F466199
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 582 | 332 | 1164 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300044693|Ga0466961_0000785|Ga0466961_0000785_18650_19543 |
| Length | 260 |
| Sequence | VSGGDIAEPEAGGEDAGAANRLPGVDLNAGDVVDLGSGGVSPDRHAYYVTGRRIVLWRHGQTEWNMAGRLQGQTDVPLDAVGREQAQTMARLLAALRPSAIVSSDLSRAADTAQALADIVKLEVTLDEGLRETYVGTWQGLTDAEIQERFPEEYAAWRKDHYHQRRGGGEIESEVADRAVAAIERALKLVPDRGTLVVVTHGGTARVTIARLLGLPEQSTGVLGGLSNCCWSVLGEGHRGWRLLEHNAGSLPEPVFGDDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 8 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 11 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 14 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 16 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 17 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 20 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 21 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 22 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 23 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 24 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 25 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 26 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 27 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 28 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 29 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 30 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 31 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 32 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 33 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 34 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 35 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 36 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 37 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 38 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 39 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 40 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 41 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 42 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 45 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 46 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 48 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 50 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 51 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 53 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 56 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 57 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 58 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 59 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 60 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 61 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 62 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 63 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 64 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 65 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 66 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 67 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 68 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 69 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 70 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 71 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 72 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 73 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 74 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 75 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 76 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 77 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 78 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 79 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 80 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 81 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 82 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 83 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 84 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 85 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 86 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 87 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 88 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 89 | 3300042132 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 | Metagenome | Rhizosphere |
