F466274

General Info

Members Datasets Scaffolds Average Seq Length
583 321 1166 425

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10031239|Ga0207645_100312393
Length 469
Sequence MNCPGTLARSRAAVLFFAIAAVSLAASCARSPPAGETVLKFWAMGREGEVVVQLLPEFERTHPGIRVDVQQLPWTAAHEKLLTAFAGDSTPDICQLGNTWIPEFVALGAIERLDRYVADSPVVDPADYFSGIWQTNIVGGALYGVPWYVDTRLLFYRRDLLAQAGYASPPASWPEWTRMMTAVKQRAGPDRYAILLPLNEFEPLLALALQQDEPLLRDDGRWGNFDSTGFRRALQFYVDAFRAGFAPASTGIDVSNVWNEFGRGHFAFYISGPWNIAEFKRRLPASVQGEWATAPLPGPSAPGASIAGGSSLVVFRASRSKAAAWQLIEYLARPDVQRRFHELTGDLPPRREPWRGAPLAGDVYARAFRDQLERVKPTPKVAEWERIANQMRLVLGTRLPGGSVYSGNAPMSPSPRSLASNGFAPGRAAGGATHRDPCTGRPGARGRSPRRCPGGRGRHRPARPRPTPR

Samples

Sample ID Description Type Environment
1 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
71 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
115 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
116 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
117 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
119 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
120 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
121 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
122 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
123 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
186 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
187 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
188 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
195 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
205 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
206 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
210 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
211 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
212 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
213 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
214 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
217 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
218 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
219 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
220 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
221 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
224 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
225 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
226 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
227 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
228 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
229 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
230 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
234 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
235 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
236 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
237 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
238 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
239 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
240 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
241 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
242 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
243 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
244 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
245 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
246 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
247 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
248 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
249 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
250 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
251 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
252 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
253 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
254 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
255 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
256 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
257 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
264 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
265 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
268 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
269 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
273 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
276 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
277 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
285 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
301 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
305 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
306 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
307 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
308 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
309 2593339238 Luteibacter sp. UNCMF366Tsu5.1 Isolate Unclassified
310 2593339239 Luteibacter sp. UNCMF331Sha3.1 Isolate Unclassified
311 2643221562 Rhodanobacter sp. Root561 Isolate Unclassified
312 2718218334 Luteibacter rhizovicinus LJ96 Isolate Rhizosphere
313 2734482264 Dyella sp. AD052 Isolate Unclassified
314 2738543009 Luteibacter sp. OK325 Isolate Unclassified
315 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
316 2842918807 Luteibacter sp. R-73110 Isolate Unclassified
317 2884338543 Luteibacter pinisoli MAH-14 Isolate Rhizosphere
318 2919085039 Luteibacter sp. 1214 Isolate Unclassified
319 2919404418 Luteibacter sp. 3190 Isolate Unclassified
320 2941471342 Luteibacter sp. 621 Isolate Unclassified
321 2953994433 Luteibacter sp. W1I16 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.43
Metatranscriptomes 0.34
Isolates 2.23

