F466199

General Info

Members Datasets Scaffolds Average Seq Length
582 332 1164 221

Family's Representative Sequence

Representative Sequence 3300044693|Ga0466961_0000785|Ga0466961_0000785_18650_19543
Length 260
Sequence VSGGDIAEPEAGGEDAGAANRLPGVDLNAGDVVDLGSGGVSPDRHAYYVTGRRIVLWRHGQTEWNMAGRLQGQTDVPLDAVGREQAQTMARLLAALRPSAIVSSDLSRAADTAQALADIVKLEVTLDEGLRETYVGTWQGLTDAEIQERFPEEYAAWRKDHYHQRRGGGEIESEVADRAVAAIERALKLVPDRGTLVVVTHGGTARVTIARLLGLPEQSTGVLGGLSNCCWSVLGEGHRGWRLLEHNAGSLPEPVFGDDQ

Samples

Sample ID Description Type Environment
1 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
9 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
10 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
11 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
12 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
13 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
14 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
15 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
16 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
17 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
18 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
19 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
20 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
21 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
22 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
23 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
24 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
25 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
26 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
27 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
28 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
29 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
30 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
31 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
32 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
33 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
34 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
35 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
36 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
37 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
38 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
39 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
40 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
41 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
42 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
43 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
44 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
45 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
51 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
52 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
53 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
54 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
56 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
57 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
58 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
59 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
60 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
61 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
62 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
63 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
64 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
65 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
66 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
67 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
68 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
69 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
70 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
71 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
72 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
73 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
74 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
75 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
76 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
77 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
78 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
79 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
80 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
81 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
82 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
83 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
84 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
85 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
86 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
87 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
88 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
89 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
90 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
91 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
92 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
93 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
94 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
95 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
96 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
97 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
98 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
99 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
100 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
101 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
102 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
103 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
104 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
105 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
106 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
107 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
108 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
109 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
110 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
111 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
112 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
113 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
114 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
115 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
116 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
117 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
118 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
119 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
123 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
124 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
125 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
126 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
127 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
128 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
129 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
130 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