| 90 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 91 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 92 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 93 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 94 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 95 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 96 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 97 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 98 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 99 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 100 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 101 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 102 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 103 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 104 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 105 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 106 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 107 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 108 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 109 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 110 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 111 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 112 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 113 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 114 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 115 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 116 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 117 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 118 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 119 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 120 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 121 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 122 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 185 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 186 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 187 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 188 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 194 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 195 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 196 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 197 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 198 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 199 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 200 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 201 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 202 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 207 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 210 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 211 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 216 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 220 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 221 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 226 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 228 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 239 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 242 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 243 | 3300053100 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 endosphere | Metagenome | Endosphere |
| 244 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 245 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 246 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 247 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 248 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 249 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 250 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 251 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 252 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 253 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 254 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 255 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 256 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 257 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 258 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 259 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 262 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 263 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 264 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 265 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 266 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 267 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 268 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 269 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 270 | 2731639228 | Motilibacter peucedani DSM 45328 | Isolate | Rhizosphere |
| 271 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 272 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 273 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 274 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 275 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 276 | 2802429296 | Streptomyces sampsonii KJ40 | Isolate | Rhizosphere |
| 277 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 278 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 279 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 280 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 281 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 282 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 283 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 284 | 2856741275 | Microbispora triticiradicis NEAU-HRDPA2-9 | Isolate | Unclassified |
| 285 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 286 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 287 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 288 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 289 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 290 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 291 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 292 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 293 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 294 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 295 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 296 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 297 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 298 | 2891562705 | Microbispora tritici MT50 | Isolate | Unclassified |
| 299 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 300 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 301 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 302 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 303 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 304 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 305 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 306 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 307 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 308 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 309 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 310 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 311 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 312 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 313 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 314 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 315 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 316 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 317 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 318 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 319 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 320 | 3002998708 | Actinomadura barringtoniae GKU 128 | Isolate | Unclassified |
| 321 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 322 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 323 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 324 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 325 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 326 | 8025413630 | Streptomyces sp. CAI-17 | Isolate | Rhizosphere |
| 327 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 328 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 329 | 8053945823 | Actinomadura terrae OS3-83 | Isolate | Rhizosphere |
| 330 | 8055066027 | Sphaerisporangium corydalis NEAU-YHS15 | Isolate | Unclassified |
| 331 | 8055172936 | Sphaerisporangium perillae NEAU-ZS1 | Isolate | Unclassified |