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.09
Nodule 0
Rhizoplane 3.09
Rhizosphere 87.99
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207645_10031239 3300025907 Bacteria 3428
2 JGI25156J39149_1000804 3300002705 Bacteria 16058
3 JGI25157J39369_1000758 3300002741 Bacteria 16801
4 rootH1_10024949 3300003316 Bacteria 3392
5 Ga0006562J51391_1155213 3300003578 Bacteria 2960
6 Ga0055529_1001578 3300003763 Bacteria 6341
7 Ga0065165_1000035 3300005262 Bacteria 214086
8 Ga0065707_10092475 3300005295 Bacteria 3765
9 Ga0070676_10000834 3300005328 Bacteria 15223
10 Ga0070683_100053443 3300005329 Bacteria 3743
11 Ga0070670_100016516 3300005331 Bacteria 6337
12 Ga0070677_10010256 3300005333 Bacteria 3200
13 Ga0070666_10024302 3300005335 Bacteria 3946
14 Ga0070666_10087496 3300005335 Bacteria 2135
15 Ga0070680_100025917 3300005336 Bacteria 4689
16 Ga0070680_100092986 3300005336 Bacteria 2498
17 Ga0068868_100002161 3300005338 Bacteria 13569
18 Ga0068868_100010326 3300005338 Bacteria 6753
19 Ga0068868_100054164 3300005338 Bacteria 3160
20 Ga0068868_100054921 3300005338 Bacteria 3141
21 Ga0068868_100158691 3300005338 Bacteria 1867
22 Ga0070660_100010603 3300005339 Bacteria 6514
23 Ga0070660_100011507 3300005339 Bacteria 6293
24 Ga0070660_100044739 3300005339 Bacteria 3387
25 Ga0070660_100059039 3300005339 Bacteria 2975
26 Ga0070689_100003752 3300005340 Bacteria 10169
27 Ga0070687_100043155 3300005343 Bacteria 2290
28 Ga0070661_100010429 3300005344 Bacteria 6461
29 Ga0070668_100054334 3300005347 Bacteria 3089
30 Ga0070669_100028904 3300005353 Bacteria 3994
31 Ga0070669_100116811 3300005353 Bacteria 2031
32 Ga0070675_100001895 3300005354 Bacteria 15437
33 Ga0070671_100003549 3300005355 Bacteria 12192
34 Ga0070671_100076925 3300005355 Bacteria 2788
35 Ga0070674_100001341 3300005356 Bacteria 12981
36 Ga0070674_100006487 3300005356 Bacteria 6831
37 Ga0070674_100027646 3300005356 Bacteria 3718
38 Ga0070673_100000908 3300005364 Bacteria 16726
39 Ga0070673_100020104 3300005364 Bacteria 4808
40 Ga0070673_100045845 3300005364 Bacteria 3393
41 Ga0070688_100002852 3300005365 Bacteria 8811
42 Ga0070659_100004965 3300005366 Bacteria 9518
43 Ga0070659_100006667 3300005366 Bacteria 8345
44 Ga0070659_100084219 3300005366 Bacteria 2542
45 Ga0070667_100006354 3300005367 Bacteria 9822
46 Ga0070667_100058740 3300005367 Bacteria 3252
47 Ga0070709_10021402 3300005434 Bacteria 3766
48 Ga0070709_10090602 3300005434 Bacteria 2016
49 Ga0070709_10103602 3300005434 Bacteria 1900
50 Ga0070714_100004155 3300005435 Bacteria 10885
51 Ga0070714_100018748 3300005435 Bacteria 5629
52 Ga0070713_100000424 3300005436 Bacteria 26974
53 Ga0070713_100001567 3300005436 Bacteria 14630
54 Ga0070713_100033938 3300005436 Bacteria 4093
55 Ga0070710_10001446 3300005437 Bacteria 11206
56 Ga0070710_10084119 3300005437 Bacteria 1864
57 Ga0070711_100000322 3300005439 Bacteria 24746
58 Ga0070711_100172119 3300005439 Bacteria 1651
59 Ga0070700_100048398 3300005441 Bacteria 2635
60 Ga0070708_100227820 3300005445 Bacteria 1749
61 Ga0070663_100010776 3300005455 Bacteria 5708
62 Ga0070678_100001549 3300005456 Bacteria 12287
63 Ga0070678_100003595 3300005456 Bacteria 8648
64 Ga0070678_100004916 3300005456 Bacteria 7646
65 Ga0068867_100000695 3300005459 Bacteria 22405
66 Ga0068867_100002745 3300005459 Bacteria 12407
67 Ga0070685_10001540 3300005466 Bacteria 12159
68 Ga0070706_100184596 3300005467 Bacteria 1948
69 Ga0070707_100216773 3300005468 Bacteria 1865
70 Ga0070698_100024723 3300005471 Bacteria 6265
71 Ga0070679_100003207 3300005530 Bacteria 14944
72 Ga0070679_100174135 3300005530 Bacteria 2124
73 Ga0070684_100113790 3300005535 Bacteria 2428
74 Ga0070697_100051862 3300005536 Bacteria 3333
75 Ga0068853_100012919 3300005539 Bacteria 6806
76 Ga0068853_100028355 3300005539 Bacteria 4709
77 Ga0068853_100259622 3300005539 Bacteria 1597
78 Ga0070672_100000486 3300005543 Bacteria 23097
79 Ga0070672_100014081 3300005543 Bacteria 5660
80 Ga0070672_100020144 3300005543 Bacteria 4860
81 Ga0070672_100022826 3300005543 Bacteria 4603
82 Ga0070672_100048637 3300005543 Bacteria 3296
83 Ga0070686_100076381 3300005544 Bacteria 2206
84 Ga0070695_100060619 3300005545 Bacteria 2452
85 Ga0070696_100101375 3300005546 Bacteria 2063
86 Ga0070693_100002225 3300005547 Bacteria 8908
87 Ga0070693_100023565 3300005547 Bacteria 3292
88 Ga0070665_100004014 3300005548 Bacteria 15511
89 Ga0070665_100008988 3300005548 Bacteria 10121
90 Ga0070665_100028180 3300005548 Bacteria 5656
91 Ga0070665_100079429 3300005548 Bacteria 3286
92 Ga0070665_100173933 3300005548 Bacteria 2154
93 Ga0068855_100033476 3300005563 Bacteria 6133
94 Ga0070664_100014682 3300005564 Bacteria 6395
95 Ga0070664_100034938 3300005564 Bacteria 4218
96 Ga0070664_100091720 3300005564 Bacteria 2630
97 Ga0068857_100042751 3300005577 Bacteria 4020
98 Ga0068857_100169802 3300005577 Bacteria 1982
99 Ga0068854_100202180 3300005578 Bacteria 1562
100 Ga0068856_100004143 3300005614 Bacteria 14484
101 Ga0068856_100052147 3300005614 Bacteria 4033
102 Ga0070702_100020492 3300005615 Bacteria 3465
103 Ga0068852_100001602 3300005616 Bacteria 15397
104 Ga0068852_100009962 3300005616 Bacteria 7072
105 Ga0068852_100016802 3300005616 Bacteria 5721
106 Ga0068852_100025722 3300005616 Bacteria 4773
107 Ga0068864_100000653 3300005618 Bacteria 28926
108 Ga0068864_100057734 3300005618 Bacteria 3353
109 Ga0068864_100229054 3300005618 Bacteria 1718
110 Ga0068866_10002515 3300005718 Bacteria 7551
111 Ga0068861_100000457 3300005719 Bacteria 23806
112 Ga0068861_100003776 3300005719 Bacteria 10114
113 Ga0068861_100023045 3300005719 Bacteria 4489
114 Ga0068851_10002365 3300005834 Bacteria 8292
115 Ga0068851_10010985 3300005834 Bacteria 4237
116 Ga0068851_10031119 3300005834 Bacteria 2649
117 Ga0068870_10005059 3300005840 Bacteria 5728
118 Ga0068870_10118225 3300005840 Bacteria 1523
119 Ga0068863_100006780 3300005841 Bacteria 11227
120 Ga0068863_100011674 3300005841 Bacteria 8497
121 Ga0068858_100001111 3300005842 Bacteria 27838
122 Ga0068860_100000685 3300005843 Bacteria 39158
123 Ga0068860_100158345 3300005843 Bacteria 2183
124 Ga0068862_100009443 3300005844 Bacteria 8069
125 Ga0068862_100014874 3300005844 Bacteria 6464
126 Ga0068862_100035748 3300005844 Bacteria 4209
127 Ga0081455_10089946 3300005937 Bacteria 2490
128 Ga0081539_10000009 3300005985 Bacteria 509286
129 Ga0070712_100002664 3300006175 Bacteria 11020
130 Ga0075366_10002997 3300006195 Bacteria 8804
131 Ga0075366_10022412 3300006195 Bacteria 3674
132 Ga0097621_100159608 3300006237 Bacteria 1938
133 Ga0068871_100006211 3300006358 Bacteria 8424
134 Ga0068871_100089930 3300006358 Bacteria 2556
135 Ga0075428_100002010 3300006844 Bacteria 21935
136 Ga0075428_100002995 3300006844 Bacteria 18423
137 Ga0075428_100006604 3300006844 Bacteria 12903
138 Ga0075428_100075755 3300006844 Bacteria 3674
139 Ga0075430_100000021 3300006846 Bacteria 83951
140 Ga0075430_100001872 3300006846 Bacteria 17221
141 Ga0075430_100003277 3300006846 Bacteria 13574