131 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
132 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
133 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
134 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
135 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
136 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
137 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
138 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
139 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
140 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
141 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
142 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
143 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
144 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
145 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
146 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
147 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
148 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
149 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
150 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
151 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
152 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
153 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
154 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
155 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
156 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
157 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
158 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
159 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
160 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
163 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
164 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
169 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
170 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
171 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
172 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
173 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
174 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
175 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
185 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
210 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
236 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
239 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
242 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
243 3300053100 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere Metagenome Endosphere
244 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
245 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
246 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
247 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
248 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
249 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
250 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
251 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
252 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
253 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
254 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
255 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
256 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
257 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
258 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
259 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
260 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
261 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
262 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
263 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
264 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
265 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
266 2643221647 Streptomyces sp. Root369 Isolate Unclassified
267 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
268 2643221714 Streptomyces sp. Root264 Isolate Unclassified
269 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
270 2731639228 Motilibacter peucedani DSM 45328 Isolate Rhizosphere
271 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
272 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
273 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
274 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
275 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
276 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
277 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
278 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
279 2808606448 Streptomyces sp. 193411 Isolate Unclassified
280 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
281 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
282 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
283 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
284 2856741275 Microbispora triticiradicis NEAU-HRDPA2-9 Isolate Unclassified
285 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
286 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
287 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
288 2862574272 Streptomyces sp. AcE210 Isolate Nodule
289 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
290 2867369537 Streptomyces sp. Z26 Isolate Unclassified
291 2867428634 Streptomyces sp. RP5T Isolate Unclassified
292 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
293 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
294 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
295 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
296 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
297 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
298 2891562705 Microbispora tritici MT50 Isolate Unclassified
299 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
300 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
301 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
302 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
303 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
304 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
305 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
306 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
307 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
308 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
309 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
310 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
311 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
312 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
313 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
314 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
315 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
316 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
317 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
318 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
