc:mga09592_43177_c1_282_1070 262
327 3300050510 nmdc:mga06r32_102907_c1 nmdc:mga06r32_102907_c1_620_1408 262
328 3300050510 nmdc:mga06r32_32080_c1 nmdc:mga06r32_32080_c1_3605_4393 262
329 3300050511 nmdc:mga08y16_222889_c1 nmdc:mga08y16_222889_c1_203_991 262
330 3300050511 nmdc:mga08y16_85784_c1 nmdc:mga08y16_85784_c1_2014_2802 262
331 3300050512 nmdc:mga0n895_2463_c1 nmdc:mga0n895_2463_c1_89_877 262
332 3300050515 nmdc:mga0a205_2569_c1 nmdc:mga0a205_2569_c1_2810_3598 262
333 3300053153 Ga0500616_0005445 Ga0500616_0005445_5724_6521 262
334 iso_pu_bacteria 2643221654 2644304470 262
335 iso_pu_bacteria 2858950400 2858952817 262
336 3300005338 Ga0068868_100185742 Ga0068868_1001857422 263
337 3300005367 Ga0070667_100058139 Ga0070667_1000581392 263
338 3300005535 Ga0070684_100430777 Ga0070684_1004307772 263
339 3300005548 Ga0070665_100389898 Ga0070665_1003898982 263
340 3300005841 Ga0068863_100031218 Ga0068863_1000312182 263
341 3300005842 Ga0068858_100145986 Ga0068858_1001459862 263
342 3300006237 Ga0097621_100379163 Ga0097621_1003791632 263
343 3300006358 Ga0068871_100365582 Ga0068871_1003655822 263
344 3300006358 Ga0068871_100520716 Ga0068871_1005207162 263
345 3300006881 Ga0068865_100107372 Ga0068865_1001073722 263
346 3300006946 Ga0079104_1007715 Ga0079104_10077154 263
347 3300009177 Ga0105248_10053979 Ga0105248_100539793 263
348 3300013296 Ga0157374_10790492 Ga0157374_107904921 263
349 3300013308 Ga0157375_10291216 Ga0157375_102912161 263
350 3300014325 Ga0163163_10246843 Ga0163163_102468432 263
351 3300014326 Ga0157380_10899910 Ga0157380_108999101 263
352 3300014968 Ga0157379_10765113 Ga0157379_107651131 263
353 3300014969 Ga0157376_10018173 Ga0157376_100181734 263
354 3300025941 Ga0207711_10042409 Ga0207711_100424093 263
355 3300025981 Ga0207640_10409670 Ga0207640_104096701 263
356 3300025986 Ga0207658_10087441 Ga0207658_100874412 263
357 3300026041 Ga0207639_10123454 Ga0207639_101234542 263
358 3300026088 Ga0207641_10008611 Ga0207641_100086115 263
359 3300026118 Ga0207675_100308285 Ga0207675_1003082851 263
360 3300026121 Ga0207683_10296538 Ga0207683_102965382 263
361 3300026142 Ga0207698_10553696 Ga0207698_105536962 263
362 3300027111 Ga0209281_1004875 Ga0209281_10048752 263
363 3300027312 Ga0209371_1006575 Ga0209371_10065754 263
364 3300028380 Ga0268265_10371914 Ga0268265_103719141 263
365 3300028794 Ga0307515_10000358 Ga0307515_1000035819 263
366 3300030500 Ga0268256_1006625 Ga0268256_10066254 263
367 3300032002 Ga0307416_100035126 Ga0307416_1000351263 263
368 3300032126 Ga0307415_100338432 Ga0307415_1003384322 263
369 3300042876 Ga0451577_0003401 Ga0451577_0003401_3474_4274 263
370 3300046539 Ga0495621_0017012 Ga0495621_0017012_874_1665 263
371 3300048905 Ga0496102_0445177 Ga0496102_0445177_265_1056 263
372 3300048906 Ga0496103_0161945 Ga0496103_0161945_110_901 263
373 3300048913 Ga0496110_0026602 Ga0496110_0026602_1705_2496 263
374 3300050514 nmdc:mga08x19_176731_c1 nmdc:mga08x19_176731_c1_374_1165 263
375 iso_pu_bacteria 2643221569 2643862699 263
376 3300003763 Ga0055529_1000970 Ga0055529_10009705 264
377 3300005328 Ga0070676_10060916 Ga0070676_100609162 264
378 3300005331 Ga0070670_100030342 Ga0070670_1000303423 264
379 3300005335 Ga0070666_10060734 Ga0070666_100607342 264
380 3300005347 Ga0070668_100010211 Ga0070668_1000102115 264
381 3300005353 Ga0070669_100073387 Ga0070669_1000733872 264
382 3300005356 Ga0070674_100011101 Ga0070674_1000111012 264
383 3300005367 Ga0070667_100033806 Ga0070667_1000338062 264
384 3300005455 Ga0070663_100031220 Ga0070663_1000312203 264
385 3300005543 Ga0070672_100010466 Ga0070672_1000104665 264
386 3300005548 Ga0070665_100025455 Ga0070665_1000254555 264
387 3300005834 Ga0068851_10001307 Ga0068851_100013077 264
388 3300005841 Ga0068863_100014591 Ga0068863_1000145913 264
389 3300006237 Ga0097621_100013309 Ga0097621_1000133096 264
390 3300006881 Ga0068865_100043261 Ga0068865_1000432612 264