142 Ga0075430_100159794 3300006846 Unclassified 1876
143 Ga0075430_100288907 3300006846 Bacteria 1357
144 Ga0075431_100000940 3300006847 Bacteria 25704
145 Ga0075431_100005386 3300006847 Bacteria 12637
146 Ga0075431_100229405 3300006847 Bacteria 1892
147 Ga0075434_100003509 3300006871 Bacteria 14013
148 Ga0075434_100018031 3300006871 Bacteria 6811
149 Ga0075434_100048875 3300006871 Bacteria 4198
150 Ga0075434_100054015 3300006871 Bacteria 3990
151 Ga0075434_100184947 3300006871 Bacteria 2104
152 Ga0075429_100000421 3300006880 Bacteria 31589
153 Ga0075429_100000937 3300006880 Bacteria 23079
154 Ga0068865_100005636 3300006881 Bacteria 7601
155 Ga0068865_100028137 3300006881 Bacteria 3720
156 Ga0068865_100103622 3300006881 Bacteria 2087
157 Ga0075436_100010783 3300006914 Bacteria 6268
158 Ga0075435_100006759 3300007076 Bacteria 8136
159 Ga0075435_100039694 3300007076 Bacteria 3757
160 Ga0099794_10111174 3300007265 Bacteria 1373
161 Ga0105240_10016657 3300009093 Bacteria 9941
162 Ga0105240_10022022 3300009093 Bacteria 8463
163 Ga0105240_10269694 3300009093 Bacteria 1960
164 Ga0105245_10004933 3300009098 Bacteria 11737
165 Ga0105245_10009254 3300009098 Bacteria 8590
166 Ga0105245_10046663 3300009098 Bacteria 3871
167 Ga0105247_10001213 3300009101 Bacteria 19110
168 Ga0114129_10000407 3300009147 Bacteria 50629
169 Ga0114129_10000507 3300009147 Bacteria 47550
170 Ga0114129_10005622 3300009147 Bacteria 17735
171 Ga0114129_10009262 3300009147 Bacteria 14043
172 Ga0114129_10017735 3300009147 Bacteria 10137
173 Ga0114129_10020665 3300009147 Bacteria 9359
174 Ga0114129_10052521 3300009147 Bacteria 5720
175 Ga0114129_10146700 3300009147 Bacteria 3232
176 Ga0114129_10226055 3300009147 Bacteria 2522
177 Ga0105241_10001727 3300009174 Bacteria 16585
178 Ga0105242_10002787 3300009176 Bacteria 13687
179 Ga0105248_10005709 3300009177 Bacteria 13664
180 Ga0105237_10000194 3300009545 Bacteria 86471
181 Ga0105237_10004560 3300009545 Bacteria 15996
182 Ga0105238_10015480 3300009551 Bacteria 7719
183 Ga0105249_10059133 3300009553 Bacteria 3514
184 Ga0105239_10011302 3300010375 Bacteria 9960
185 Ga0157371_10072293 3300013102 Bacteria 2442
186 Ga0157370_10000114 3300013104 Bacteria 92643
187 Ga0157370_10006412 3300013104 Bacteria 12977
188 Ga0157370_10010631 3300013104 Bacteria 9686
189 Ga0157370_10023358 3300013104 Bacteria 6140
190 Ga0157370_10043044 3300013104 Bacteria 4348
191 Ga0157370_10064067 3300013104 Bacteria 3480
192 Ga0157369_10020865 3300013105 Bacteria 7324
193 Ga0157369_10026837 3300013105 Bacteria 6386
194 Ga0157369_10044615 3300013105 Bacteria 4824
195 Ga0157374_10003310 3300013296 Bacteria 13533
196 Ga0157374_10030390 3300013296 Bacteria 4904
197 Ga0157374_10344227 3300013296 Bacteria 1480
198 Ga0157378_10186055 3300013297 Bacteria 1956
199 Ga0157378_10248731 3300013297 Bacteria 1701
200 Ga0163162_10006095 3300013306 Bacteria 11672
201 Ga0163162_10007011 3300013306 Bacteria 10932
202 Ga0163162_10012123 3300013306 Bacteria 8412
203 Ga0157372_10111109 3300013307 Bacteria 3140
204 Ga0157372_10228936 3300013307 Bacteria 2155
205 Ga0157372_10376969 3300013307 Bacteria 1653
206 Ga0157375_10006843 3300013308 Bacteria 9934
207 Ga0157375_10059884 3300013308 Bacteria 3774
208 Ga0157375_10105056 3300013308 Bacteria 2914
209 Ga0157375_10160045 3300013308 Bacteria 2393
210 Ga0157375_10364561 3300013308 Bacteria 1611
211 Ga0163163_10000625 3300014325 Bacteria 30463
212 Ga0157380_10001539 3300014326 Bacteria 15145
213 Ga0157380_10010860 3300014326 Bacteria 6566
214 Ga0182008_10005776 3300014497 Bacteria 7003
215 Ga0157377_10008372 3300014745 Bacteria 5043
216 Ga0157379_10002712 3300014968 Bacteria 14939
217 Ga0157379_10023753 3300014968 Bacteria 5443
218 Ga0157379_10099146 3300014968 Bacteria 2615
219 Ga0157379_10236817 3300014968 Bacteria 1655
220 Ga0157376_10013435 3300014969 Bacteria 6109
221 Ga0157376_10018583 3300014969 Bacteria 5334
222 Ga0157376_10041705 3300014969 Bacteria 3760
223 Ga0157376_10053865 3300014969 Bacteria 3352
224 Ga0182006_1000036 3300015261 Bacteria 226098
225 Ga0182006_1000167 3300015261 Bacteria 69601
226 Ga0182007_10009250 3300015262 Bacteria 3990
227 Ga0182005_1000019 3300015265 Bacteria 296232
228 Ga0182005_1000260 3300015265 Bacteria 33405
229 Ga0182005_1002530 3300015265 Bacteria 6494
230 Ga0163161_10025133 3300017792 Bacteria 4213
231 Ga0163161_10025703 3300017792 Bacteria 4170
232 Ga0163161_10027554 3300017792 Bacteria 4032
233 Ga0163161_10027642 3300017792 Bacteria 4025
234 Ga0206353_11489041 3300020082 Bacteria 2213
235 Ga0209437_101533 3300025233 Bacteria 5427
236 Ga0209646_1001194 3300025246 Bacteria 7502
237 Ga0209026_1000127 3300025250 Bacteria 122147
238 Ga0209148_1000968 3300025254 Bacteria 18698
239 Ga0209759_1000810 3300025256 Bacteria 25105
240 Ga0209129_1000422 3300025258 Bacteria 32451
241 Ga0209455_1000226 3300025272 Bacteria 75997
242 Ga0209758_1013531 3300025297 Bacteria 4438
243 Ga0209256_1004651 3300025299 Bacteria 8448
244 Ga0207426_1017844 3300025302 Bacteria 2513
245 Ga0207697_10000964 3300025315 Bacteria 16191
246 Ga0207697_10067651 3300025315 Bacteria 1493
247 Ga0207656_10035385 3300025321 Bacteria 2091
248 Ga0207682_10000782 3300025893 Bacteria 14719
249 Ga0207682_10001163 3300025893 Bacteria 12207
250 Ga0207642_10004463 3300025899 Bacteria 4517
251 Ga0207710_10015849 3300025900 Bacteria 3188
252 Ga0207688_10008843 3300025901 Bacteria 5480
253 Ga0207680_10015861 3300025903 Bacteria 3942
254 Ga0207647_10000002 3300025904 Bacteria 400771
255 Ga0207647_10027897 3300025904 Bacteria 3676
256 Ga0207685_10008211 3300025905 Bacteria 2959
257 Ga0207699_10003409 3300025906 Bacteria 7580
258 Ga0207645_10000982 3300025907 Bacteria 23565
259 Ga0207643_10000251 3300025908 Bacteria 37540
260 Ga0207643_10078430 3300025908 Bacteria 1911
261 Ga0207643_10116846 3300025908 Bacteria 1576
262 Ga0207684_10020299 3300025910 Bacteria 5675
263 Ga0207684_10038569 3300025910 Bacteria 4054
264 Ga0207654_10042778 3300025911 Bacteria 2565
265 Ga0207707_10002784 3300025912 Bacteria 15597
266 Ga0207707_10046056 3300025912 Bacteria 3798
267 Ga0207695_10000721 3300025913 Bacteria 64249
268 Ga0207695_10043588 3300025913 Bacteria 4781
269 Ga0207695_10051121 3300025913 Bacteria 4342
270 Ga0207671_10000579 3300025914 Bacteria 48938
271 Ga0207693_10003029 3300025915 Bacteria 14523
272 Ga0207693_10006859 3300025915 Bacteria 9404
273 Ga0207663_10002525 3300025916 Bacteria 8804
274 Ga0207662_10048271 3300025918 Bacteria 2521
275 Ga0207657_10000428 3300025919 Bacteria 44668
276 Ga0207657_10005731 3300025919 Bacteria 12957
277 Ga0207657_10013585 3300025919 Bacteria 7987
278 Ga0207657_10038970 3300025919 Bacteria 4225
279 Ga0207657_10040119 3300025919 Bacteria 4151
280 Ga0207649_10004989 3300025920 Bacteria 7171
281 Ga0207646_10018372 3300025922 Bacteria 6523
282 Ga0207646_10172731 3300025922 Bacteria 1952
283 Ga0207681_10177456 3300025923 Bacteria 1620
284 Ga0207650_10002489 3300025925 Bacteria 12814
285 Ga0207687_10027808 3300025927 Bacteria 3796