319 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
320 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
321 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
322 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
323 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
324 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
325 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
326 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
327 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
328 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
329 8053945823 Actinomadura terrae OS3-83 Isolate Rhizosphere
330 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
331 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified
332 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.71
Metatranscriptomes 3.09
Isolates 12.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.12
Nodule 0.69
Rhizoplane 2.06
Rhizosphere 80.07
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466961_0000785 3300044693 Bacteria 19929
2 rootH2_10025259 3300003320 Bacteria 11723
3 Ga0006562J51391_1108414 3300003578 Bacteria 3741
4 Ga0006562J51391_1108415 3300003578 Bacteria 2210
5 Ga0006562J51391_1196098 3300003578 Bacteria 1078
6 Ga0006562J51391_1196099 3300003578 Bacteria 930
7 Ga0070658_10034093 3300005327 Bacteria 4095
8 Ga0070658_10068535 3300005327 Bacteria 2900
9 Ga0070658_10200951 3300005327 Bacteria 1682
10 Ga0070660_100436731 3300005339 Bacteria 1085
11 Ga0070667_100270230 3300005367 Bacteria 1524
12 Ga0070713_100300151 3300005436 Bacteria 1478
13 Ga0070679_100286642 3300005530 Bacteria 1599
14 Ga0070679_100645037 3300005530 Bacteria 1002
15 Ga0070684_100543161 3300005535 Bacteria 1078
16 Ga0068853_100023713 3300005539 Bacteria 5141
17 Ga0070672_100378341 3300005543 Bacteria 1211
18 Ga0070696_100000319 3300005546 Bacteria 29290
19 Ga0068855_100013334 3300005563 Bacteria 9915
20 Ga0070664_100318074 3300005564 Bacteria 1410
21 Ga0068856_100248762 3300005614 Bacteria 1793
22 Ga0068856_100473757 3300005614 Bacteria 1273
23 Ga0081455_10001502 3300005937 Bacteria 28810
24 Ga0070717_10234663 3300006028 Bacteria 1616
25 Ga0070715_10007791 3300006163 Bacteria 3701
26 Ga0075428_100042771 3300006844 Bacteria 4981
27 Ga0075430_100140386 3300006846 Bacteria 2012
28 Ga0075429_100046409 3300006880 Bacteria 3780
29 Ga0075429_100265637 3300006880 Bacteria 1503
30 Ga0099826_10081918 3300006948 Bacteria 2007
31 Ga0105251_10017321 3300009011 Bacteria 3865
32 Ga0105240_10037865 3300009093 Bacteria 6194
33 Ga0105245_10266260 3300009098 Bacteria 1670
34 Ga0114129_10082591 3300009147 Bacteria 4464
35 Ga0105243_10353508 3300009148 Bacteria 1350
36 Ga0105239_10178520 3300010375 Bacteria 2375
37 Ga0105246_10030162 3300011119 Bacteria 3579
38 Ga0157369_10138863 3300013105 Bacteria 2572
39 Ga0157369_10438806 3300013105 Bacteria 1353
40 Ga0157372_10151647 3300013307 Bacteria 2675
41 Ga0157375_11021341 3300013308 Bacteria 966
42 Ga0182008_10002664 3300014497 Bacteria 11077
43 Ga0182007_10000257 3300015262 Bacteria 35765
44 Ga0206356_11506728 3300020070 Bacteria 1560
45 Ga0206354_11276608 3300020081 Bacteria 1412
46 Ga0213875_10006219 3300021388 Bacteria 6292
47 Ga0224712_10123168 3300022467 Bacteria 1125
48 Ga0209758_1003194 3300025297 Bacteria 15296
49 Ga0207426_1014399 3300025302 Bacteria 2897
50 Ga0207426_1014479 3300025302 Bacteria 2887
51 Ga0207713_1054773 3300025735 Bacteria 1561
52 Ga0207647_10041485 3300025904 Bacteria 2893
53 Ga0207705_10053453 3300025909 Bacteria 2909
54 Ga0207695_10633099 3300025913 Bacteria 951
55 Ga0207663_10062562 3300025916 Bacteria 2366
56 Ga0207657_10217898 3300025919 Bacteria 1530
57 Ga0207652_10173077 3300025921 Bacteria 1938
58 Ga0207664_10032867 3300025929 Bacteria 3980
59 Ga0207665_10002397 3300025939 Bacteria 12667
60 Ga0207667_10082959 3300025949 Bacteria 3319
61 Ga0207639_10028788 3300026041 Bacteria 4060
62 Ga0207702_10515167 3300026078 Bacteria 1167
63 Ga0209371_1012071 3300027312 Bacteria 2525
64 Ga0209371_1044350 3300027312 Bacteria 884
65 Ga0268266_10021285 3300028379 Bacteria 5525
66 Ga0268266_10416959 3300028379 Bacteria 1272
67 Ga0307517_10003835 3300028786 Bacteria 23322
68 Ga0307517_10051657 3300028786 Bacteria 4142
69 Ga0307515_10001149 3300028794 Bacteria 60657
70 Ga0307515_10087927 3300028794 Bacteria 3936
71 Ga0265338_10001308 3300028800 Bacteria 40815
72 Ga0268256_1004756 3300030500 Bacteria 5527
73 Ga0268256_1016424 3300030500 Bacteria 2123
74 Ga0307511_10017850 3300030521 Bacteria 6797
75 Ga0307511_10031583 3300030521 Bacteria 4727
76 Ga0307511_10123730 3300030521 Bacteria 1587
77 Ga0307512_10001899 3300030522 Bacteria 27905
78 Ga0307512_10008535 3300030522 Bacteria 9973
79 Ga0307512_10131706 3300030522 Bacteria 1565
80 Ga0307513_10005208 3300031456 Bacteria 17235
81 Ga0307513_10166215 3300031456 Bacteria 2090
82 Ga0307509_10203736 3300031507 Bacteria 1812
83 Ga0307509_10274444 3300031507 Bacteria 1451
84 Ga0307509_10528956 3300031507 Bacteria 859
85 Ga0307509_10565405 3300031507 Bacteria 813
86 Ga0307508_10037453 3300031616 Bacteria 4361
87 Ga0307508_10095800 3300031616 Bacteria 2559
88 Ga0307508_10159963 3300031616 Bacteria 1855
89 Ga0307508_10257269 3300031616 Bacteria 1341
90 Ga0307514_10043441 3300031649 Bacteria 3529
91 Ga0307514_10134388 3300031649 Bacteria 1696
92 Ga0307514_10205864 3300031649 Bacteria 1229
93 Ga0307514_10354625 3300031649 Bacteria 779
94 Ga0316576_10329357 3300031727 Bacteria 1138
95 Ga0307516_10007342 3300031730 Bacteria 12687
96 Ga0307516_10019837 3300031730 Bacteria 6952
97 Ga0307516_10063363 3300031730 Bacteria 3579
98 Ga0307516_10236616 3300031730 Bacteria 1527
99 Ga0307411_10826959 3300032005 Bacteria 818
100 Ga0307507_10000024 3300033179 Bacteria 212340
101 Ga0307507_10189819 3300033179 Bacteria 1447
102 Ga0307510_10020096 3300033180 Bacteria 7816
103 Ga0373926_0013159 3300035083 Bacteria 2803
104 Ga0373925_0002102 3300037068 Bacteria 16346
105 Ga0395900_0072481 3300037418 Bacteria 3541
106 Ga0395900_0343322 3300037418 Bacteria 1468
107 Ga0395900_0623746 3300037418 Bacteria 1017
108 Ga0395900_0794876 3300037418 Bacteria 874
109 Ga0395898_0002277 3300037466 Bacteria 23180
110 Ga0395898_0047547 3300037466 Bacteria 4210
111 Ga0395898_0068337 3300037466 Bacteria 3438
112 Ga0395905_0150347 3300037471 Bacteria 2191
113 Ga0395905_0173947 3300037471 Bacteria 2022
114 Ga0436364_1043328 3300037853 Bacteria 10028
115 Ga0395901_0170452 3300038443 Bacteria 2284
116 Ga0395901_0272691 3300038443 Bacteria 1759
117 Ga0395901_0290618 3300038443 Bacteria 1696
118 Ga0395901_0803436 3300038443 Bacteria 929
119 Ga0439436_0000415 3300041404 Bacteria 10718
120 Ga0439436_0004869 3300041404 Bacteria 4120
121 Ga0439439_0005044 3300041406 Bacteria 3000
122 Ga0451802_2066529 3300041460 Bacteria 1467
123 Ga0451853_1066400 3300041512 Bacteria 11292
124 Ga0451853_3574142 3300041512 Bacteria 779
125 Ga0451853_4001808 3300041512 Bacteria 1046
126 Ga0439433_0000725 3300041999 Bacteria 6434
127 Ga0439433_0003607 3300041999 Bacteria 3328
128 Ga0439442_006208 3300042002 Bacteria 2397
129 Ga0439442_014223 3300042002 Bacteria 1637