391 3300013306 Ga0163162_10348497 Ga0163162_103484972 264
392 3300025272 Ga0209455_1000566 Ga0209455_100056615 264
393 3300025321 Ga0207656_10004179 Ga0207656_100041792 264
394 3300025893 Ga0207682_10000207 Ga0207682_1000020715 264
395 3300025907 Ga0207645_10001642 Ga0207645_1000164210 264
396 3300025925 Ga0207650_10045594 Ga0207650_100455942 264
397 3300025926 Ga0207659_10009509 Ga0207659_100095092 264
398 3300025937 Ga0207669_10039938 Ga0207669_100399382 264
399 3300025940 Ga0207691_10000127 Ga0207691_100001279 264
400 3300025941 Ga0207711_10067651 Ga0207711_100676513 264
401 3300025960 Ga0207651_10043856 Ga0207651_100438563 264
402 3300025986 Ga0207658_10034200 Ga0207658_100342003 264
403 3300026035 Ga0207703_10015668 Ga0207703_100156682 264
404 3300026075 Ga0207708_10139170 Ga0207708_101391702 264
405 3300026089 Ga0207648_10088738 Ga0207648_100887382 264
406 3300026095 Ga0207676_10111808 Ga0207676_101118082 264
407 3300026121 Ga0207683_10003804 Ga0207683_100038045 264
408 3300028379 Ga0268266_10014568 Ga0268266_100145687 264
409 3300028381 Ga0268264_10099782 Ga0268264_100997822 264
410 3300031911 Ga0307412_10001167 Ga0307412_1000116714 264
411 3300037471 Ga0395905_0011306 Ga0395905_0011306_5851_6654 264
412 3300048919 Ga0496116_0008170 Ga0496116_0008170_6547_7398 264
413 3300048919 Ga0496116_0030720 Ga0496116_0030720_2808_3632 264
414 3300048920 Ga0496117_0022859 Ga0496117_0022859_4040_4864 264
415 3300048921 Ga0496118_0005781 Ga0496118_0005781_6045_6902 264
416 3300048921 Ga0496118_0032451 Ga0496118_0032451_3255_4079 264
417 3300048922 Ga0496119_0018081 Ga0496119_0018081_255_1079 264
418 3300048923 Ga0496120_0063561 Ga0496120_0063561_773_1597 264
419 3300048924 Ga0496121_0000314 Ga0496121_0000314_46415_47239 264
420 3300048924 Ga0496121_0025188 Ga0496121_0025188_1212_2087 264
421 3300048925 Ga0496122_0000046 Ga0496122_0000046_81492_82367 264
422 3300048925 Ga0496122_0038261 Ga0496122_0038261_118_942 264
423 3300048926 Ga0496123_0000082 Ga0496123_0000082_43388_44263 264
424 3300048927 Ga0496124_0254698 Ga0496124_0254698_217_1041 264
425 3300048928 Ga0496125_0000028 Ga0496125_0000028_122104_122928 264
426 3300048928 Ga0496125_0009558 Ga0496125_0009558_247_1158 264
427 3300048929 Ga0496126_0021467 Ga0496126_0021467_2532_3356 264
428 3300048929 Ga0496126_0035484 Ga0496126_0035484_2737_3624 264
429 3300049823 Ga0501044_0000022 Ga0501044_0000022_13613_14413 264
430 3300005328 Ga0070676_10004590 Ga0070676_100045903 265
431 3300005330 Ga0070690_100216120 Ga0070690_1002161202 265
432 3300005334 Ga0068869_100058292 Ga0068869_1000582922 265
433 3300005338 Ga0068868_100023248 Ga0068868_1000232483 265
434 3300005344 Ga0070661_100301707 Ga0070661_1003017071 265
435 3300005347 Ga0070668_100269107 Ga0070668_1002691072 265
436 3300005355 Ga0070671_100077017 Ga0070671_1000770172 265
437 3300005364 Ga0070673_100004627 Ga0070673_1000046275 265
438 3300005367 Ga0070667_100086665 Ga0070667_1000866652 265
439 3300005459 Ga0068867_100012813 Ga0068867_1000128133 265
440 3300005543 Ga0070672_100113678 Ga0070672_1001136783 265
441 3300005577 Ga0068857_100121642 Ga0068857_1001216422 265
442 3300005618 Ga0068864_100122304 Ga0068864_1001223043 265
443 3300005841 Ga0068863_100022212 Ga0068863_1000222124 265
444 3300006353 Ga0075370_10093959 Ga0075370_100939592 265
445 3300009148 Ga0105243_10051938 Ga0105243_100519383 265
446 3300009177 Ga0105248_10134212 Ga0105248_101342123 265
447 3300013296 Ga0157374_10388059 Ga0157374_103880592 265
448 3300013306 Ga0163162_10172071 Ga0163162_101720713 265
449 3300013308 Ga0157375_10045415 Ga0157375_100454154 265
450 3300013308 Ga0157375_10077149 Ga0157375_100771492 265
451 3300014325 Ga0163163_10913788 Ga0163163_109137882 265
452 3300014968 Ga0157379_10176324 Ga0157379_101763243 265
453 3300025315 Ga0207697_10076530 Ga0207697_100765302 265
454 3300025907 Ga0207645_10012366 Ga0207645_100123665 265