286 Ga0207700_10000303 3300025928 Bacteria 29240
287 Ga0207700_10002576 3300025928 Bacteria 10415
288 Ga0207664_10022737 3300025929 Bacteria 4686
289 Ga0207664_10024283 3300025929 Bacteria 4554
290 Ga0207664_10039542 3300025929 Bacteria 3662
291 Ga0207644_10003377 3300025931 Bacteria 10303
292 Ga0207644_10004733 3300025931 Bacteria 8843
293 Ga0207706_10003902 3300025933 Bacteria 14154
294 Ga0207706_10139377 3300025933 Bacteria 2133
295 Ga0207686_10000574 3300025934 Bacteria 23161
296 Ga0207704_10002094 3300025938 Bacteria 8934
297 Ga0207665_10006539 3300025939 Bacteria 7729
298 Ga0207665_10031050 3300025939 Bacteria 3534
299 Ga0207691_10000040 3300025940 Bacteria 106561
300 Ga0207691_10015297 3300025940 Bacteria 7299
301 Ga0207691_10023824 3300025940 Bacteria 5761
302 Ga0207691_10038468 3300025940 Bacteria 4427
303 Ga0207691_10039565 3300025940 Bacteria 4362
304 Ga0207711_10000292 3300025941 Bacteria 53498
305 Ga0207711_10011444 3300025941 Bacteria 7376
306 Ga0207711_10011756 3300025941 Bacteria 7271
307 Ga0207689_10002070 3300025942 Bacteria 18932
308 Ga0207689_10049820 3300025942 Bacteria 3455
309 Ga0207689_10062768 3300025942 Bacteria 3056
310 Ga0207679_10031715 3300025945 Bacteria 3701
311 Ga0207679_10045615 3300025945 Bacteria 3171
312 Ga0207679_10127472 3300025945 Bacteria 2036
313 Ga0207667_10001633 3300025949 Bacteria 28242
314 Ga0207667_10086113 3300025949 Bacteria 3252
315 Ga0207651_10001671 3300025960 Bacteria 10193
316 Ga0207651_10014461 3300025960 Bacteria 4559
317 Ga0207668_10038689 3300025972 Bacteria 3204
318 Ga0207640_10055300 3300025981 Bacteria 2599
319 Ga0207658_10004640 3300025986 Bacteria 9525
320 Ga0207677_10000157 3300026023 Bacteria 53946
321 Ga0207703_10009573 3300026035 Bacteria 7608
322 Ga0207703_10011452 3300026035 Bacteria 6897
323 Ga0207703_10134714 3300026035 Bacteria 2137
324 Ga0207639_10033780 3300026041 Bacteria 3776
325 Ga0207678_10002787 3300026067 Bacteria 15850
326 Ga0207678_10003094 3300026067 Bacteria 15059
327 Ga0207678_10006003 3300026067 Bacteria 10808
328 Ga0207678_10036107 3300026067 Bacteria 4302
329 Ga0207678_10036854 3300026067 Bacteria 4257
330 Ga0207678_10039293 3300026067 Bacteria 4107
331 Ga0207678_10147671 3300026067 Bacteria 2007
332 Ga0207708_10000568 3300026075 Bacteria 28553
333 Ga0207702_10000070 3300026078 Bacteria 115440
334 Ga0207702_10100743 3300026078 Bacteria 2549
335 Ga0207702_10179684 3300026078 Bacteria 1948
336 Ga0207702_10289162 3300026078 Bacteria 1552
337 Ga0207641_10016827 3300026088 Bacteria 5988
338 Ga0207641_10021195 3300026088 Bacteria 5342
339 Ga0207641_10046684 3300026088 Bacteria 3651
340 Ga0207648_10001873 3300026089 Bacteria 23008
341 Ga0207648_10003734 3300026089 Bacteria 15928
342 Ga0207648_10003955 3300026089 Bacteria 15407
343 Ga0207648_10096410 3300026089 Bacteria 2588
344 Ga0207676_10000219 3300026095 Bacteria 49390
345 Ga0207676_10150614 3300026095 Bacteria 2003
346 Ga0207674_10001026 3300026116 Bacteria 36426
347 Ga0207674_10051579 3300026116 Bacteria 4198
348 Ga0207675_100002397 3300026118 Bacteria 18561
349 Ga0207675_100003034 3300026118 Bacteria 16463
350 Ga0207683_10000059 3300026121 Bacteria 83666
351 Ga0207683_10002700 3300026121 Bacteria 15497
352 Ga0207683_10011053 3300026121 Bacteria 7694
353 Ga0207698_10002813 3300026142 Bacteria 10406
354 Ga0207698_10003455 3300026142 Bacteria 9512
355 Ga0207698_10067117 3300026142 Bacteria 2827
356 Ga0209971_1001813 3300027682 Bacteria 5235
357 Ga0209998_10000570 3300027717 Bacteria 9954
358 Ga0209974_10002425 3300027876 Bacteria 6754
359 Ga0268266_10011697 3300028379 Bacteria 7614
360 Ga0268266_10012060 3300028379 Bacteria 7480
361 Ga0268266_10160974 3300028379 Bacteria 2030
362 Ga0268265_10010215 3300028380 Bacteria 6338
363 Ga0268265_10129195 3300028380 Bacteria 2096
364 Ga0268264_10007544 3300028381 Bacteria 9076
365 Ga0265331_10001077 3300031250 Bacteria 21159
366 Ga0265327_10000078 3300031251 Bacteria 207398
367 Ga0307509_10080362 3300031507 Bacteria 3372
368 Ga0307408_100065530 3300031548 Bacteria 2664
369 Ga0307408_100097434 3300031548 Bacteria 2234
370 Ga0316575_10005872 3300031665 Bacteria 4393
371 Ga0307406_10190394 3300031901 Bacteria 1501
372 Ga0307412_10002107 3300031911 Bacteria 11049
373 Ga0307416_100108806 3300032002 Bacteria 2436
374 Ga0373944_0045839 3300035089 Bacteria 1365
375 Ga0373923_0000444 3300035111 Bacteria 9782
376 Ga0373953_0006839 3300035117 Bacteria 3783
377 Ga0373956_0007248 3300035119 Bacteria 4464
378 Ga0373943_0002868 3300035170 Bacteria 7829
379 Ga0373943_0040825 3300035170 Bacteria 2241
380 Ga0373955_0010183 3300035172 Bacteria 4431
381 Ga0373955_0046885 3300035172 Bacteria 2338
382 Ga0373924_0005723 3300035410 Bacteria 4414
383 Ga0373927_0011692 3300035695 Bacteria 5842
384 Ga0373927_0018462 3300035695 Bacteria 4584
385 Ga0373927_0033832 3300035695 Bacteria 3326
386 Ga0373933_0010170 3300035724 Bacteria 5152
387 Ga0373947_0128193 3300035725 Bacteria 1617
388 Ga0373937_0005305 3300036401 Bacteria 11015
389 Ga0373937_0035437 3300036401 Bacteria 4542
390 Ga0373925_0020209 3300037068 Bacteria 4845
391 Ga0373925_0028170 3300037068 Bacteria 4115
392 Ga0395899_0003973 3300037312 Bacteria 11649
393 Ga0395899_0062813 3300037312 Bacteria 2734
394 Ga0395900_0000103 3300037418 Bacteria 153001
395 Ga0395900_0036996 3300037418 Bacteria 5032
396 Ga0395900_0042452 3300037418 Bacteria 4687
397 Ga0395900_0079515 3300037418 Bacteria 3369
398 Ga0395900_0260863 3300037418 Bacteria 1731
399 Ga0395900_0280004 3300037418 Bacteria 1660
400 Ga0395898_0015433 3300037466 Bacteria 7833
401 Ga0395898_0060754 3300037466 Bacteria 3672
402 Ga0395905_0104505 3300037471 Bacteria 2659
403 Ga0395901_0002116 3300038443 Bacteria 20357
404 Ga0395901_0008138 3300038443 Bacteria 10591
405 Ga0395901_0107679 3300038443 Bacteria 2926
406 Ga0395901_0134131 3300038443 Bacteria 2602
407 Ga0439436_0000002 3300041404 Bacteria 248787
408 Ga0450908_000001 3300042184 Bacteria 100479
409 Ga0495617_000036 3300046452 Bacteria 138126
410 Ga0495617_005211 3300046452 Bacteria 4636
411 Ga0495638_0000217 3300046460 Bacteria 79891
412 Ga0495651_0136850 3300046462 Bacteria 1781
413 Ga0495653_0154512 3300046463 Bacteria 1600
414 Ga0495580_0038286 3300046472 Bacteria 3435
415 Ga0495639_0000329 3300046475 Bacteria 22843
416 Ga0495662_0133440 3300046476 Bacteria 1221
417 Ga0495584_0004393 3300046491 Bacteria 7591
418 Ga0495585_0000134 3300046492 Bacteria 80529
419 Ga0495585_0000782 3300046492 Bacteria 28092
420 Ga0495594_0035120 3300046499 Bacteria 2730
421 Ga0495607_0000002 3300046501 Bacteria 414833
422 Ga0495607_0000039 3300046501 Bacteria 133875
423 Ga0495607_0016865 3300046501 Bacteria 4703
424 Ga0495607_0108867 3300046501 Bacteria 1472
425 Ga0495606_0000107 3300046507 Bacteria 140948
426 Ga0495606_0000310 3300046507 Bacteria 84133
427 Ga0495606_0006904 3300046507 Bacteria 10333
428 Ga0495608_0003542 3300046511 Bacteria 11186
429 Ga0495610_0001641 3300046512 Bacteria 19663
430 Ga0495610_0046969 3300046512 Bacteria 2126