130 Ga0439448_0001643 3300042005 Bacteria 5856
131 Ga0439449_0001870 3300042007 Bacteria 8285
132 Ga0439449_0041752 3300042007 Bacteria 1705
133 Ga0439449_0046804 3300042007 Bacteria 1602
134 Ga0439455_0001561 3300042012 Bacteria 3885
135 Ga0439457_000038 3300042014 Bacteria 28052
136 Ga0439457_015535 3300042014 Bacteria 1699
137 Ga0439462_0043435 3300042015 Bacteria 1201
138 Ga0450894_000092 3300042131 Bacteria 14871
139 Ga0450895_001832 3300042132 Bacteria 1528
140 Ga0450898_001309 3300042134 Bacteria 3248
141 Ga0450898_046848 3300042134 Bacteria 828
142 Ga0450899_000182 3300042135 Bacteria 6303
143 Ga0450900_012150 3300042136 Bacteria 1126
144 Ga0450906_000810 3300042145 Bacteria 6865
145 Ga0439458_0000330 3300042157 Bacteria 11809
146 Ga0439458_0106072 3300042157 Bacteria 732
147 Ga0466969_0006625 3300044656 Bacteria 6155
148 Ga0466969_0016499 3300044656 Bacteria 3865
149 Ga0466969_0072603 3300044656 Bacteria 1652
150 Ga0466972_0009322 3300044658 Bacteria 4934
151 Ga0466972_0027952 3300044658 Bacteria 2787
152 Ga0466972_0058494 3300044658 Bacteria 1850
153 Ga0466972_0223814 3300044658 Bacteria 880
154 Ga0466965_0015598 3300044683 Bacteria 3609
155 Ga0466965_0060639 3300044683 Bacteria 1890
156 Ga0466966_0005141 3300044684 Bacteria 8593
157 Ga0466966_0021483 3300044684 Bacteria 4238
158 Ga0466966_0052729 3300044684 Bacteria 2582
159 Ga0466966_0442399 3300044684 Bacteria 781
160 Ga0466961_0004261 3300044693 Bacteria 8953
161 Ga0466961_0044552 3300044693 Bacteria 2839
162 Ga0466961_0051397 3300044693 Bacteria 2632
163 Ga0466963_0004350 3300044694 Bacteria 8222
164 Ga0466963_0004527 3300044694 Bacteria 8094
165 Ga0466963_0014560 3300044694 Bacteria 4853
166 Ga0466963_0263836 3300044694 Bacteria 1209
167 Ga0466964_0026835 3300044706 Bacteria 2256
168 Ga0466971_0000499 3300044719 Bacteria 15385
169 Ga0466971_0063659 3300044719 Bacteria 1669
170 Ga0466971_0106939 3300044719 Bacteria 1289
171 Ga0466971_0175276 3300044719 Bacteria 1007
172 Ga0466968_0099072 3300044735 Bacteria 1299
173 Ga0466968_0114842 3300044735 Bacteria 1214
174 Ga0466970_0002580 3300044765 Bacteria 8736
175 Ga0466970_0013053 3300044765 Bacteria 4257
176 Ga0466970_0032563 3300044765 Bacteria 2754
177 Ga0466970_0128406 3300044765 Bacteria 1391
178 Ga0466957_0002868 3300044842 Bacteria 9336
179 Ga0466957_0190537 3300044842 Bacteria 1343
180 Ga0466960_0009571 3300044901 Bacteria 3999
181 Ga0466960_0041466 3300044901 Bacteria 2181
182 Ga0466959_0000705 3300045049 Bacteria 19526
183 Ga0466959_0009945 3300045049 Bacteria 6780
184 Ga0466959_0019398 3300045049 Bacteria 5001
185 Ga0466959_0106178 3300045049 Bacteria 2008
186 Ga0466959_0214349 3300045049 Bacteria 1337
187 Ga0466958_0001314 3300045836 Bacteria 11712
188 Ga0466958_0135560 3300045836 Bacteria 1548
189 Ga0466958_0138693 3300045836 Bacteria 1530
190 Ga0466958_0205310 3300045836 Bacteria 1254
191 Ga0466967_0001824 3300045976 Bacteria 12808
192 Ga0466967_0036387 3300045976 Bacteria 4202
193 Ga0466967_0182496 3300045976 Bacteria 1980
194 Ga0495617_068547 3300046452 Bacteria 1167
195 Ga0495592_0001663 3300046454 Bacteria 15578
196 Ga0495592_0165381 3300046454 Bacteria 1519
197 Ga0495592_0307192 3300046454 Bacteria 1029
198 Ga0495603_0003752 3300046455 Bacteria 9033
199 Ga0495603_0006258 3300046455 Bacteria 7115
200 Ga0495603_0015271 3300046455 Bacteria 4646
201 Ga0495590_0062019 3300046457 Bacteria 1309
202 Ga0495590_0066254 3300046457 Bacteria 1264
203 Ga0495629_0042359 3300046459 Bacteria 3200
204 Ga0495629_0119604 3300046459 Bacteria 1835
205 Ga0495629_0159420 3300046459 Bacteria 1567
206 Ga0495629_0165656 3300046459 Bacteria 1535
207 Ga0495629_0299031 3300046459 Bacteria 1102
208 Ga0495638_0044500 3300046460 Bacteria 2796
209 Ga0495638_0189176 3300046460 Bacteria 1169
210 Ga0495651_0000382 3300046462 Bacteria 34395
211 Ga0495651_0000984 3300046462 Bacteria 22098
212 Ga0495651_0113298 3300046462 Bacteria 2002
213 Ga0495651_0141601 3300046462 Bacteria 1743
214 Ga0495580_0296051 3300046472 Bacteria 1102
215 Ga0495582_0027486 3300046473 Bacteria 3119
216 Ga0495605_0078047 3300046474 Bacteria 1553
217 Ga0495639_0052399 3300046475 Bacteria 1857
218 Ga0495639_0266946 3300046475 Bacteria 849
219 Ga0495662_0000634 3300046476 Bacteria 16387
220 Ga0495662_0083968 3300046476 Bacteria 1550
221 Ga0495662_0113007 3300046476 Bacteria 1331
222 Ga0495664_0001800 3300046477 Bacteria 11386
223 Ga0495664_0377549 3300046477 Bacteria 852
224 Ga0495585_0085805 3300046492 Bacteria 1701
225 Ga0495585_0194393 3300046492 Bacteria 1036
226 Ga0495594_0004347 3300046499 Bacteria 7292
227 Ga0495594_0018978 3300046499 Bacteria 3650
228 Ga0495594_0086998 3300046499 Bacteria 1748
229 Ga0495594_0140381 3300046499 Bacteria 1370
230 Ga0495594_0281256 3300046499 Bacteria 948
231 Ga0495596_0047092 3300046500 Bacteria 1692
232 Ga0495583_0018789 3300046506 Bacteria 3628
233 Ga0495583_0063885 3300046506 Bacteria 1634
234 Ga0495606_0036359 3300046507 Bacteria 3354
235 Ga0495608_0260253 3300046511 Bacteria 1080
236 Ga0495610_0008225 3300046512 Bacteria 6794
237 Ga0495616_0005243 3300046513 Bacteria 8005
238 Ga0495618_0052952 3300046514 Bacteria 2566
239 Ga0495618_0097679 3300046514 Bacteria 1879
240 Ga0495620_0042762 3300046515 Bacteria 1977
241 Ga0495620_0057791 3300046515 Bacteria 1626
242 Ga0495628_0010264 3300046516 Bacteria 7965
243 Ga0495628_0022365 3300046516 Bacteria 5194
244 Ga0495628_0054678 3300046516 Bacteria 3146
245 Ga0495628_0138112 3300046516 Bacteria 1861
246 Ga0495628_0279311 3300046516 Bacteria 1240
247 Ga0495630_0025726 3300046517 Bacteria 4353
248 Ga0495631_0009437 3300046518 Bacteria 4877
249 Ga0495631_0067577 3300046518 Bacteria 1546
250 Ga0495632_0078839 3300046519 Bacteria 1573
251 Ga0495643_0000999 3300046522 Bacteria 28874
252 Ga0495643_0061441 3300046522 Bacteria 1992
253 Ga0495643_0204474 3300046522 Bacteria 946
254 Ga0495666_0014060 3300046526 Bacteria 3991
255 Ga0495666_0142536 3300046526 Bacteria 1116
256 Ga0495666_0158333 3300046526 Bacteria 1051
257 Ga0495642_0116641 3300046528 Bacteria 1144
258 Ga0495652_0000991 3300046529 Bacteria 32501
259 Ga0495652_0009088 3300046529 Bacteria 9044
260 Ga0495652_0024424 3300046529 Bacteria 5349
261 Ga0495652_0120628 3300046529 Bacteria 2092
262 Ga0495654_0016773 3300046530 Bacteria 3861
263 Ga0495640_0002942 3300046533 Bacteria 13719
264 Ga0495640_0046882 3300046533 Bacteria 2992
265 Ga0495640_0139515 3300046533 Bacteria 1563
266 Ga0495640_0184943 3300046533 Bacteria 1326
267 Ga0495640_0316973 3300046533 Bacteria 966
268 Ga0495587_0000643 3300046536 Bacteria 23431
269 Ga0495597_0045768 3300046542 Bacteria 1940
270 Ga0495597_0087713 3300046542 Bacteria 1323
271 Ga0495645_0011885 3300046543 Bacteria 6136
272 Ga0495645_0015783 3300046543 Bacteria 5377
273 Ga0495645_0103617 3300046543 Bacteria 2021
274 Ga0495645_0259587 3300046543 Bacteria 1151
275 Ga0495622_0004333 3300046557 Bacteria 6606
276 Ga0495622_0027513 3300046557 Bacteria 2654
277 Ga0495622_0095175 3300046557 Bacteria 1367
278 Ga0495622_0113529 3300046557 Bacteria 1239
279 Ga0495667_0084315 3300046559 Bacteria 2063