| 332 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.71 |
| Metatranscriptomes | 3.09 |
| Isolates | 12.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 4.12 |
| Nodule | 0.69 |
| Rhizoplane | 2.06 |
| Rhizosphere | 80.07 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466961_0000785 | 3300044693 | Bacteria | 19929 |
| 2 | rootH2_10025259 | 3300003320 | Bacteria | 11723 |
| 3 | Ga0006562J51391_1108414 | 3300003578 | Bacteria | 3741 |
| 4 | Ga0006562J51391_1108415 | 3300003578 | Bacteria | 2210 |
| 5 | Ga0006562J51391_1196098 | 3300003578 | Bacteria | 1078 |
| 6 | Ga0006562J51391_1196099 | 3300003578 | Bacteria | 930 |
| 7 | Ga0070658_10034093 | 3300005327 | Bacteria | 4095 |
| 8 | Ga0070658_10068535 | 3300005327 | Bacteria | 2900 |
| 9 | Ga0070658_10200951 | 3300005327 | Bacteria | 1682 |
| 10 | Ga0070660_100436731 | 3300005339 | Bacteria | 1085 |
| 11 | Ga0070667_100270230 | 3300005367 | Bacteria | 1524 |
| 12 | Ga0070713_100300151 | 3300005436 | Bacteria | 1478 |
| 13 | Ga0070679_100286642 | 3300005530 | Bacteria | 1599 |
| 14 | Ga0070679_100645037 | 3300005530 | Bacteria | 1002 |
| 15 | Ga0070684_100543161 | 3300005535 | Bacteria | 1078 |
| 16 | Ga0068853_100023713 | 3300005539 | Bacteria | 5141 |
| 17 | Ga0070672_100378341 | 3300005543 | Bacteria | 1211 |
| 18 | Ga0070696_100000319 | 3300005546 | Bacteria | 29290 |
| 19 | Ga0068855_100013334 | 3300005563 | Bacteria | 9915 |
| 20 | Ga0070664_100318074 | 3300005564 | Bacteria | 1410 |
| 21 | Ga0068856_100248762 | 3300005614 | Bacteria | 1793 |
| 22 | Ga0068856_100473757 | 3300005614 | Bacteria | 1273 |
| 23 | Ga0081455_10001502 | 3300005937 | Bacteria | 28810 |
| 24 | Ga0070717_10234663 | 3300006028 | Bacteria | 1616 |
| 25 | Ga0070715_10007791 | 3300006163 | Bacteria | 3701 |
| 26 | Ga0075428_100042771 | 3300006844 | Bacteria | 4981 |
| 27 | Ga0075430_100140386 | 3300006846 | Bacteria | 2012 |
| 28 | Ga0075429_100046409 | 3300006880 | Bacteria | 3780 |
| 29 | Ga0075429_100265637 | 3300006880 | Bacteria | 1503 |
| 30 | Ga0099826_10081918 | 3300006948 | Bacteria | 2007 |
| 31 | Ga0105251_10017321 | 3300009011 | Bacteria | 3865 |
| 32 | Ga0105240_10037865 | 3300009093 | Bacteria | 6194 |
| 33 | Ga0105245_10266260 | 3300009098 | Bacteria | 1670 |
| 34 | Ga0114129_10082591 | 3300009147 | Bacteria | 4464 |
| 35 | Ga0105243_10353508 | 3300009148 | Bacteria | 1350 |
| 36 | Ga0105239_10178520 | 3300010375 | Bacteria | 2375 |
| 37 | Ga0105246_10030162 | 3300011119 | Bacteria | 3579 |
| 38 | Ga0157369_10138863 | 3300013105 | Bacteria | 2572 |
| 39 | Ga0157369_10438806 | 3300013105 | Bacteria | 1353 |
| 40 | Ga0157372_10151647 | 3300013307 | Bacteria | 2675 |
| 41 | Ga0157375_11021341 | 3300013308 | Bacteria | 966 |
| 42 | Ga0182008_10002664 | 3300014497 | Bacteria | 11077 |
| 43 | Ga0182007_10000257 | 3300015262 | Bacteria | 35765 |
| 44 | Ga0206356_11506728 | 3300020070 | Bacteria | 1560 |
| 45 | Ga0206354_11276608 | 3300020081 | Bacteria | 1412 |
| 46 | Ga0213875_10006219 | 3300021388 | Bacteria | 6292 |
| 47 | Ga0224712_10123168 | 3300022467 | Bacteria | 1125 |
| 48 | Ga0209758_1003194 | 3300025297 | Bacteria | 15296 |
| 49 | Ga0207426_1014399 | 3300025302 | Bacteria | 2897 |
| 50 | Ga0207426_1014479 | 3300025302 | Bacteria | 2887 |
| 51 | Ga0207713_1054773 | 3300025735 | Bacteria | 1561 |
| 52 | Ga0207647_10041485 | 3300025904 | Bacteria | 2893 |
| 53 | Ga0207705_10053453 | 3300025909 | Bacteria | 2909 |
| 54 | Ga0207695_10633099 | 3300025913 | Bacteria | 951 |
| 55 | Ga0207663_10062562 | 3300025916 | Bacteria | 2366 |
| 56 | Ga0207657_10217898 | 3300025919 | Bacteria | 1530 |
| 57 | Ga0207652_10173077 | 3300025921 | Bacteria | 1938 |
| 58 | Ga0207664_10032867 | 3300025929 | Bacteria | 3980 |
| 59 | Ga0207665_10002397 | 3300025939 | Bacteria | 12667 |
| 60 | Ga0207667_10082959 | 3300025949 | Bacteria | 3319 |
| 61 | Ga0207639_10028788 | 3300026041 | Bacteria | 4060 |
| 62 | Ga0207702_10515167 | 3300026078 | Bacteria | 1167 |
| 63 | Ga0209371_1012071 | 3300027312 | Bacteria | 2525 |
| 64 | Ga0209371_1044350 | 3300027312 | Bacteria | 884 |
| 65 | Ga0268266_10021285 | 3300028379 | Bacteria | 5525 |
| 66 | Ga0268266_10416959 | 3300028379 | Bacteria | 1272 |
| 67 | Ga0307517_10003835 | 3300028786 | Bacteria | 23322 |
| 68 | Ga0307517_10051657 | 3300028786 | Bacteria | 4142 |