431 Ga0495616_0000005 3300046513 Bacteria 260589
432 Ga0495620_0000248 3300046515 Bacteria 40332
433 Ga0495620_0002630 3300046515 Bacteria 10382
434 Ga0495628_0072782 3300046516 Bacteria 2678
435 Ga0495631_0000037 3300046518 Bacteria 81401
436 Ga0495631_0000041 3300046518 Bacteria 78909
437 Ga0495632_0000015 3300046519 Bacteria 237713
438 Ga0495632_0008649 3300046519 Bacteria 6216
439 Ga0495632_0009259 3300046519 Bacteria 5950
440 Ga0495632_0012090 3300046519 Bacteria 4994
441 Ga0495637_0008099 3300046520 Bacteria 5174
442 Ga0495648_0000157 3300046524 Bacteria 80874
443 Ga0495648_0068706 3300046524 Bacteria 2065
444 Ga0495665_0020726 3300046531 Bacteria 3530
445 Ga0495586_0019072 3300046535 Bacteria 3651
446 Ga0495609_0021937 3300046538 Bacteria 2944
447 Ga0495621_0002746 3300046539 Bacteria 4777
448 Ga0495645_0052938 3300046543 Bacteria 2952
449 Ga0495668_0001157 3300046616 Bacteria 26970
450 Ga0495611_0000002 3300046648 Bacteria 705677
451 Ga0495611_0000069 3300046648 Bacteria 71918
452 Ga0495625_0000002 3300046660 Bacteria 813323
453 Ga0495635_0005715 3300046663 Bacteria 8665
454 Ga0495661_0000656 3300046665 Bacteria 34794
455 Ga0495599_0003454 3300046678 Bacteria 9251
456 Ga0495623_0012144 3300046679 Bacteria 5580
457 Ga0495623_0040729 3300046679 Bacteria 2965
458 Ga0495613_0013763 3300046689 Bacteria 6002
459 Ga0495624_0097536 3300046690 Bacteria 1811
460 Ga0495670_0000535 3300046691 Bacteria 18056
461 Ga0495670_0002964 3300046691 Bacteria 8376
462 Ga0495671_0000113 3300046692 Bacteria 72284
463 Ga0495671_0014103 3300046692 Bacteria 4309
464 Ga0495649_0018672 3300046694 Bacteria 3898
465 Ga0495589_0000014 3300046794 Bacteria 246197
466 Ga0495660_0000066 3300046810 Bacteria 119694
467 Ga0495660_0000084 3300046810 Bacteria 100402
468 Ga0495581_0003404 3300047315 Bacteria 9137
469 Ga0495604_0154496 3300047317 Unclassified 1627
470 Ga0495674_0101509 3300047319 Bacteria 2447
471 Ga0495683_0000609 3300047323 Bacteria 26771
472 Ga0495679_000003 3300047446 Bacteria 787868
473 Ga0495673_0000043 3300047469 Bacteria 284984
474 Ga0495673_0000161 3300047469 Bacteria 115632
475 Ga0495673_0001054 3300047469 Bacteria 24270
476 Ga0495686_0000176 3300047472 Bacteria 121953
477 Ga0495686_0010290 3300047472 Bacteria 6662
478 Ga0496100_0023123 3300048903 Bacteria 3771
479 Ga0496100_0079902 3300048903 Bacteria 2205
480 Ga0496101_0000513 3300048904 Bacteria 24252
481 Ga0496101_0034966 3300048904 Bacteria 3552
482 Ga0496104_0006355 3300048907 Bacteria 10393
483 Ga0496104_0038022 3300048907 Bacteria 4501
484 Ga0496105_0003719 3300048908 Bacteria 11358
485 Ga0496105_0019093 3300048908 Bacteria 5525
486 Ga0496106_0001018 3300048909 Bacteria 20566
487 Ga0496106_0033666 3300048909 Bacteria 3824
488 Ga0496106_0198876 3300048909 Bacteria 1595
489 Ga0496108_0002995 3300048911 Bacteria 13570
490 Ga0496109_0001654 3300048912 Bacteria 18622
491 Ga0496109_0033272 3300048912 Bacteria 4637
492 Ga0496109_0184008 3300048912 Bacteria 1963
493 Ga0496110_0001296 3300048913 Bacteria 17952
494 Ga0496114_0008157 3300048917 Bacteria 8301
495 Ga0496114_0121487 3300048917 Bacteria 2247
496 Ga0496116_0065952 3300048919 Bacteria 2319
497 Ga0496117_0007356 3300048920 Bacteria 10779
498 Ga0496118_0000478 3300048921 Bacteria 66294
499 Ga0496118_0001292 3300048921 Bacteria 38147
500 Ga0496119_0015265 3300048922 Bacteria 5933
501 Ga0496121_0000075 3300048924 Bacteria 240437
502 Ga0496121_0001545 3300048924 Bacteria 38511
503 Ga0496121_0002001 3300048924 Bacteria 32372
504 Ga0496122_0013126 3300048925 Bacteria 8146
505 Ga0496122_0016385 3300048925 Bacteria 7016
506 Ga0496123_0004867 3300048926 Bacteria 13815
507 Ga0496123_0081618 3300048926 Bacteria 1964
508 Ga0496124_0001418 3300048927 Bacteria 35568
509 Ga0496124_0003645 3300048927 Bacteria 18680
510 Ga0496124_0131939 3300048927 Bacteria 1983
511 Ga0496125_0007636 3300048928 Bacteria 11468
512 Ga0495678_000044 3300049459 Bacteria 172592
513 Ga0495682_0000246 3300049460 Bacteria 43120
514 Ga0495682_0014892 3300049460 Bacteria 2946
515 Ga0501033_0005062 3300049570 Bacteria 10494
516 Ga0501036_0038797 3300049572 Bacteria 4032
517 Ga0501039_0137014 3300049575 Bacteria 1922
518 Ga0501040_0004516 3300049576 Bacteria 9027
519 Ga0501041_0008640 3300049577 Bacteria 6000
520 Ga0501041_0071184 3300049577 Bacteria 2135
521 Ga0501043_0052278 3300049579 Bacteria 3209
522 Ga0501067_0036120 3300049583 Bacteria 2744
523 Ga0501070_0003224 3300049586 Bacteria 14188
524 Ga0501072_0041431 3300049588 Bacteria 3617
525 Ga0501077_0124409 3300049593 Bacteria 1635
526 Ga0501035_0041935 3300049822 Bacteria 4130
527 Ga0501044_0006143 3300049823 Bacteria 13263
528 Ga0501044_0157650 3300049823 Bacteria 2248
529 nmdc:mga0k408_2405_c1 3300050493 Bacteria 9958
530 nmdc:mga0k408_274_c1 3300050493 Bacteria 28068
531 nmdc:mga05p37_109768_c1 3300050507 Bacteria 3394
532 nmdc:mga05p37_115553_c1 3300050507 Bacteria 3299
533 nmdc:mga05p37_119559_c1 3300050507 Bacteria 3237
534 nmdc:mga05p37_2197_c1 3300050507 Bacteria 22724
535 nmdc:mga05p37_3573_c1 3300050507 Bacteria 18167
536 nmdc:mga05p37_40384_c1 3300050507 Bacteria 5730
537 nmdc:mga05p37_81589_c1 3300050507 Bacteria 3984
538 nmdc:mga05p37_89279_c1 3300050507 Bacteria 3798
539 nmdc:mga09592_1452_c1 3300050508 Bacteria 19039
540 nmdc:mga09592_21487_c1 3300050508 Bacteria 5317
541 nmdc:mga09592_29243_c1 3300050508 Bacteria 4582
542 nmdc:mga09592_38713_c1 3300050508 Bacteria 4003
543 nmdc:mga09592_399_c1 3300050508 Bacteria 31825
544 nmdc:mga0qj67_10385_c1 3300050509 Bacteria 6957
545 nmdc:mga0qj67_117577_c1 3300050509 Bacteria 2149
546 nmdc:mga0qj67_2242_c1 3300050509 Bacteria 13741
547 nmdc:mga0qj67_485_c1 3300050509 Bacteria 27197
548 nmdc:mga06r32_130284_c1 3300050510 Bacteria 2487
549 nmdc:mga06r32_235813_c1 3300050510 Bacteria 1817
550 nmdc:mga06r32_2463_c1 3300050510 Bacteria 16560
551 nmdc:mga06r32_2604_c1 3300050510 Bacteria 16104
552 nmdc:mga06r32_3171_c1 3300050510 Bacteria 14728
553 nmdc:mga06r32_3884_c2 3300050510 Bacteria 8594
554 nmdc:mga08y16_233199_c1 3300050511 Bacteria 1903
555 nmdc:mga08y16_38334_c1 3300050511 Bacteria 5033
556 nmdc:mga0n895_29929_c1 3300050512 Bacteria 5198
557 nmdc:mga0n895_334_c1 3300050512 Bacteria 31435
558 nmdc:mga0rr50_19393_c1 3300050513 Bacteria 4590
559 nmdc:mga08x19_12016_c1 3300050514 Bacteria 5211
560 nmdc:mga0a205_19098_c1 3300050515 Bacteria 6460
561 nmdc:mga0a205_8274_c1 3300050515 Bacteria 9459
562 nmdc:mga0sz30_48612_c1 3300050516 Bacteria 1795
563 Ga0495601_0139431 3300053077 Unclassified 1581
564 Ga0495595_0063922 3300053084 Bacteria 1729
565 Ga0495619_0050826 3300053085 Bacteria 2738
566 Ga0500643_000024 3300053087 Bacteria 265935
567 Ga0500555_001011 3300053103 Bacteria 9594
568 Ga0500633_0000446 3300053160 Bacteria 6523
569 Ga0500645_001879 3300053730 Bacteria 10035
570 Ga0530510_0003413 3300061734 Bacteria 10927
571 2595448619 2593339238 Bacteria 4182970
572 2595450874 2593339239 Bacteria 4124669
573 2643828475 2643221562 Bacteria 4048635
574 2721029547 2718218334 Bacteria 4765486