280 Ga0495656_0142794 3300046615 Bacteria 1150
281 Ga0495668_0023182 3300046616 Bacteria 3542
282 Ga0495668_0138434 3300046616 Bacteria 1332
283 Ga0495634_0003674 3300046642 Bacteria 12239
284 Ga0495634_0033374 3300046642 Bacteria 3537
285 Ga0495611_0039223 3300046648 Bacteria 2108
286 Ga0495611_0119888 3300046648 Bacteria 1226
287 Ga0495625_0015286 3300046660 Bacteria 6083
288 Ga0495625_0021903 3300046660 Bacteria 4908
289 Ga0495635_0001049 3300046663 Bacteria 18303
290 Ga0495635_0021203 3300046663 Bacteria 4529
291 Ga0495635_0068480 3300046663 Bacteria 2434
292 Ga0495635_0256154 3300046663 Bacteria 1179
293 Ga0495661_0008094 3300046665 Bacteria 7293
294 Ga0495588_0014849 3300046674 Bacteria 3737
295 Ga0495588_0241013 3300046674 Bacteria 954
296 Ga0495657_0006445 3300046675 Bacteria 9183
297 Ga0495657_0027804 3300046675 Bacteria 3986
298 Ga0495599_0103598 3300046678 Bacteria 1773
299 Ga0495623_0021867 3300046679 Bacteria 4130
300 Ga0495623_0103982 3300046679 Bacteria 1727
301 Ga0495646_0000782 3300046680 Bacteria 17783
302 Ga0495646_0002348 3300046680 Bacteria 11582
303 Ga0495613_0001126 3300046689 Bacteria 20354
304 Ga0495613_0057945 3300046689 Bacteria 2844
305 Ga0495613_0078050 3300046689 Bacteria 2409
306 Ga0495624_0148664 3300046690 Bacteria 1433
307 Ga0495670_0002468 3300046691 Bacteria 9125
308 Ga0495670_0026173 3300046691 Bacteria 2888
309 Ga0495671_0107665 3300046692 Bacteria 1361
310 Ga0495649_0129725 3300046694 Bacteria 1330
311 Ga0495649_0144000 3300046694 Bacteria 1253
312 Ga0495589_0107793 3300046794 Bacteria 1345
313 Ga0495589_0109526 3300046794 Bacteria 1333
314 Ga0495589_0143026 3300046794 Bacteria 1144
315 Ga0495589_0160524 3300046794 Bacteria 1071
316 Ga0495600_0000527 3300046809 Bacteria 19849
317 Ga0495600_0015370 3300046809 Bacteria 4839
318 Ga0495600_0121535 3300046809 Bacteria 1698
319 Ga0495600_0206360 3300046809 Bacteria 1260
320 Ga0495660_0070556 3300046810 Bacteria 1854
321 Ga0495581_0019710 3300047315 Bacteria 3915
322 Ga0495581_0081056 3300047315 Bacteria 1879
323 Ga0495604_0002748 3300047317 Bacteria 14109
324 Ga0495604_0014507 3300047317 Bacteria 6283
325 Ga0495604_0335578 3300047317 Bacteria 1007
326 Ga0495636_0014080 3300047318 Bacteria 3179
327 Ga0495636_0018933 3300047318 Bacteria 2764
328 Ga0495636_0066999 3300047318 Bacteria 1527
329 Ga0495674_0034274 3300047319 Bacteria 4592
330 Ga0495674_0038786 3300047319 Bacteria 4274
331 Ga0495672_0165805 3300047320 Bacteria 1131
332 Ga0495676_0024401 3300047321 Bacteria 5235
333 Ga0495676_0039911 3300047321 Bacteria 3881
334 Ga0495676_0320428 3300047321 Bacteria 1041
335 Ga0495680_0002771 3300047322 Bacteria 17676
336 Ga0495683_0031381 3300047323 Bacteria 2708
337 Ga0495687_005037 3300047443 Bacteria 8614
338 Ga0495687_005042 3300047443 Bacteria 8606
339 Ga0495687_007978 3300047443 Bacteria 6140
340 Ga0495675_0074698 3300047444 Bacteria 2136
341 Ga0495675_0094094 3300047444 Bacteria 1879
342 Ga0495685_001515 3300047447 Bacteria 7119
343 Ga0495685_006081 3300047447 Bacteria 3949
344 Ga0495685_010126 3300047447 Bacteria 3159
345 Ga0495685_025013 3300047447 Bacteria 2055
346 Ga0495685_064340 3300047447 Bacteria 1233
347 Ga0495681_0002625 3300047470 Bacteria 12773
348 Ga0495681_0006932 3300047470 Bacteria 7345
349 Ga0495681_0009811 3300047470 Bacteria 5856
350 Ga0495681_0148071 3300047470 Bacteria 987
351 Ga0495684_0081170 3300047471 Bacteria 2461
352 Ga0495686_0011886 3300047472 Bacteria 6120
353 Ga0495686_0027231 3300047472 Bacteria 3734
354 Ga0495686_0194156 3300047472 Bacteria 1168
355 Ga0495686_0406413 3300047472 Bacteria 730
356 Ga0495593_0000961 3300047673 Bacteria 16873
357 Ga0495602_0008700 3300048088 Bacteria 10594
358 Ga0495602_0172098 3300048088 Bacteria 1680
359 Ga0495614_0016707 3300048089 Bacteria 3192
360 Ga0495614_0165539 3300048089 Bacteria 990
361 Ga0496101_0307716 3300048904 Bacteria 1242
362 Ga0496102_0350782 3300048905 Bacteria 1389
363 Ga0496104_0252433 3300048907 Bacteria 1676
364 Ga0496105_0024615 3300048908 Bacteria 4892
365 Ga0496108_0026034 3300048911 Bacteria 4825
366 Ga0496109_0025388 3300048912 Bacteria 5280
367 Ga0496109_0131937 3300048912 Bacteria 2332
368 Ga0496112_0000486 3300048915 Bacteria 26671
369 Ga0496113_0034792 3300048916 Bacteria 3679
370 Ga0496113_0486957 3300048916 Bacteria 991
371 Ga0496114_0226525 3300048917 Bacteria 1642
372 Ga0501306_005898 3300049127 Bacteria 1420
373 Ga0501306_006413 3300049127 Bacteria 1379
374 Ga0501309_016562 3300049129 Bacteria 1006
375 Ga0501310_008726 3300049130 Bacteria 1105
376 Ga0501311_013126 3300049527 Bacteria 1042
377 Ga0501315_010781 3300049531 Bacteria 1105
378 Ga0501316_009069 3300049532 Bacteria 1110
379 Ga0501318_007984 3300049534 Bacteria 1120
380 Ga0501319_005320 3300049535 Bacteria 921
381 Ga0501320_005143 3300049536 Bacteria 1182
382 Ga0501323_012362 3300049539 Bacteria 1042
383 Ga0501031_0001404 3300049568 Bacteria 14894
384 Ga0501031_0003700 3300049568 Bacteria 9836
385 Ga0501031_0220065 3300049568 Bacteria 1236
386 Ga0501031_0227190 3300049568 Bacteria 1215
387 Ga0501032_0001354 3300049569 Bacteria 19476
388 Ga0501032_0056047 3300049569 Bacteria 2650
389 Ga0501032_0083447 3300049569 Bacteria 2125
390 Ga0501032_0173669 3300049569 Bacteria 1412
391 Ga0501033_0005743 3300049570 Bacteria 9775
392 Ga0501033_0009393 3300049570 Bacteria 7530
393 Ga0501033_0017067 3300049570 Bacteria 5487
394 Ga0501033_0029886 3300049570 Bacteria 4095
395 Ga0501033_0039578 3300049570 Bacteria 3521
396 Ga0501033_0165008 3300049570 Bacteria 1593
397 Ga0501034_0003199 3300049571 Bacteria 18801
398 Ga0501034_0020934 3300049571 Bacteria 6676
399 Ga0501034_0023110 3300049571 Bacteria 6336
400 Ga0501034_0030916 3300049571 Bacteria 5442
401 Ga0501034_0157379 3300049571 Bacteria 2245
402 Ga0501034_0334872 3300049571 Bacteria 1444
403 Ga0501034_0562774 3300049571 Bacteria 1048
404 Ga0501036_0001153 3300049572 Bacteria 20096
405 Ga0501036_0002718 3300049572 Bacteria 13979
406 Ga0501036_0029647 3300049572 Bacteria 4621
407 Ga0501036_0038480 3300049572 Bacteria 4049
408 Ga0501036_0094376 3300049572 Bacteria 2528
409 Ga0501036_0421756 3300049572 Bacteria 1112
410 Ga0501037_0001251 3300049573 Bacteria 18721
411 Ga0501037_0001697 3300049573 Bacteria 15984
412 Ga0501037_0016874 3300049573 Bacteria 5372
413 Ga0501037_0404175 3300049573 Bacteria 936
414 Ga0501038_0000870 3300049574 Bacteria 26736
415 Ga0501038_0011684 3300049574 Bacteria 8009
416 Ga0501038_0011952 3300049574 Bacteria 7926
417 Ga0501039_0010092 3300049575 Bacteria 7194
418 Ga0501039_0046419 3300049575 Bacteria 3355
419 Ga0501039_0324511 3300049575 Bacteria 1210
420 Ga0501040_0007890 3300049576 Bacteria 6900
421 Ga0501041_0001249 3300049577 Bacteria 13940
422 Ga0501042_0057951 3300049578 Bacteria 2764
423 Ga0501042_0167073 3300049578 Bacteria 1587
424 Ga0501042_0668349 3300049578 Bacteria 755
425 Ga0501043_0003900 3300049579 Bacteria 12244
426 Ga0501043_0006281 3300049579 Bacteria 9538
427 Ga0501043_0007294 3300049579 Bacteria 8775
428 Ga0501043_0050795 3300049579 Bacteria 3259
429 Ga0501046_0002857 3300049580 Bacteria 16064