| 69 | Ga0307515_10001149 | 3300028794 | Bacteria | 60657 |
| 70 | Ga0307515_10087927 | 3300028794 | Bacteria | 3936 |
| 71 | Ga0265338_10001308 | 3300028800 | Bacteria | 40815 |
| 72 | Ga0268256_1004756 | 3300030500 | Bacteria | 5527 |
| 73 | Ga0268256_1016424 | 3300030500 | Bacteria | 2123 |
| 74 | Ga0307511_10017850 | 3300030521 | Bacteria | 6797 |
| 75 | Ga0307511_10031583 | 3300030521 | Bacteria | 4727 |
| 76 | Ga0307511_10123730 | 3300030521 | Bacteria | 1587 |
| 77 | Ga0307512_10001899 | 3300030522 | Bacteria | 27905 |
| 78 | Ga0307512_10008535 | 3300030522 | Bacteria | 9973 |
| 79 | Ga0307512_10131706 | 3300030522 | Bacteria | 1565 |
| 80 | Ga0307513_10005208 | 3300031456 | Bacteria | 17235 |
| 81 | Ga0307513_10166215 | 3300031456 | Bacteria | 2090 |
| 82 | Ga0307509_10203736 | 3300031507 | Bacteria | 1812 |
| 83 | Ga0307509_10274444 | 3300031507 | Bacteria | 1451 |
| 84 | Ga0307509_10528956 | 3300031507 | Bacteria | 859 |
| 85 | Ga0307509_10565405 | 3300031507 | Bacteria | 813 |
| 86 | Ga0307508_10037453 | 3300031616 | Bacteria | 4361 |
| 87 | Ga0307508_10095800 | 3300031616 | Bacteria | 2559 |
| 88 | Ga0307508_10159963 | 3300031616 | Bacteria | 1855 |
| 89 | Ga0307508_10257269 | 3300031616 | Bacteria | 1341 |
| 90 | Ga0307514_10043441 | 3300031649 | Bacteria | 3529 |
| 91 | Ga0307514_10134388 | 3300031649 | Bacteria | 1696 |
| 92 | Ga0307514_10205864 | 3300031649 | Bacteria | 1229 |
| 93 | Ga0307514_10354625 | 3300031649 | Bacteria | 779 |
| 94 | Ga0316576_10329357 | 3300031727 | Bacteria | 1138 |
| 95 | Ga0307516_10007342 | 3300031730 | Bacteria | 12687 |
| 96 | Ga0307516_10019837 | 3300031730 | Bacteria | 6952 |
| 97 | Ga0307516_10063363 | 3300031730 | Bacteria | 3579 |
| 98 | Ga0307516_10236616 | 3300031730 | Bacteria | 1527 |
| 99 | Ga0307411_10826959 | 3300032005 | Bacteria | 818 |
| 100 | Ga0307507_10000024 | 3300033179 | Bacteria | 212340 |
| 101 | Ga0307507_10189819 | 3300033179 | Bacteria | 1447 |
| 102 | Ga0307510_10020096 | 3300033180 | Bacteria | 7816 |
| 103 | Ga0373926_0013159 | 3300035083 | Bacteria | 2803 |
| 104 | Ga0373925_0002102 | 3300037068 | Bacteria | 16346 |
| 105 | Ga0395900_0072481 | 3300037418 | Bacteria | 3541 |
| 106 | Ga0395900_0343322 | 3300037418 | Bacteria | 1468 |
| 107 | Ga0395900_0623746 | 3300037418 | Bacteria | 1017 |
| 108 | Ga0395900_0794876 | 3300037418 | Bacteria | 874 |
| 109 | Ga0395898_0002277 | 3300037466 | Bacteria | 23180 |
| 110 | Ga0395898_0047547 | 3300037466 | Bacteria | 4210 |
| 111 | Ga0395898_0068337 | 3300037466 | Bacteria | 3438 |
| 112 | Ga0395905_0150347 | 3300037471 | Bacteria | 2191 |
| 113 | Ga0395905_0173947 | 3300037471 | Bacteria | 2022 |
| 114 | Ga0436364_1043328 | 3300037853 | Bacteria | 10028 |
| 115 | Ga0395901_0170452 | 3300038443 | Bacteria | 2284 |
| 116 | Ga0395901_0272691 | 3300038443 | Bacteria | 1759 |
| 117 | Ga0395901_0290618 | 3300038443 | Bacteria | 1696 |
| 118 | Ga0395901_0803436 | 3300038443 | Bacteria | 929 |
| 119 | Ga0439436_0000415 | 3300041404 | Bacteria | 10718 |
| 120 | Ga0439436_0004869 | 3300041404 | Bacteria | 4120 |
| 121 | Ga0439439_0005044 | 3300041406 | Bacteria | 3000 |
| 122 | Ga0451802_2066529 | 3300041460 | Bacteria | 1467 |
| 123 | Ga0451853_1066400 | 3300041512 | Bacteria | 11292 |
| 124 | Ga0451853_3574142 | 3300041512 | Bacteria | 779 |
| 125 | Ga0451853_4001808 | 3300041512 | Bacteria | 1046 |
| 126 | Ga0439433_0000725 | 3300041999 | Bacteria | 6434 |
| 127 | Ga0439433_0003607 | 3300041999 | Bacteria | 3328 |
| 128 | Ga0439442_006208 | 3300042002 | Bacteria | 2397 |
| 129 | Ga0439442_014223 | 3300042002 | Bacteria | 1637 |
| 130 | Ga0439448_0001643 | 3300042005 | Bacteria | 5856 |
| 131 | Ga0439449_0001870 | 3300042007 | Bacteria | 8285 |
| 132 | Ga0439449_0041752 | 3300042007 | Bacteria | 1705 |
| 133 | Ga0439449_0046804 | 3300042007 | Bacteria | 1602 |
| 134 | Ga0439455_0001561 | 3300042012 | Bacteria | 3885 |
| 135 | Ga0439457_000038 | 3300042014 | Bacteria | 28052 |
| 136 | Ga0439457_015535 | 3300042014 | Bacteria | 1699 |
| 137 | Ga0439462_0043435 | 3300042015 | Bacteria | 1201 |
| 138 | Ga0450894_000092 | 3300042131 | Bacteria | 14871 |
| 139 | Ga0450895_001832 | 3300042132 | Bacteria | 1528 |
| 140 | Ga0450898_001309 | 3300042134 | Bacteria | 3248 |
| 141 | Ga0450898_046848 | 3300042134 | Bacteria | 828 |