455 3300025923 Ga0207681_10121812 Ga0207681_101218122 265
456 3300025926 Ga0207659_10017151 Ga0207659_100171512 265
457 3300025927 Ga0207687_10631643 Ga0207687_106316431 265
458 3300025932 Ga0207690_10184558 Ga0207690_101845582 265
459 3300025934 Ga0207686_10161849 Ga0207686_101618492 265
460 3300025935 Ga0207709_10073150 Ga0207709_100731502 265
461 3300025940 Ga0207691_10013729 Ga0207691_100137295 265
462 3300025940 Ga0207691_10056758 Ga0207691_100567583 265
463 3300025942 Ga0207689_10048147 Ga0207689_100481473 265
464 3300025960 Ga0207651_10010844 Ga0207651_100108445 265
465 3300025960 Ga0207651_10033176 Ga0207651_100331763 265
466 3300025981 Ga0207640_10470205 Ga0207640_104702051 265
467 3300025986 Ga0207658_10269876 Ga0207658_102698761 265
468 3300026023 Ga0207677_10037715 Ga0207677_100377153 265
469 3300026088 Ga0207641_10041711 Ga0207641_100417113 265
470 3300026089 Ga0207648_10017634 Ga0207648_100176348 265
471 3300026095 Ga0207676_10098527 Ga0207676_100985273 265
472 3300026116 Ga0207674_10037482 Ga0207674_100374824 265
473 3300028786 Ga0307517_10000052 Ga0307517_1000005289 265
474 3300028794 Ga0307515_10003504 Ga0307515_1000350418 265
475 3300028794 Ga0307515_10028554 Ga0307515_100285546 265
476 3300028794 Ga0307515_10104667 Ga0307515_101046672 265
477 3300031507 Ga0307509_10013408 Ga0307509_100134089 265
478 3300031507 Ga0307509_10029302 Ga0307509_100293024 265
479 3300031507 Ga0307509_10216644 Ga0307509_102166441 265
480 3300031616 Ga0307508_10000053 Ga0307508_1000005323 265
481 3300031649 Ga0307514_10009268 Ga0307514_1000926811 265
482 3300031649 Ga0307514_10260914 Ga0307514_102609141 265
483 3300031730 Ga0307516_10034119 Ga0307516_100341192 265
484 3300031824 Ga0307413_10101936 Ga0307413_101019362 265
485 3300031901 Ga0307406_10066072 Ga0307406_100660722 265
486 3300032002 Ga0307416_100135747 Ga0307416_1001357472 265
487 3300033179 Ga0307507_10166568 Ga0307507_101665683 265
488 3300033180 Ga0307510_10001123 Ga0307510_1000112323 265
489 3300033180 Ga0307510_10125131 Ga0307510_101251312 265
490 3300035114 Ga0373939_0000239 Ga0373939_0000239_2196_2999 265
491 3300035121 Ga0373960_0001500 Ga0373960_0001500_2039_2842 265
492 3300035691 Ga0373931_0028290 Ga0373931_0028290_1846_2649 265
493 3300041999 Ga0439433_0014717 Ga0439433_0014717_416_1219 265
494 3300042002 Ga0439442_005368 Ga0439442_005368_1200_2003 265
495 3300042004 Ga0439445_0006810 Ga0439445_0006810_50_853 265
496 3300042006 Ga0439432_002542 Ga0439432_002542_1260_2063 265
497 3300042010 Ga0439452_008154 Ga0439452_008154_158_961 265
498 3300042015 Ga0439462_0007813 Ga0439462_0007813_1722_2525 265
499 3300042435 Ga0439434_0005056 Ga0439434_0005056_1062_1865 265
500 3300045051 Ga0451576_0212818 Ga0451576_0212818_1125_1928 265
501 3300046454 Ga0495592_0000370 Ga0495592_0000370_17433_18236 265
502 3300046459 Ga0495629_0133852 Ga0495629_0133852_546_1349 265
503 3300046471 Ga0495650_0004943 Ga0495650_0004943_4638_5441 265
504 3300046517 Ga0495630_0226860 Ga0495630_0226860_186_989 265
505 3300046519 Ga0495632_0120244 Ga0495632_0120244_312_1115 265
506 3300046690 Ga0495624_0057406 Ga0495624_0057406_851_1654 265
507 3300047321 Ga0495676_0037805 Ga0495676_0037805_2247_3050 265
508 3300047673 Ga0495593_0025281 Ga0495593_0025281_2345_3148 265
509 3300048089 Ga0495614_0127394 Ga0495614_0127394_239_1042 265
510 3300048917 Ga0496114_0226734 Ga0496114_0226734_661_1464 265
511 3300053093 Ga0500651_0067977 Ga0500651_0067977_1026_1829 265
512 3300053098 Ga0500650_0101848 Ga0500650_0101848_343_1146 265
513 3300053121 Ga0500607_071221 Ga0500607_071221_204_1007 265
514 3300053131 Ga0500652_074936 Ga0500652_074936_304_1149 265
515 3300053136 Ga0500559_0000041 Ga0500559_0000041_93265_94068 265
516 3300053156 Ga0500622_0003555 Ga0500622_0003555_6534_7337 265
517 3300005328 Ga0070676_10236586 Ga0070676_102365862 266