575 2735834854 2734482264 Unclassified 5014763
576 2739228008 2738543009 Bacteria 4944499
577 2842915970 2842914999 Bacteria 4419378
578 2842921244 2842918807 Bacteria 4289178
579 2884342731 2884338543 Bacteria 4610696
580 2919088682 2919085039 Bacteria 4532964
581 2919407297 2919404418 Bacteria 4232372
582 2941474170 2941471342 Bacteria 5018624
583 2953996486 2953994433 Bacteria 4303959
584 Ga0207645_10031239
585 JGI25156J39149_1000804
586 JGI25157J39369_1000758
587 rootH1_10024949
588 Ga0006562J51391_1155213
589 Ga0055529_1001578
590 Ga0065165_1000035
591 Ga0065707_10092475
592 Ga0070676_10000834
593 Ga0070683_100053443
594 Ga0070670_100016516
595 Ga0070677_10010256
596 Ga0070666_10024302
597 Ga0070666_10087496
598 Ga0070680_100025917
599 Ga0070680_100092986
600 Ga0068868_100002161
601 Ga0068868_100010326
602 Ga0068868_100054164
603 Ga0068868_100054921
604 Ga0068868_100158691
605 Ga0070660_100010603
606 Ga0070660_100011507
607 Ga0070660_100044739
608 Ga0070660_100059039
609 Ga0070689_100003752
610 Ga0070687_100043155
611 Ga0070661_100010429
612 Ga0070668_100054334
613 Ga0070669_100028904
614 Ga0070669_100116811
615 Ga0070675_100001895
616 Ga0070671_100003549
617 Ga0070671_100076925
618 Ga0070674_100001341
619 Ga0070674_100006487
620 Ga0070674_100027646
621 Ga0070673_100000908
622 Ga0070673_100020104
623 Ga0070673_100045845
624 Ga0070688_100002852
625 Ga0070659_100004965
626 Ga0070659_100006667
627 Ga0070659_100084219
628 Ga0070667_100006354
629 Ga0070667_100058740
630 Ga0070709_10021402
631 Ga0070709_10090602
632 Ga0070709_10103602
633 Ga0070714_100004155
634 Ga0070714_100018748
635 Ga0070713_100000424
636 Ga0070713_100001567
637 Ga0070713_100033938
638 Ga0070710_10001446
639 Ga0070710_10084119
640 Ga0070711_100000322
641 Ga0070711_100172119
642 Ga0070700_100048398
643 Ga0070708_100227820
644 Ga0070663_100010776
645 Ga0070678_100001549
646 Ga0070678_100003595
647 Ga0070678_100004916
648 Ga0068867_100000695
649 Ga0068867_100002745
650 Ga0070685_10001540
651 Ga0070706_100184596
652 Ga0070707_100216773
653 Ga0070698_100024723
654 Ga0070679_100003207
655 Ga0070679_100174135
656 Ga0070684_100113790
657 Ga0070697_100051862
658 Ga0068853_100012919
659 Ga0068853_100028355
660 Ga0068853_100259622
661 Ga0070672_100000486
662 Ga0070672_100014081
663 Ga0070672_100020144
664 Ga0070672_100022826
665 Ga0070672_100048637
666 Ga0070686_100076381
667 Ga0070695_100060619
668 Ga0070696_100101375
669 Ga0070693_100002225
670 Ga0070693_100023565
671 Ga0070665_100004014
672 Ga0070665_100008988
673 Ga0070665_100028180
674 Ga0070665_100079429
675 Ga0070665_100173933
676 Ga0068855_100033476
677 Ga0070664_100014682
678 Ga0070664_100034938
679 Ga0070664_100091720
680 Ga0068857_100042751
681 Ga0068857_100169802
682 Ga0068854_100202180
683 Ga0068856_100004143
684 Ga0068856_100052147
685 Ga0070702_100020492
686 Ga0068852_100001602
687 Ga0068852_100009962
688 Ga0068852_100016802
689 Ga0068852_100025722
690 Ga0068864_100000653
691 Ga0068864_100057734
692 Ga0068864_100229054
693 Ga0068866_10002515
694 Ga0068861_100000457
695 Ga0068861_100003776
696 Ga0068861_100023045
697 Ga0068851_10002365
698 Ga0068851_10010985
699 Ga0068851_10031119
700 Ga0068870_10005059
701 Ga0068870_10118225
702 Ga0068863_100006780
703 Ga0068863_100011674
704 Ga0068858_100001111
705 Ga0068860_100000685
706 Ga0068860_100158345
707 Ga0068862_100009443
708 Ga0068862_100014874
709 Ga0068862_100035748
710 Ga0081455_10089946
711 Ga0081539_10000009
712 Ga0070712_100002664
713 Ga0075366_10002997
714 Ga0075366_10022412
715 Ga0097621_100159608
716 Ga0068871_100006211
717 Ga0068871_100089930
718 Ga0075428_100002010
719 Ga0075428_100002995
720 Ga0075428_100006604
721 Ga0075428_100075755
722 Ga0075430_100000021
723 Ga0075430_100001872
724 Ga0075430_100003277
725 Ga0075430_100159794
726 Ga0075430_100288907
727 Ga0075431_100000940
728 Ga0075431_100005386
729 Ga0075431_100229405
730 Ga0075434_100003509
731 Ga0075434_100018031
732 Ga0075434_100048875
733 Ga0075434_100054015
734 Ga0075434_100184947
735 Ga0075429_100000421
736 Ga0075429_100000937
737 Ga0068865_100005636
738 Ga0068865_100028137
739 Ga0068865_100103622
740 Ga0075436_100010783
741 Ga0075435_100006759
742 Ga0075435_100039694
743 Ga0099794_10111174
744 Ga0105240_10016657
745 Ga0105240_10022022
746 Ga0105240_10269694
747 Ga0105245_10004933
748 Ga0105245_10009254
749 Ga0105245_10046663
750 Ga0105247_10001213
751 Ga0114129_10000407
752 Ga0114129_10000507
753 Ga0114129_10005622
754 Ga0114129_10009262
755 Ga0114129_10017735
756 Ga0114129_10020665
757 Ga0114129_10052521
758 Ga0114129_10146700
759 Ga0114129_10226055
760 Ga0105241_10001727
761 Ga0105242_10002787
762 Ga0105248_10005709
763 Ga0105237_10000194
764 Ga0105237_10004560
765 Ga0105238_10015480
766 Ga0105249_10059133
767 Ga0105239_10011302
768 Ga0157371_10072293
769 Ga0157370_10000114
770 Ga0157370_10006412
771 Ga0157370_10010631
772 Ga0157370_10023358
773 Ga0157370_10043044
774 Ga0157370_10064067
775 Ga0157369_10020865
776 Ga0157369_10026837
777 Ga0157369_10044615
778 Ga0157374_10003310
779 Ga0157374_10030390
780 Ga0157374_10344227
781 Ga0157378_10186055
782 Ga0157378_10248731
783 Ga0163162_10006095
784 Ga0163162_10007011
785 Ga0163162_10012123
786 Ga0157372_10111109
787 Ga0157372_10228936
788 Ga0157372_10376969
789 Ga0157375_10006843
790 Ga0157375_10059884
791 Ga0157375_10105056
792 Ga0157375_10160045
793 Ga0157375_10364561
794 Ga0163163_10000625
795 Ga0157380_10001539
796 Ga0157380_10010860
797 Ga0182008_10005776
798 Ga0157377_10008372
799 Ga0157379_10002712
800 Ga0157379_10023753
801 Ga0157379_10099146
802 Ga0157379_10236817
803 Ga0157376_10013435
804 Ga0157376_10018583
805 Ga0157376_10041705
806 Ga0157376_10053865
807 Ga0182006_1000036
808 Ga0182006_1000167
809 Ga0182007_10009250
810 Ga0182005_1000019
811 Ga0182005_1000260
812 Ga0182005_1002530
813 Ga0163161_10025133
814 Ga0163161_10025703
815 Ga0163161_10027554
816 Ga0163161_10027642
817 Ga0206353_11489041
818 Ga0209437_101533
819 Ga0209646_1001194
820 Ga0209026_1000127
821 Ga0209148_1000968
822 Ga0209759_1000810
823 Ga0209129_1000422
824 Ga0209455_1000226
825 Ga0209758_1013531
826 Ga0209256_1004651
827 Ga0207426_1017844
828 Ga0207697_10000964
829 Ga0207697_10067651
830 Ga0207656_10035385
831 Ga0207682_10000782
832 Ga0207682_10001163
833 Ga0207642_10004463
834 Ga0207710_10015849
835 Ga0207688_10008843
836 Ga0207680_10015861
837 Ga0207647_10000002
838 Ga0207647_10027897
839 Ga0207685_10008211
840 Ga0207699_10003409
841 Ga0207645_10000982
842 Ga0207643_10000251
843 Ga0207643_10078430
844 Ga0207643_10116846
845 Ga0207684_10020299
846 Ga0207684_10038569
847 Ga0207654_10042778
848 Ga0207707_10002784
849 Ga0207707_10046056
850 Ga0207695_10000721
851 Ga0207695_10043588
852 Ga0207695_10051121
853 Ga0207671_10000579
854 Ga0207693_10003029
855 Ga0207693_10006859
856 Ga0207663_10002525
857 Ga0207662_10048271
858 Ga0207657_10000428
859 Ga0207657_10005731
860 Ga0207657_10013585
861 Ga0207657_10038970
862 Ga0207657_10040119
863 Ga0207649_10004989
864 Ga0207646_10018372