| 142 | Ga0450899_000182 | 3300042135 | Bacteria | 6303 |
| 143 | Ga0450900_012150 | 3300042136 | Bacteria | 1126 |
| 144 | Ga0450906_000810 | 3300042145 | Bacteria | 6865 |
| 145 | Ga0439458_0000330 | 3300042157 | Bacteria | 11809 |
| 146 | Ga0439458_0106072 | 3300042157 | Bacteria | 732 |
| 147 | Ga0466969_0006625 | 3300044656 | Bacteria | 6155 |
| 148 | Ga0466969_0016499 | 3300044656 | Bacteria | 3865 |
| 149 | Ga0466969_0072603 | 3300044656 | Bacteria | 1652 |
| 150 | Ga0466972_0009322 | 3300044658 | Bacteria | 4934 |
| 151 | Ga0466972_0027952 | 3300044658 | Bacteria | 2787 |
| 152 | Ga0466972_0058494 | 3300044658 | Bacteria | 1850 |
| 153 | Ga0466972_0223814 | 3300044658 | Bacteria | 880 |
| 154 | Ga0466965_0015598 | 3300044683 | Bacteria | 3609 |
| 155 | Ga0466965_0060639 | 3300044683 | Bacteria | 1890 |
| 156 | Ga0466966_0005141 | 3300044684 | Bacteria | 8593 |
| 157 | Ga0466966_0021483 | 3300044684 | Bacteria | 4238 |
| 158 | Ga0466966_0052729 | 3300044684 | Bacteria | 2582 |
| 159 | Ga0466966_0442399 | 3300044684 | Bacteria | 781 |
| 160 | Ga0466961_0004261 | 3300044693 | Bacteria | 8953 |
| 161 | Ga0466961_0044552 | 3300044693 | Bacteria | 2839 |
| 162 | Ga0466961_0051397 | 3300044693 | Bacteria | 2632 |
| 163 | Ga0466963_0004350 | 3300044694 | Bacteria | 8222 |
| 164 | Ga0466963_0004527 | 3300044694 | Bacteria | 8094 |
| 165 | Ga0466963_0014560 | 3300044694 | Bacteria | 4853 |
| 166 | Ga0466963_0263836 | 3300044694 | Bacteria | 1209 |
| 167 | Ga0466964_0026835 | 3300044706 | Bacteria | 2256 |
| 168 | Ga0466971_0000499 | 3300044719 | Bacteria | 15385 |
| 169 | Ga0466971_0063659 | 3300044719 | Bacteria | 1669 |
| 170 | Ga0466971_0106939 | 3300044719 | Bacteria | 1289 |
| 171 | Ga0466971_0175276 | 3300044719 | Bacteria | 1007 |
| 172 | Ga0466968_0099072 | 3300044735 | Bacteria | 1299 |
| 173 | Ga0466968_0114842 | 3300044735 | Bacteria | 1214 |
| 174 | Ga0466970_0002580 | 3300044765 | Bacteria | 8736 |
| 175 | Ga0466970_0013053 | 3300044765 | Bacteria | 4257 |
| 176 | Ga0466970_0032563 | 3300044765 | Bacteria | 2754 |
| 177 | Ga0466970_0128406 | 3300044765 | Bacteria | 1391 |
| 178 | Ga0466957_0002868 | 3300044842 | Bacteria | 9336 |
| 179 | Ga0466957_0190537 | 3300044842 | Bacteria | 1343 |
| 180 | Ga0466960_0009571 | 3300044901 | Bacteria | 3999 |
| 181 | Ga0466960_0041466 | 3300044901 | Bacteria | 2181 |
| 182 | Ga0466959_0000705 | 3300045049 | Bacteria | 19526 |
| 183 | Ga0466959_0009945 | 3300045049 | Bacteria | 6780 |
| 184 | Ga0466959_0019398 | 3300045049 | Bacteria | 5001 |
| 185 | Ga0466959_0106178 | 3300045049 | Bacteria | 2008 |
| 186 | Ga0466959_0214349 | 3300045049 | Bacteria | 1337 |
| 187 | Ga0466958_0001314 | 3300045836 | Bacteria | 11712 |
| 188 | Ga0466958_0135560 | 3300045836 | Bacteria | 1548 |
| 189 | Ga0466958_0138693 | 3300045836 | Bacteria | 1530 |
| 190 | Ga0466958_0205310 | 3300045836 | Bacteria | 1254 |
| 191 | Ga0466967_0001824 | 3300045976 | Bacteria | 12808 |
| 192 | Ga0466967_0036387 | 3300045976 | Bacteria | 4202 |
| 193 | Ga0466967_0182496 | 3300045976 | Bacteria | 1980 |
| 194 | Ga0495617_068547 | 3300046452 | Bacteria | 1167 |
| 195 | Ga0495592_0001663 | 3300046454 | Bacteria | 15578 |
| 196 | Ga0495592_0165381 | 3300046454 | Bacteria | 1519 |
| 197 | Ga0495592_0307192 | 3300046454 | Bacteria | 1029 |
| 198 | Ga0495603_0003752 | 3300046455 | Bacteria | 9033 |
| 199 | Ga0495603_0006258 | 3300046455 | Bacteria | 7115 |
| 200 | Ga0495603_0015271 | 3300046455 | Bacteria | 4646 |
| 201 | Ga0495590_0062019 | 3300046457 | Bacteria | 1309 |
| 202 | Ga0495590_0066254 | 3300046457 | Bacteria | 1264 |
| 203 | Ga0495629_0042359 | 3300046459 | Bacteria | 3200 |
| 204 | Ga0495629_0119604 | 3300046459 | Bacteria | 1835 |
| 205 | Ga0495629_0159420 | 3300046459 | Bacteria | 1567 |
| 206 | Ga0495629_0165656 | 3300046459 | Bacteria | 1535 |
| 207 | Ga0495629_0299031 | 3300046459 | Bacteria | 1102 |
| 208 | Ga0495638_0044500 | 3300046460 | Bacteria | 2796 |
| 209 | Ga0495638_0189176 | 3300046460 | Bacteria | 1169 |
| 210 | Ga0495651_0000382 | 3300046462 | Bacteria | 34395 |
| 211 | Ga0495651_0000984 | 3300046462 | Bacteria | 22098 |
| 212 | Ga0495651_0113298 | 3300046462 | Bacteria | 2002 |
| 213 | Ga0495651_0141601 | 3300046462 | Bacteria | 1743 |
| 214 | Ga0495580_0296051 | 3300046472 | Bacteria | 1102 |