518 3300005331 Ga0070670_100003540 Ga0070670_1000035407 266
519 3300005353 Ga0070669_100009428 Ga0070669_1000094283 266
520 3300005355 Ga0070671_100049480 Ga0070671_1000494803 266
521 3300005356 Ga0070674_100043910 Ga0070674_1000439103 266
522 3300005364 Ga0070673_100003906 Ga0070673_1000039063 266
523 3300005459 Ga0068867_100112111 Ga0068867_1001121112 266
524 3300005543 Ga0070672_100002849 Ga0070672_1000028495 266
525 3300005548 Ga0070665_100771222 Ga0070665_1007712221 266
526 3300005564 Ga0070664_100307214 Ga0070664_1003072142 266
527 3300005578 Ga0068854_100120914 Ga0068854_1001209142 266
528 3300006358 Ga0068871_100482833 Ga0068871_1004828331 266
529 3300013308 Ga0157375_10273435 Ga0157375_102734352 266
530 3300014969 Ga0157376_10048419 Ga0157376_100484192 266
531 3300025907 Ga0207645_10306430 Ga0207645_103064302 266
532 3300025925 Ga0207650_10003576 Ga0207650_100035765 266
533 3300025926 Ga0207659_10002431 Ga0207659_100024316 266
534 3300025937 Ga0207669_10036389 Ga0207669_100363892 266
535 3300025937 Ga0207669_10044857 Ga0207669_100448573 266
536 3300025940 Ga0207691_10003752 Ga0207691_100037527 266
537 3300025945 Ga0207679_10290667 Ga0207679_102906672 266
538 3300026089 Ga0207648_10160206 Ga0207648_101602062 266
539 3300026095 Ga0207676_10585059 Ga0207676_105850591 266
540 3300026121 Ga0207683_10030377 Ga0207683_100303773 266
541 3300028379 Ga0268266_10195253 Ga0268266_101952532 266
542 3300031548 Ga0307408_100333935 Ga0307408_1003339352 266
543 3300031731 Ga0307405_10008662 Ga0307405_100086622 266
544 3300031824 Ga0307413_10152944 Ga0307413_101529442 266
545 3300031852 Ga0307410_10013807 Ga0307410_100138072 266
546 3300031903 Ga0307407_10034564 Ga0307407_100345641 266
547 3300031995 Ga0307409_100097537 Ga0307409_1000975372 266
548 3300032002 Ga0307416_100039700 Ga0307416_1000397002 266
549 3300032004 Ga0307414_10015531 Ga0307414_100155314 266
550 3300032005 Ga0307411_10017113 Ga0307411_100171134 266
551 3300003322 rootL2_10011839 rootL2_100118394 267
552 3300005334 Ga0068869_100103617 Ga0068869_1001036173 267
553 3300005338 Ga0068868_100064919 Ga0068868_1000649192 267
554 3300005445 Ga0070708_100276277 Ga0070708_1002762772 267
555 3300005456 Ga0070678_100272185 Ga0070678_1002721852 267
556 3300005459 Ga0068867_100047752 Ga0068867_1000477522 267
557 3300005467 Ga0070706_100003542 Ga0070706_1000035429 267
558 3300005518 Ga0070699_100164192 Ga0070699_1001641921 267
559 3300005548 Ga0070665_100006913 Ga0070665_1000069134 267
560 3300005617 Ga0068859_100091539 Ga0068859_1000915392 267
561 3300005618 Ga0068864_100010268 Ga0068864_1000102683 267
562 3300005841 Ga0068863_100054240 Ga0068863_1000542403 267
563 3300006178 Ga0075367_10050285 Ga0075367_100502852 267
564 3300006195 Ga0075366_10016865 Ga0075366_100168652 267
565 3300006353 Ga0075370_10121926 Ga0075370_101219262 267
566 3300006881 Ga0068865_100292811 Ga0068865_1002928112 267
567 3300006931 Ga0097620_100091538 Ga0097620_1000915382 267
568 3300009098 Ga0105245_10071927 Ga0105245_100719272 267
569 3300009177 Ga0105248_10531267 Ga0105248_105312671 267
570 3300014968 Ga0157379_10091558 Ga0157379_100915583 267
571 3300025910 Ga0207684_10021243 Ga0207684_100212434 267
572 3300025922 Ga0207646_10073512 Ga0207646_100735123 267
573 3300025931 Ga0207644_10027999 Ga0207644_100279992 267
574 3300025935 Ga0207709_10376947 Ga0207709_103769471 267
575 3300025938 Ga0207704_10487739 Ga0207704_104877391 267
576 3300025942 Ga0207689_10114295 Ga0207689_101142952 267
577 3300026088 Ga0207641_10187746 Ga0207641_101877463 267
578 3300026089 Ga0207648_10059758 Ga0207648_100597582 267
579 3300026121 Ga0207683_10238570 Ga0207683_102385702 267
580 3300028379 Ga0268266_10039553 Ga0268266_100395534 267
581 3300046512 Ga0495610_0035524 Ga0495610_0035524_111_980 267
582 3300046616 Ga0495668_0120190 Ga0495668_0120190_244_1059 267
583 3300050494 nmdc:mga06z11_252922_c1 nmdc:mga06z11_252922_c1_49_852 267