865 Ga0207646_10172731
866 Ga0207681_10177456
867 Ga0207650_10002489
868 Ga0207687_10027808
869 Ga0207700_10000303
870 Ga0207700_10002576
871 Ga0207664_10022737
872 Ga0207664_10024283
873 Ga0207664_10039542
874 Ga0207644_10003377
875 Ga0207644_10004733
876 Ga0207706_10003902
877 Ga0207706_10139377
878 Ga0207686_10000574
879 Ga0207704_10002094
880 Ga0207665_10006539
881 Ga0207665_10031050
882 Ga0207691_10000040
883 Ga0207691_10015297
884 Ga0207691_10023824
885 Ga0207691_10038468
886 Ga0207691_10039565
887 Ga0207711_10000292
888 Ga0207711_10011444
889 Ga0207711_10011756
890 Ga0207689_10002070
891 Ga0207689_10049820
892 Ga0207689_10062768
893 Ga0207679_10031715
894 Ga0207679_10045615
895 Ga0207679_10127472
896 Ga0207667_10001633
897 Ga0207667_10086113
898 Ga0207651_10001671
899 Ga0207651_10014461
900 Ga0207668_10038689
901 Ga0207640_10055300
902 Ga0207658_10004640
903 Ga0207677_10000157
904 Ga0207703_10009573
905 Ga0207703_10011452
906 Ga0207703_10134714
907 Ga0207639_10033780
908 Ga0207678_10002787
909 Ga0207678_10003094
910 Ga0207678_10006003
911 Ga0207678_10036107
912 Ga0207678_10036854
913 Ga0207678_10039293
914 Ga0207678_10147671
915 Ga0207708_10000568
916 Ga0207702_10000070
917 Ga0207702_10100743
918 Ga0207702_10179684
919 Ga0207702_10289162
920 Ga0207641_10016827
921 Ga0207641_10021195
922 Ga0207641_10046684
923 Ga0207648_10001873
924 Ga0207648_10003734
925 Ga0207648_10003955
926 Ga0207648_10096410
927 Ga0207676_10000219
928 Ga0207676_10150614
929 Ga0207674_10001026
930 Ga0207674_10051579
931 Ga0207675_100002397
932 Ga0207675_100003034
933 Ga0207683_10000059
934 Ga0207683_10002700
935 Ga0207683_10011053
936 Ga0207698_10002813
937 Ga0207698_10003455
938 Ga0207698_10067117
939 Ga0209971_1001813
940 Ga0209998_10000570
941 Ga0209974_10002425
942 Ga0268266_10011697
943 Ga0268266_10012060
944 Ga0268266_10160974
945 Ga0268265_10010215
946 Ga0268265_10129195
947 Ga0268264_10007544
948 Ga0265331_10001077
949 Ga0265327_10000078
950 Ga0307509_10080362
951 Ga0307408_100065530
952 Ga0307408_100097434
953 Ga0316575_10005872
954 Ga0307406_10190394
955 Ga0307412_10002107
956 Ga0307416_100108806
957 Ga0373944_0045839
958 Ga0373923_0000444
959 Ga0373953_0006839
960 Ga0373956_0007248
961 Ga0373943_0002868
962 Ga0373943_0040825
963 Ga0373955_0010183
964 Ga0373955_0046885
965 Ga0373924_0005723
966 Ga0373927_0011692
967 Ga0373927_0018462
968 Ga0373927_0033832
969 Ga0373933_0010170
970 Ga0373947_0128193
971 Ga0373937_0005305
972 Ga0373937_0035437
973 Ga0373925_0020209
974 Ga0373925_0028170
975 Ga0395899_0003973
976 Ga0395899_0062813
977 Ga0395900_0000103
978 Ga0395900_0036996
979 Ga0395900_0042452
980 Ga0395900_0079515
981 Ga0395900_0260863
982 Ga0395900_0280004
983 Ga0395898_0015433
984 Ga0395898_0060754
985 Ga0395905_0104505
986 Ga0395901_0002116
987 Ga0395901_0008138
988 Ga0395901_0107679
989 Ga0395901_0134131
990 Ga0439436_0000002
991 Ga0450908_000001
992 Ga0495617_000036
993 Ga0495617_005211
994 Ga0495638_0000217
995 Ga0495651_0136850
996 Ga0495653_0154512
997 Ga0495580_0038286
998 Ga0495639_0000329
999 Ga0495662_0133440
1000 Ga0495584_0004393
1001 Ga0495585_0000134
1002 Ga0495585_0000782
1003 Ga0495594_0035120
1004 Ga0495607_0000002
1005 Ga0495607_0000039
1006 Ga0495607_0016865
1007 Ga0495607_0108867
1008 Ga0495606_0000107
1009 Ga0495606_0000310
1010 Ga0495606_0006904
1011 Ga0495608_0003542
1012 Ga0495610_0001641
1013 Ga0495610_0046969
1014 Ga0495616_0000005
1015 Ga0495620_0000248
1016 Ga0495620_0002630
1017 Ga0495628_0072782
1018 Ga0495631_0000037
1019 Ga0495631_0000041
1020 Ga0495632_0000015
1021 Ga0495632_0008649
1022 Ga0495632_0009259
1023 Ga0495632_0012090
1024 Ga0495637_0008099
1025 Ga0495648_0000157
1026 Ga0495648_0068706
1027 Ga0495665_0020726
1028 Ga0495586_0019072
1029 Ga0495609_0021937
1030 Ga0495621_0002746
1031 Ga0495645_0052938
1032 Ga0495668_0001157
1033 Ga0495611_0000002
1034 Ga0495611_0000069
1035 Ga0495625_0000002
1036 Ga0495635_0005715
1037 Ga0495661_0000656
1038 Ga0495599_0003454
1039 Ga0495623_0012144
1040 Ga0495623_0040729
1041 Ga0495613_0013763
1042 Ga0495624_0097536
1043 Ga0495670_0000535
1044 Ga0495670_0002964
1045 Ga0495671_0000113
1046 Ga0495671_0014103
1047 Ga0495649_0018672
1048 Ga0495589_0000014
1049 Ga0495660_0000066
1050 Ga0495660_0000084
1051 Ga0495581_0003404
1052 Ga0495604_0154496
1053 Ga0495674_0101509
1054 Ga0495683_0000609
1055 Ga0495679_000003
1056 Ga0495673_0000043
1057 Ga0495673_0000161
1058 Ga0495673_0001054
1059 Ga0495686_0000176
1060 Ga0495686_0010290
1061 Ga0496100_0023123
1062 Ga0496100_0079902
1063 Ga0496101_0000513
1064 Ga0496101_0034966
1065 Ga0496104_0006355
1066 Ga0496104_0038022
1067 Ga0496105_0003719
1068 Ga0496105_0019093
1069 Ga0496106_0001018
1070 Ga0496106_0033666
1071 Ga0496106_0198876
1072 Ga0496108_0002995
1073 Ga0496109_0001654
1074 Ga0496109_0033272
1075 Ga0496109_0184008
1076 Ga0496110_0001296
1077 Ga0496114_0008157
1078 Ga0496114_0121487
1079 Ga0496116_0065952
1080 Ga0496117_0007356
1081 Ga0496118_0000478
1082 Ga0496118_0001292
1083 Ga0496119_0015265
1084 Ga0496121_0000075
1085 Ga0496121_0001545
1086 Ga0496121_0002001
1087 Ga0496122_0013126
1088 Ga0496122_0016385
1089 Ga0496123_0004867
1090 Ga0496123_0081618
1091 Ga0496124_0001418
1092 Ga0496124_0003645
1093 Ga0496124_0131939
1094 Ga0496125_0007636
1095 Ga0495678_000044
1096 Ga0495682_0000246
1097 Ga0495682_0014892
1098 Ga0501033_0005062
1099 Ga0501036_0038797
1100 Ga0501039_0137014
1101 Ga0501040_0004516
1102 Ga0501041_0008640
1103 Ga0501041_0071184
1104 Ga0501043_0052278
1105 Ga0501067_0036120
1106 Ga0501070_0003224
1107 Ga0501072_0041431
1108 Ga0501077_0124409
1109 Ga0501035_0041935
1110 Ga0501044_0006143
1111 Ga0501044_0157650
1112 nmdc:mga0k408_2405_c1
1113 nmdc:mga0k408_274_c1
1114 nmdc:mga05p37_109768_c1
1115 nmdc:mga05p37_115553_c1
1116 nmdc:mga05p37_119559_c1
1117 nmdc:mga05p37_2197_c1
1118 nmdc:mga05p37_3573_c1
1119 nmdc:mga05p37_40384_c1
1120 nmdc:mga05p37_81589_c1
1121 nmdc:mga05p37_89279_c1
1122 nmdc:mga09592_1452_c1
1123 nmdc:mga09592_21487_c1
1124 nmdc:mga09592_29243_c1
1125 nmdc:mga09592_38713_c1
1126 nmdc:mga09592_399_c1
1127 nmdc:mga0qj67_10385_c1
1128 nmdc:mga0qj67_117577_c1
1129 nmdc:mga0qj67_2242_c1
1130 nmdc:mga0qj67_485_c1
1131 nmdc:mga06r32_130284_c1
1132 nmdc:mga06r32_235813_c1
1133 nmdc:mga06r32_2463_c1
1134 nmdc:mga06r32_2604_c1
1135 nmdc:mga06r32_3171_c1
1136 nmdc:mga06r32_3884_c2
1137 nmdc:mga08y16_233199_c1
1138 nmdc:mga08y16_38334_c1
1139 nmdc:mga0n895_29929_c1
1140 nmdc:mga0n895_334_c1
1141 nmdc:mga0rr50_19393_c1
1142 nmdc:mga08x19_12016_c1
1143 nmdc:mga0a205_19098_c1
1144 nmdc:mga0a205_8274_c1
1145 nmdc:mga0sz30_48612_c1
1146 Ga0495601_0139431
1147 Ga0495595_0063922
1148 Ga0495619_0050826
1149 Ga0500643_000024
1150 Ga0500555_001011
1151 Ga0500633_0000446
1152 Ga0500645_001879
1153 Ga0530510_0003413
1154 2595448619
1155 2595450874
1156 2643828475
1157 2721029547
1158 2735834854
1159 2739228008
1160 2842915970
1161 2842921244
1162 2884342731
1163 2919088682
1164 2919407297
1165 2941474170
1166 2953996486