| 215 | Ga0495582_0027486 | 3300046473 | Bacteria | 3119 |
| 216 | Ga0495605_0078047 | 3300046474 | Bacteria | 1553 |
| 217 | Ga0495639_0052399 | 3300046475 | Bacteria | 1857 |
| 218 | Ga0495639_0266946 | 3300046475 | Bacteria | 849 |
| 219 | Ga0495662_0000634 | 3300046476 | Bacteria | 16387 |
| 220 | Ga0495662_0083968 | 3300046476 | Bacteria | 1550 |
| 221 | Ga0495662_0113007 | 3300046476 | Bacteria | 1331 |
| 222 | Ga0495664_0001800 | 3300046477 | Bacteria | 11386 |
| 223 | Ga0495664_0377549 | 3300046477 | Bacteria | 852 |
| 224 | Ga0495585_0085805 | 3300046492 | Bacteria | 1701 |
| 225 | Ga0495585_0194393 | 3300046492 | Bacteria | 1036 |
| 226 | Ga0495594_0004347 | 3300046499 | Bacteria | 7292 |
| 227 | Ga0495594_0018978 | 3300046499 | Bacteria | 3650 |
| 228 | Ga0495594_0086998 | 3300046499 | Bacteria | 1748 |
| 229 | Ga0495594_0140381 | 3300046499 | Bacteria | 1370 |
| 230 | Ga0495594_0281256 | 3300046499 | Bacteria | 948 |
| 231 | Ga0495596_0047092 | 3300046500 | Bacteria | 1692 |
| 232 | Ga0495583_0018789 | 3300046506 | Bacteria | 3628 |
| 233 | Ga0495583_0063885 | 3300046506 | Bacteria | 1634 |
| 234 | Ga0495606_0036359 | 3300046507 | Bacteria | 3354 |
| 235 | Ga0495608_0260253 | 3300046511 | Bacteria | 1080 |
| 236 | Ga0495610_0008225 | 3300046512 | Bacteria | 6794 |
| 237 | Ga0495616_0005243 | 3300046513 | Bacteria | 8005 |
| 238 | Ga0495618_0052952 | 3300046514 | Bacteria | 2566 |
| 239 | Ga0495618_0097679 | 3300046514 | Bacteria | 1879 |
| 240 | Ga0495620_0042762 | 3300046515 | Bacteria | 1977 |
| 241 | Ga0495620_0057791 | 3300046515 | Bacteria | 1626 |
| 242 | Ga0495628_0010264 | 3300046516 | Bacteria | 7965 |
| 243 | Ga0495628_0022365 | 3300046516 | Bacteria | 5194 |
| 244 | Ga0495628_0054678 | 3300046516 | Bacteria | 3146 |
| 245 | Ga0495628_0138112 | 3300046516 | Bacteria | 1861 |
| 246 | Ga0495628_0279311 | 3300046516 | Bacteria | 1240 |
| 247 | Ga0495630_0025726 | 3300046517 | Bacteria | 4353 |
| 248 | Ga0495631_0009437 | 3300046518 | Bacteria | 4877 |
| 249 | Ga0495631_0067577 | 3300046518 | Bacteria | 1546 |
| 250 | Ga0495632_0078839 | 3300046519 | Bacteria | 1573 |
| 251 | Ga0495643_0000999 | 3300046522 | Bacteria | 28874 |
| 252 | Ga0495643_0061441 | 3300046522 | Bacteria | 1992 |
| 253 | Ga0495643_0204474 | 3300046522 | Bacteria | 946 |
| 254 | Ga0495666_0014060 | 3300046526 | Bacteria | 3991 |
| 255 | Ga0495666_0142536 | 3300046526 | Bacteria | 1116 |
| 256 | Ga0495666_0158333 | 3300046526 | Bacteria | 1051 |
| 257 | Ga0495642_0116641 | 3300046528 | Bacteria | 1144 |
| 258 | Ga0495652_0000991 | 3300046529 | Bacteria | 32501 |
| 259 | Ga0495652_0009088 | 3300046529 | Bacteria | 9044 |
| 260 | Ga0495652_0024424 | 3300046529 | Bacteria | 5349 |
| 261 | Ga0495652_0120628 | 3300046529 | Bacteria | 2092 |
| 262 | Ga0495654_0016773 | 3300046530 | Bacteria | 3861 |
| 263 | Ga0495640_0002942 | 3300046533 | Bacteria | 13719 |
| 264 | Ga0495640_0046882 | 3300046533 | Bacteria | 2992 |
| 265 | Ga0495640_0139515 | 3300046533 | Bacteria | 1563 |
| 266 | Ga0495640_0184943 | 3300046533 | Bacteria | 1326 |
| 267 | Ga0495640_0316973 | 3300046533 | Bacteria | 966 |
| 268 | Ga0495587_0000643 | 3300046536 | Bacteria | 23431 |
| 269 | Ga0495597_0045768 | 3300046542 | Bacteria | 1940 |
| 270 | Ga0495597_0087713 | 3300046542 | Bacteria | 1323 |
| 271 | Ga0495645_0011885 | 3300046543 | Bacteria | 6136 |
| 272 | Ga0495645_0015783 | 3300046543 | Bacteria | 5377 |
| 273 | Ga0495645_0103617 | 3300046543 | Bacteria | 2021 |
| 274 | Ga0495645_0259587 | 3300046543 | Bacteria | 1151 |
| 275 | Ga0495622_0004333 | 3300046557 | Bacteria | 6606 |
| 276 | Ga0495622_0027513 | 3300046557 | Bacteria | 2654 |
| 277 | Ga0495622_0095175 | 3300046557 | Bacteria | 1367 |
| 278 | Ga0495622_0113529 | 3300046557 | Bacteria | 1239 |
| 279 | Ga0495667_0084315 | 3300046559 | Bacteria | 2063 |
| 280 | Ga0495656_0142794 | 3300046615 | Bacteria | 1150 |
| 281 | Ga0495668_0023182 | 3300046616 | Bacteria | 3542 |
| 282 | Ga0495668_0138434 | 3300046616 | Bacteria | 1332 |
| 283 | Ga0495634_0003674 | 3300046642 | Bacteria | 12239 |
| 284 | Ga0495634_0033374 | 3300046642 | Bacteria | 3537 |
| 285 | Ga0495611_0039223 | 3300046648 | Bacteria | 2108 |
| 286 | Ga0495611_0119888 | 3300046648 | Bacteria | 1226 |
| 287 | Ga0495625_0015286 | 3300046660 | Bacteria | 6083 |