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

31

289

0.92

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

36

221

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9757 8 267
4fzw-assembly1.cif.gz_C crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9753 8 267
4fzw-assembly1.cif.gz_D crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9681 8 267
4fzw-assembly1.cif.gz_C crystal structure of the paaf-paag hydratase-isomerase complex from e.coli 0.9676 8 267
6sla-assembly2.cif.gz_FFF crystal structure of isomerase paag mutant - d136n with oxepin-coa 0.9672 8 267
ID Description Score Start End Superfamily
2ej5A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.979 6 209 3.90.226.10
4fzwD01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9785 8 207 3.90.226.10
af_P77467_205_262_1.10.12.10 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9676 214 267 1.10.12.10
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9669 7 63 3.30.300.220
2ej5A01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.964 6 209 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A2M8WYE0-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.9926 5 267 GO:0016853
AF-A0A257LKI2-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase (EC 4.2.1.17) 0.9894 5 267 GO:0004300
GO:0016853
AF-A0A382IFT0-F1-model_v4 Enoyl-CoA hydratase 0.9843 7 267 GO:0006635
GO:0010124
GO:0016829
AF-A0A2S5GP16-F1-model_v4 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase 0.983 6 267 GO:0016853
AF-A0A6J4SVT8-F1-model_v4 1,2-epoxyphenylacetyl-CoA isomerase (EC 5.3.3.18) 0.9826 6 267 GO:0010124
GO:0016853

Feature Viewer

pLDDT pTM Quality
95.91 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map