430 Ga0501046_0048397 3300049580 Bacteria 3366
431 Ga0501047_0000025 3300049581 Bacteria 225560
432 Ga0501047_0000031 3300049581 Bacteria 215903
433 Ga0501047_0002182 3300049581 Bacteria 18725
434 Ga0501047_0005252 3300049581 Bacteria 12167
435 Ga0501047_0008544 3300049581 Bacteria 9661
436 Ga0501047_0011159 3300049581 Bacteria 8504
437 Ga0501047_0015981 3300049581 Bacteria 7156
438 Ga0501047_0070516 3300049581 Bacteria 3365
439 Ga0501047_0159191 3300049581 Bacteria 2130
440 Ga0501047_0244710 3300049581 Bacteria 1643
441 Ga0501047_0252173 3300049581 Bacteria 1613
442 Ga0501048_0006529 3300049582 Bacteria 8866
443 Ga0501048_0152718 3300049582 Bacteria 1633
444 Ga0501048_0260274 3300049582 Bacteria 1233
445 Ga0501067_0002728 3300049583 Bacteria 9715
446 Ga0501068_0000751 3300049584 Bacteria 16633
447 Ga0501068_0246235 3300049584 Bacteria 1138
448 Ga0501069_0050300 3300049585 Bacteria 2317
449 Ga0501070_0006937 3300049586 Bacteria 9633
450 Ga0501070_0007350 3300049586 Bacteria 9353
451 Ga0501070_0262197 3300049586 Bacteria 1412
452 Ga0501070_0372740 3300049586 Bacteria 1157
453 Ga0501071_0000873 3300049587 Bacteria 16278
454 Ga0501072_0003631 3300049588 Bacteria 11610
455 Ga0501073_0016451 3300049589 Bacteria 5360
456 Ga0501073_0202583 3300049589 Bacteria 1372
457 Ga0501074_0005791 3300049590 Bacteria 8914
458 Ga0501074_0009748 3300049590 Bacteria 6973
459 Ga0501076_0006283 3300049592 Bacteria 8610
460 Ga0501077_0257794 3300049593 Bacteria 1109
461 Ga0501079_0012558 3300049741 Bacteria 6467
462 Ga0501080_0748811 3300049742 Bacteria 859
463 Ga0501035_0002332 3300049822 Bacteria 18716
464 Ga0501035_0016537 3300049822 Bacteria 6801
465 Ga0501035_0018777 3300049822 Bacteria 6368
466 Ga0501035_0065670 3300049822 Bacteria 3221
467 Ga0501035_0072937 3300049822 Bacteria 3037
468 Ga0501035_0164448 3300049822 Bacteria 1919
469 Ga0501035_0386165 3300049822 Bacteria 1167
470 Ga0501044_0002414 3300049823 Bacteria 21312
471 Ga0501044_0003111 3300049823 Bacteria 18802
472 Ga0501044_0013714 3300049823 Bacteria 8759
473 Ga0501044_0019719 3300049823 Bacteria 7205
474 Ga0501044_0068809 3300049823 Bacteria 3605
475 Ga0501044_0071847 3300049823 Bacteria 3519
476 Ga0501044_0262555 3300049823 Bacteria 1665
477 Ga0501044_0474108 3300049823 Bacteria 1155
478 Ga0501045_0144303 3300049824 Bacteria 1770
479 nmdc:mga06z11_896_c1 3300050494 Bacteria 10843
480 nmdc:mga05p37_211183_c1 3300050507 Bacteria 2346
481 nmdc:mga09592_338673_c1 3300050508 Bacteria 1302
482 nmdc:mga0qj67_44312_c1 3300050509 Bacteria 3505
483 Ga0495601_0213186 3300053077 Bacteria 1261
484 Ga0500610_0070393 3300053079 Bacteria 1824
485 Ga0495655_0001607 3300053083 Bacteria 3483
486 Ga0495619_0108214 3300053085 Bacteria 1897
487 Ga0500578_0068043 3300053086 Bacteria 2270
488 Ga0500640_006124 3300053095 Bacteria 4563
489 Ga0500660_115804 3300053100 Bacteria 1130
490 Ga0500553_041418 3300053101 Bacteria 2256
491 Ga0500553_135089 3300053101 Bacteria 985
492 Ga0500560_021192 3300053107 Bacteria 1854
493 Ga0500594_0057588 3300053118 Bacteria 1112
494 Ga0500652_016761 3300053131 Bacteria 2673
495 Ga0500658_0008548 3300053134 Bacteria 3781
496 Ga0500561_0030198 3300053137 Bacteria 1359
497 Ga0500573_0002476 3300053140 Bacteria 9241
498 Ga0500586_127935 3300053145 Bacteria 881
499 Ga0500600_0004832 3300053149 Bacteria 7919
500 Ga0500603_071377 3300053150 Bacteria 990
501 Ga0500633_0033738 3300053160 Bacteria 1672
502 Ga0500634_0079154 3300053161 Bacteria 1698
503 Ga0500636_0092174 3300053177 Bacteria 1734
504 Ga0500656_000635 3300053732 Bacteria 2703
505 Ga0500587_006094 3300053739 Bacteria 1610
506 Ga0501084_0021137 3300054114 Bacteria 5427
507 Ga0501082_0001787 3300060353 Bacteria 18906
508 Ga0466962_0008770 3300061719 Bacteria 4847
509 Ga0466962_0019164 3300061719 Bacteria 3285
510 Ga0466962_0037837 3300061719 Bacteria 2311
511 Ga0466962_0063271 3300061719 Bacteria 1766
512 2547412852 2547132111 Bacteria 8013147
513 2585304871 2582581313 Bacteria 10042643
514 2585319421 2582581314 Bacteria 11452267
515 2616701839 2616644814 Bacteria 11555299
516 2644269222 2643221647 Bacteria 10741251
517 2644436340 2643221678 Bacteria 9540101
518 2644625797 2643221714 Bacteria 9015452
519 2676496498 2675903060 Bacteria 10051191
520 2731907845 2731639228 Bacteria 4187555
521 2784587839 2784132148 Bacteria 8627943
522 2785344303 2784746763 Bacteria 9783172
523 2785368547 2784746768 Bacteria 10036182
524 2786669636 2786546132 Bacteria 10419719
525 2799184344 2799112218 Bacteria 4315149
526 2804844855 2802429296 Bacteria 7227771
527 2808841237 2808606359 Bacteria 9866990
528 2808919753 2808606375 Bacteria 9466072
529 2809231424 2808606448 Bacteria 8656184
530 2811848243 2808606982 Bacteria 7791042
531 2812359016 2811994879 Bacteria 9313447
532 2812481264 2811994917 Bacteria 7761064
533 2852641241 2852635781 Bacteria 8251373
534 2856743226 2856741275 Bacteria 8096094
535 2862288180 2862281513 Bacteria 9621493
536 2862385348 2862382967 Bacteria 10317375
537 2862509460 2862507626 Bacteria 9425308
538 2862580024 2862574272 Bacteria 10567477
539 2863405557 2863404153 Bacteria 9672205
540 2867371059 2867369537 Bacteria 6501581
541 2867431328 2867428634 Bacteria 9590268
542 2873156584 2873151551 Bacteria 8625867
543 2873318020 2873314349 Bacteria 8512634
544 2877681987 2877676314 Bacteria 9512378
545 2884701795 2884693830 Bacteria 11273186
546 2891396165 2891395885 Bacteria 9251614
547 2891558553 2891554331 Bacteria 8812224
548 2891568705 2891562705 Bacteria 8039471
549 2895439066 2895427314 Bacteria 13147766
550 2895446523 2895442618 Bacteria 11027144
551 2912720950 2912715099 Bacteria 9460473
552 2912725043 2912723979 Bacteria 8557534
553 2919468638 2919468124 Bacteria 9133025
554 2946066861 2946064051 Bacteria 8957905
555 2946075185 2946072368 Bacteria 8999607
556 2947230368 2947224130 Bacteria 9938529
557 2954003700 2954002825 Bacteria 9173742
558 2954387100 2954380949 Bacteria 10050426
559 2954688105 2954682443 Bacteria 9862841
560 2954697933 2954691527 Bacteria 10720516
561 2954704283 2954701450 Bacteria 10834262
562 2954717053 2954711539 Bacteria 10867210
563 2954727001 2954721474 Bacteria 10456478
564 2954734780 2954731030 Bacteria 10243860
565 2954753666 2954749733 Bacteria 10366972
566 2954764896 2954759201 Bacteria 9358192
567 2990061921 2990059506 Bacteria 9321252
568 2990094442 2990088156 Bacteria 6657676
569 2997608188 2997600082 Bacteria 9896405
570 3002998728 3002998708 Bacteria 11715108
571 3006398162 3006393351 Bacteria 6615579
572 3006500981 3006493962 Bacteria 8825450
573 8008559519 8008558824 Bacteria 10610750
574 8008579640 8008574985 Bacteria 7815457
575 8023630830 8023623736 Bacteria 8593882
576 8025419296 8025413630 Bacteria 7014048
577 8033687390 8033684223 Bacteria 6906479
578 8048408412 8048406513 Bacteria 8936924
579 8053950208 8053945823 Bacteria 8962862
580 8055068692 8055066027 Bacteria 9479577
581 8055177159 8055172936 Bacteria 9305943
582 8056836911 8056829672 Bacteria 9045328
583 Ga0466961_0000785
584 rootH2_10025259
585 Ga0006562J51391_1108414
586 Ga0006562J51391_1108415