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01547

SBP_bac_1

Bacterial extracellular solute-binding protein

44

338

0.88

PF13416

SBP_bac_8

Bacterial extracellular solute-binding protein

53

353

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3uor-assembly2.cif.gz_B the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri 0.9722 32 421
3uor-assembly2.cif.gz_B the structure of the sugar-binding protein male from the phytopathogen xanthomonas citri 0.9577 32 421
5yse-assembly1.cif.gz_A crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose 0.9177 31 415
5yse-assembly1.cif.gz_A crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotetraose 0.8999 31 415
7c6x-assembly7.cif.gz_G crystal structure of beta-glycosides-binding protein (w41a) of abc transporter in an open state (form i) 0.8861 32 414
ID Description Score Start End Superfamily
3uorB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9806 32 372 3.40.190.10
3uorB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9704 32 372 3.40.190.10
3uorB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.96 147 421 3.40.190.10
3uorB02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.937 147 421 3.40.190.10
5ysdB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9305 30 372 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A5B9DW52-F1-model_v4 Extracellular solute-binding protein 0.9716 21 427
AF-A0A2M7XSQ7-F1-model_v4 ABC transporter substrate-binding protein 0.9626 27 422 GO:0015768
GO:0042956
GO:0055052
GO:1901982
AF-A0A3D8VEB8-F1-model_v4 Extracellular solute-binding protein 0.9557 39 414 GO:0015768
GO:0030313
GO:0042956
GO:0055052
GO:1901982
AF-A0A0Q4L0C0-F1-model_v4 ABC transporter substrate-binding protein 0.9537 41 423 GO:0042597
AF-A0A8B0U4D7-F1-model_v4 deleted 0.9532 20 425

Map