587 Ga0006562J51391_1196098
588 Ga0006562J51391_1196099
589 Ga0070658_10034093
590 Ga0070658_10068535
591 Ga0070658_10200951
592 Ga0070660_100436731
593 Ga0070667_100270230
594 Ga0070713_100300151
595 Ga0070679_100286642
596 Ga0070679_100645037
597 Ga0070684_100543161
598 Ga0068853_100023713
599 Ga0070672_100378341
600 Ga0070696_100000319
601 Ga0068855_100013334
602 Ga0070664_100318074
603 Ga0068856_100248762
604 Ga0068856_100473757
605 Ga0081455_10001502
606 Ga0070717_10234663
607 Ga0070715_10007791
608 Ga0075428_100042771
609 Ga0075430_100140386
610 Ga0075429_100046409
611 Ga0075429_100265637
612 Ga0099826_10081918
613 Ga0105251_10017321
614 Ga0105240_10037865
615 Ga0105245_10266260
616 Ga0114129_10082591
617 Ga0105243_10353508
618 Ga0105239_10178520
619 Ga0105246_10030162
620 Ga0157369_10138863
621 Ga0157369_10438806
622 Ga0157372_10151647
623 Ga0157375_11021341
624 Ga0182008_10002664
625 Ga0182007_10000257
626 Ga0206356_11506728
627 Ga0206354_11276608
628 Ga0213875_10006219
629 Ga0224712_10123168
630 Ga0209758_1003194
631 Ga0207426_1014399
632 Ga0207426_1014479
633 Ga0207713_1054773
634 Ga0207647_10041485
635 Ga0207705_10053453
636 Ga0207695_10633099
637 Ga0207663_10062562
638 Ga0207657_10217898
639 Ga0207652_10173077
640 Ga0207664_10032867
641 Ga0207665_10002397
642 Ga0207667_10082959
643 Ga0207639_10028788
644 Ga0207702_10515167
645 Ga0209371_1012071
646 Ga0209371_1044350
647 Ga0268266_10021285
648 Ga0268266_10416959
649 Ga0307517_10003835
650 Ga0307517_10051657
651 Ga0307515_10001149
652 Ga0307515_10087927
653 Ga0265338_10001308
654 Ga0268256_1004756
655 Ga0268256_1016424
656 Ga0307511_10017850
657 Ga0307511_10031583
658 Ga0307511_10123730
659 Ga0307512_10001899
660 Ga0307512_10008535
661 Ga0307512_10131706
662 Ga0307513_10005208
663 Ga0307513_10166215
664 Ga0307509_10203736
665 Ga0307509_10274444
666 Ga0307509_10528956
667 Ga0307509_10565405
668 Ga0307508_10037453
669 Ga0307508_10095800
670 Ga0307508_10159963
671 Ga0307508_10257269
672 Ga0307514_10043441
673 Ga0307514_10134388
674 Ga0307514_10205864
675 Ga0307514_10354625
676 Ga0316576_10329357
677 Ga0307516_10007342
678 Ga0307516_10019837
679 Ga0307516_10063363
680 Ga0307516_10236616
681 Ga0307411_10826959
682 Ga0307507_10000024
683 Ga0307507_10189819
684 Ga0307510_10020096
685 Ga0373926_0013159
686 Ga0373925_0002102
687 Ga0395900_0072481
688 Ga0395900_0343322
689 Ga0395900_0623746
690 Ga0395900_0794876
691 Ga0395898_0002277
692 Ga0395898_0047547
693 Ga0395898_0068337
694 Ga0395905_0150347
695 Ga0395905_0173947
696 Ga0436364_1043328
697 Ga0395901_0170452
698 Ga0395901_0272691
699 Ga0395901_0290618
700 Ga0395901_0803436
701 Ga0439436_0000415
702 Ga0439436_0004869
703 Ga0439439_0005044
704 Ga0451802_2066529
705 Ga0451853_1066400
706 Ga0451853_3574142
707 Ga0451853_4001808
708 Ga0439433_0000725
709 Ga0439433_0003607
710 Ga0439442_006208
711 Ga0439442_014223
712 Ga0439448_0001643
713 Ga0439449_0001870
714 Ga0439449_0041752
715 Ga0439449_0046804
716 Ga0439455_0001561
717 Ga0439457_000038
718 Ga0439457_015535
719 Ga0439462_0043435
720 Ga0450894_000092
721 Ga0450895_001832
722 Ga0450898_001309
723 Ga0450898_046848
724 Ga0450899_000182
725 Ga0450900_012150
726 Ga0450906_000810
727 Ga0439458_0000330
728 Ga0439458_0106072
729 Ga0466969_0006625
730 Ga0466969_0016499
731 Ga0466969_0072603
732 Ga0466972_0009322
733 Ga0466972_0027952
734 Ga0466972_0058494
735 Ga0466972_0223814
736 Ga0466965_0015598
737 Ga0466965_0060639
738 Ga0466966_0005141
739 Ga0466966_0021483
740 Ga0466966_0052729
741 Ga0466966_0442399
742 Ga0466961_0004261
743 Ga0466961_0044552
744 Ga0466961_0051397
745 Ga0466963_0004350
746 Ga0466963_0004527
747 Ga0466963_0014560
748 Ga0466963_0263836
749 Ga0466964_0026835
750 Ga0466971_0000499
751 Ga0466971_0063659
752 Ga0466971_0106939
753 Ga0466971_0175276
754 Ga0466968_0099072
755 Ga0466968_0114842
756 Ga0466970_0002580
757 Ga0466970_0013053
758 Ga0466970_0032563
759 Ga0466970_0128406
760 Ga0466957_0002868
761 Ga0466957_0190537
762 Ga0466960_0009571
763 Ga0466960_0041466
764 Ga0466959_0000705
765 Ga0466959_0009945
766 Ga0466959_0019398
767 Ga0466959_0106178
768 Ga0466959_0214349
769 Ga0466958_0001314
770 Ga0466958_0135560
771 Ga0466958_0138693
772 Ga0466958_0205310
773 Ga0466967_0001824
774 Ga0466967_0036387
775 Ga0466967_0182496
776 Ga0495617_068547
777 Ga0495592_0001663
778 Ga0495592_0165381
779 Ga0495592_0307192
780 Ga0495603_0003752
781 Ga0495603_0006258
782 Ga0495603_0015271
783 Ga0495590_0062019
784 Ga0495590_0066254
785 Ga0495629_0042359
786 Ga0495629_0119604
787 Ga0495629_0159420
788 Ga0495629_0165656
789 Ga0495629_0299031
790 Ga0495638_0044500
791 Ga0495638_0189176
792 Ga0495651_0000382
793 Ga0495651_0000984
794 Ga0495651_0113298
795 Ga0495651_0141601
796 Ga0495580_0296051
797 Ga0495582_0027486
798 Ga0495605_0078047
799 Ga0495639_0052399
800 Ga0495639_0266946
801 Ga0495662_0000634
802 Ga0495662_0083968
803 Ga0495662_0113007
804 Ga0495664_0001800
805 Ga0495664_0377549
806 Ga0495585_0085805
807 Ga0495585_0194393
808 Ga0495594_0004347
809 Ga0495594_0018978
810 Ga0495594_0086998
811 Ga0495594_0140381
812 Ga0495594_0281256
813 Ga0495596_0047092
814 Ga0495583_0018789
815 Ga0495583_0063885
816 Ga0495606_0036359
817 Ga0495608_0260253
818 Ga0495610_0008225
819 Ga0495616_0005243
820 Ga0495618_0052952
821 Ga0495618_0097679
822 Ga0495620_0042762
823 Ga0495620_0057791
824 Ga0495628_0010264
825 Ga0495628_0022365
826 Ga0495628_0054678
827 Ga0495628_0138112
828 Ga0495628_0279311
829 Ga0495630_0025726
830 Ga0495631_0009437
831 Ga0495631_0067577
832 Ga0495632_0078839
833 Ga0495643_0000999
834 Ga0495643_0061441
835 Ga0495643_0204474
836 Ga0495666_0014060
837 Ga0495666_0142536
838 Ga0495666_0158333
839 Ga0495642_0116641
840 Ga0495652_0000991
841 Ga0495652_0009088
842 Ga0495652_0024424
843 Ga0495652_0120628
844 Ga0495654_0016773
845 Ga0495640_0002942
846 Ga0495640_0046882
847 Ga0495640_0139515
848 Ga0495640_0184943
849 Ga0495640_0316973
850 Ga0495587_0000643
851 Ga0495597_0045768
852 Ga0495597_0087713
853 Ga0495645_0011885
854 Ga0495645_0015783
855 Ga0495645_0103617
856 Ga0495645_0259587
857 Ga0495622_0004333
858 Ga0495622_0027513
859 Ga0495622_0095175
860 Ga0495622_0113529
861 Ga0495667_0084315
862 Ga0495656_0142794
863 Ga0495668_0023182
864 Ga0495668_0138434
865 Ga0495634_0003674
866 Ga0495634_0033374
867 Ga0495611_0039223
868 Ga0495611_0119888
869 Ga0495625_0015286
870 Ga0495625_0021903
871 Ga0495635_0001049
872 Ga0495635_0021203
873 Ga0495635_0068480
874 Ga0495635_0256154
875 Ga0495661_0008094
876 Ga0495588_0014849
877 Ga0495588_0241013
878 Ga0495657_0006445
879 Ga0495657_0027804
880 Ga0495599_0103598
881 Ga0495623_0021867
882 Ga0495623_0103982
883 Ga0495646_0000782
884 Ga0495646_0002348
885 Ga0495613_0001126
886 Ga0495613_0057945
887 Ga0495613_0078050
888 Ga0495624_0148664
889 Ga0495670_0002468
890 Ga0495670_0026173
891 Ga0495671_0107665
892 Ga0495649_0129725
893 Ga0495649_0144000
894 Ga0495589_0107793
895 Ga0495589_0109526
896 Ga0495589_0143026
897 Ga0495589_0160524
898 Ga0495600_0000527
899 Ga0495600_0015370
900 Ga0495600_0121535
901 Ga0495600_0206360
902 Ga0495660_0070556
903 Ga0495581_0019710
904 Ga0495581_0081056
905 Ga0495604_0002748
906 Ga0495604_0014507
907 Ga0495604_0335578
908 Ga0495636_0014080
909 Ga0495636_0018933
910 Ga0495636_0066999
911 Ga0495674_0034274
912 Ga0495674_0038786
913 Ga0495672_0165805
914 Ga0495676_0024401
915 Ga0495676_0039911
916 Ga0495676_0320428
917 Ga0495680_0002771
918 Ga0495683_0031381
919 Ga0495687_005037
920 Ga0495687_005042
921 Ga0495687_007978
922 Ga0495675_0074698
923 Ga0495675_0094094
924 Ga0495685_001515
925 Ga0495685_006081
926 Ga0495685_010126
927 Ga0495685_025013
928 Ga0495685_064340
929 Ga0495681_0002625
930 Ga0495681_0006932
931 Ga0495681_0009811
932 Ga0495681_0148071
933 Ga0495684_0081170
934 Ga0495686_0011886
935 Ga0495686_0027231
936 Ga0495686_0194156
937 Ga0495686_0406413
938 Ga0495593_0000961
939 Ga0495602_0008700
940 Ga0495602_0172098
941 Ga0495614_0016707
942 Ga0495614_0165539
943 Ga0496101_0307716
944 Ga0496102_0350782
945 Ga0496104_0252433
946 Ga0496105_0024615
947 Ga0496108_0026034
948 Ga0496109_0025388
949 Ga0496109_0131937
950 Ga0496112_0000486
951 Ga0496113_0034792
952 Ga0496113_0486957
953 Ga0496114_0226525
954 Ga0501306_005898
955 Ga0501306_006413
956 Ga0501309_016562
957 Ga0501310_008726
958 Ga0501311_013126
959 Ga0501315_010781
960 Ga0501316_009069
961 Ga0501318_007984
962 Ga0501319_005320
963 Ga0501320_005143
964 Ga0501323_012362
965 Ga0501031_0001404
966 Ga0501031_0003700
967 Ga0501031_0220065
968 Ga0501031_0227190
969 Ga0501032_0001354
970 Ga0501032_0056047
971 Ga0501032_0083447
972 Ga0501032_0173669
973 Ga0501033_0005743
974 Ga0501033_0009393
975 Ga0501033_0017067
976 Ga0501033_0029886
977 Ga0501033_0039578
978 Ga0501033_0165008
979 Ga0501034_0003199
980 Ga0501034_0020934
981 Ga0501034_0023110
982 Ga0501034_0030916
983 Ga0501034_0157379
984 Ga0501034_0334872
985 Ga0501034_0562774
986 Ga0501036_0001153
987 Ga0501036_0002718
988 Ga0501036_0029647
989 Ga0501036_0038480
990 Ga0501036_0094376
991 Ga0501036_0421756
992 Ga0501037_0001251
993 Ga0501037_0001697
994 Ga0501037_0016874
995 Ga0501037_0404175
996 Ga0501038_0000870
997 Ga0501038_0011684
998 Ga0501038_0011952
999 Ga0501039_0010092
1000 Ga0501039_0046419
1001 Ga0501039_0324511
1002 Ga0501040_0007890
1003 Ga0501041_0001249
1004 Ga0501042_0057951
1005 Ga0501042_0167073
1006 Ga0501042_0668349
1007 Ga0501043_0003900
1008 Ga0501043_0006281
1009 Ga0501043_0007294
1010 Ga0501043_0050795
1011 Ga0501046_0002857
1012 Ga0501046_0048397
1013 Ga0501047_0000025
1014 Ga0501047_0000031
1015 Ga0501047_0002182
1016 Ga0501047_0005252
1017 Ga0501047_0008544
1018 Ga0501047_0011159
1019 Ga0501047_0015981
1020 Ga0501047_0070516
1021 Ga0501047_0159191
1022 Ga0501047_0244710
1023 Ga0501047_0252173
1024 Ga0501048_0006529
1025 Ga0501048_0152718
1026 Ga0501048_0260274
1027 Ga0501067_0002728
1028 Ga0501068_0000751
1029 Ga0501068_0246235
1030 Ga0501069_0050300
1031 Ga0501070_0006937
1032 Ga0501070_0007350
1033 Ga0501070_0262197
1034 Ga0501070_0372740
1035 Ga0501071_0000873
1036 Ga0501072_0003631
1037 Ga0501073_0016451
1038 Ga0501073_0202583
1039 Ga0501074_0005791
1040 Ga0501074_0009748
1041 Ga0501076_0006283
1042 Ga0501077_0257794
1043 Ga0501079_0012558
1044 Ga0501080_0748811
1045 Ga0501035_0002332
1046 Ga0501035_0016537
1047 Ga0501035_0018777
1048 Ga0501035_0065670
1049 Ga0501035_0072937
1050 Ga0501035_0164448
1051 Ga0501035_0386165
1052 Ga0501044_0002414
1053 Ga0501044_0003111
1054 Ga0501044_0013714
1055 Ga0501044_0019719
1056 Ga0501044_0068809
1057 Ga0501044_0071847
1058 Ga0501044_0262555
1059 Ga0501044_0474108
1060 Ga0501045_0144303
1061 nmdc:mga06z11_896_c1
1062 nmdc:mga05p37_211183_c1
1063 nmdc:mga09592_338673_c1
1064 nmdc:mga0qj67_44312_c1
1065 Ga0495601_0213186
1066 Ga0500610_0070393
1067 Ga0495655_0001607
1068 Ga0495619_0108214
1069 Ga0500578_0068043
1070 Ga0500640_006124
1071 Ga0500660_115804
1072 Ga0500553_041418
1073 Ga0500553_135089
1074 Ga0500560_021192
1075 Ga0500594_0057588
1076 Ga0500652_016761
1077 Ga0500658_0008548
1078 Ga0500561_0030198
1079 Ga0500573_0002476
1080 Ga0500586_127935
1081 Ga0500600_0004832
1082 Ga0500603_071377
1083 Ga0500633_0033738
1084 Ga0500634_0079154
1085 Ga0500636_0092174
1086 Ga0500656_000635
1087 Ga0500587_006094
1088 Ga0501084_0021137
1089 Ga0501082_0001787
1090 Ga0466962_0008770
1091 Ga0466962_0019164
1092 Ga0466962_0037837
1093 Ga0466962_0063271
1094 2547412852
1095 2585304871
1096 2585319421
1097 2616701839
1098 2644269222
1099 2644436340
1100 2644625797
1101 2676496498
1102 2731907845
1103 2784587839
1104 2785344303
1105 2785368547
1106 2786669636
1107 2799184344
1108 2804844855
1109 2808841237
1110 2808919753
1111 2809231424
1112 2811848243
1113 2812359016
1114 2812481264
1115 2852641241
1116 2856743226
1117 2862288180
1118 2862385348
1119 2862509460
1120 2862580024
1121 2863405557
1122 2867371059
1123 2867431328
1124 2873156584
1125 2873318020
1126 2877681987
1127 2884701795
1128 2891396165
1129 2891558553
1130 2891568705
1131 2895439066
1132 2895446523
1133 2912720950
1134 2912725043
1135 2919468638
1136 2946066861
1137 2946075185
1138 2947230368
1139 2954003700
1140 2954387100
1141 2954688105
1142 2954697933
1143 2954704283
1144 2954717053
1145 2954727001
1146 2954734780
1147 2954753666
1148 2954764896
1149 2990061921
1150 2990094442
1151 2997608188
1152 3002998728
1153 3006398162
1154 3006500981
1155 8008559519
1156 8008579640
1157 8023630830
1158 8025419296
1159 8033687390
1160 8048408412
1161 8053950208
1162 8055068692
1163 8055177159
1164 8056836911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

54

249

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6s2q-assembly2.cif.gz_D mycobacterial hydrolase 1 0.9179 30 229
6s2q-assembly2.cif.gz_C mycobacterial hydrolase 1 0.9106 30 229
4ij6-assembly1.cif.gz_B crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine 0.909 31 226
4qih-assembly1.cif.gz_B the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 0.901 31 228
4qih-assembly1.cif.gz_A the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 0.9007 31 228
ID Description Score Start End Superfamily
4ij6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9089 31 226 3.40.50.1240
4qihB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.901 31 228 3.40.50.1240
af_P9WLH5_165_364_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8874 32 230 3.40.50.1240
af_A0A1D6QHM8_37_228_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8862 32 213 3.40.50.1240
4qihB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.884 31 228 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A6I3BNL5-F1-model_v4 Histidine phosphatase family protein 1 36 118 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A2W4L7Z0-F1-model_v4 Histidine phosphatase family protein 0.9813 37 130 GO:0005737
GO:0016791
AF-X1LSK0-F1-model_v4 Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) 0.9798 37 121 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-X0Z1D0-F1-model_v4 Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) 0.9781 37 158 GO:0004331
GO:0005829
GO:0043456
GO:0045820
AF-A0A5D0SNR0-F1-model_v4 Histidine phosphatase family protein 0.9696 31 201 GO:0005737
GO:0016791

Map