| 288 | Ga0495625_0021903 | 3300046660 | Bacteria | 4908 |
| 289 | Ga0495635_0001049 | 3300046663 | Bacteria | 18303 |
| 290 | Ga0495635_0021203 | 3300046663 | Bacteria | 4529 |
| 291 | Ga0495635_0068480 | 3300046663 | Bacteria | 2434 |
| 292 | Ga0495635_0256154 | 3300046663 | Bacteria | 1179 |
| 293 | Ga0495661_0008094 | 3300046665 | Bacteria | 7293 |
| 294 | Ga0495588_0014849 | 3300046674 | Bacteria | 3737 |
| 295 | Ga0495588_0241013 | 3300046674 | Bacteria | 954 |
| 296 | Ga0495657_0006445 | 3300046675 | Bacteria | 9183 |
| 297 | Ga0495657_0027804 | 3300046675 | Bacteria | 3986 |
| 298 | Ga0495599_0103598 | 3300046678 | Bacteria | 1773 |
| 299 | Ga0495623_0021867 | 3300046679 | Bacteria | 4130 |
| 300 | Ga0495623_0103982 | 3300046679 | Bacteria | 1727 |
| 301 | Ga0495646_0000782 | 3300046680 | Bacteria | 17783 |
| 302 | Ga0495646_0002348 | 3300046680 | Bacteria | 11582 |
| 303 | Ga0495613_0001126 | 3300046689 | Bacteria | 20354 |
| 304 | Ga0495613_0057945 | 3300046689 | Bacteria | 2844 |
| 305 | Ga0495613_0078050 | 3300046689 | Bacteria | 2409 |
| 306 | Ga0495624_0148664 | 3300046690 | Bacteria | 1433 |
| 307 | Ga0495670_0002468 | 3300046691 | Bacteria | 9125 |
| 308 | Ga0495670_0026173 | 3300046691 | Bacteria | 2888 |
| 309 | Ga0495671_0107665 | 3300046692 | Bacteria | 1361 |
| 310 | Ga0495649_0129725 | 3300046694 | Bacteria | 1330 |
| 311 | Ga0495649_0144000 | 3300046694 | Bacteria | 1253 |
| 312 | Ga0495589_0107793 | 3300046794 | Bacteria | 1345 |
| 313 | Ga0495589_0109526 | 3300046794 | Bacteria | 1333 |
| 314 | Ga0495589_0143026 | 3300046794 | Bacteria | 1144 |
| 315 | Ga0495589_0160524 | 3300046794 | Bacteria | 1071 |
| 316 | Ga0495600_0000527 | 3300046809 | Bacteria | 19849 |
| 317 | Ga0495600_0015370 | 3300046809 | Bacteria | 4839 |
| 318 | Ga0495600_0121535 | 3300046809 | Bacteria | 1698 |
| 319 | Ga0495600_0206360 | 3300046809 | Bacteria | 1260 |
| 320 | Ga0495660_0070556 | 3300046810 | Bacteria | 1854 |
| 321 | Ga0495581_0019710 | 3300047315 | Bacteria | 3915 |
| 322 | Ga0495581_0081056 | 3300047315 | Bacteria | 1879 |
| 323 | Ga0495604_0002748 | 3300047317 | Bacteria | 14109 |
| 324 | Ga0495604_0014507 | 3300047317 | Bacteria | 6283 |
| 325 | Ga0495604_0335578 | 3300047317 | Bacteria | 1007 |
| 326 | Ga0495636_0014080 | 3300047318 | Bacteria | 3179 |
| 327 | Ga0495636_0018933 | 3300047318 | Bacteria | 2764 |
| 328 | Ga0495636_0066999 | 3300047318 | Bacteria | 1527 |
| 329 | Ga0495674_0034274 | 3300047319 | Bacteria | 4592 |
| 330 | Ga0495674_0038786 | 3300047319 | Bacteria | 4274 |
| 331 | Ga0495672_0165805 | 3300047320 | Bacteria | 1131 |
| 332 | Ga0495676_0024401 | 3300047321 | Bacteria | 5235 |
| 333 | Ga0495676_0039911 | 3300047321 | Bacteria | 3881 |
| 334 | Ga0495676_0320428 | 3300047321 | Bacteria | 1041 |
| 335 | Ga0495680_0002771 | 3300047322 | Bacteria | 17676 |
| 336 | Ga0495683_0031381 | 3300047323 | Bacteria | 2708 |
| 337 | Ga0495687_005037 | 3300047443 | Bacteria | 8614 |
| 338 | Ga0495687_005042 | 3300047443 | Bacteria | 8606 |
| 339 | Ga0495687_007978 | 3300047443 | Bacteria | 6140 |
| 340 | Ga0495675_0074698 | 3300047444 | Bacteria | 2136 |
| 341 | Ga0495675_0094094 | 3300047444 | Bacteria | 1879 |
| 342 | Ga0495685_001515 | 3300047447 | Bacteria | 7119 |
| 343 | Ga0495685_006081 | 3300047447 | Bacteria | 3949 |
| 344 | Ga0495685_010126 | 3300047447 | Bacteria | 3159 |
| 345 | Ga0495685_025013 | 3300047447 | Bacteria | 2055 |
| 346 | Ga0495685_064340 | 3300047447 | Bacteria | 1233 |
| 347 | Ga0495681_0002625 | 3300047470 | Bacteria | 12773 |
| 348 | Ga0495681_0006932 | 3300047470 | Bacteria | 7345 |
| 349 | Ga0495681_0009811 | 3300047470 | Bacteria | 5856 |
| 350 | Ga0495681_0148071 | 3300047470 | Bacteria | 987 |
| 351 | Ga0495684_0081170 | 3300047471 | Bacteria | 2461 |
| 352 | Ga0495686_0011886 | 3300047472 | Bacteria | 6120 |
| 353 | Ga0495686_0027231 | 3300047472 | Bacteria | 3734 |
| 354 | Ga0495686_0194156 | 3300047472 | Bacteria | 1168 |
| 355 | Ga0495686_0406413 | 3300047472 | Bacteria | 730 |
| 356 | Ga0495593_0000961 | 3300047673 | Bacteria | 16873 |
| 357 | Ga0495602_0008700 | 3300048088 | Bacteria | 10594 |
| 358 | Ga0495602_0172098 | 3300048088 | Bacteria | 1680 |
| 359 | Ga0495614_0016707 | 3300048089 | Bacteria | 3192 |
| 360 | Ga0495614_0165539 | 3300048089 | Bacteria | 990 |
| 361 | Ga0496101_0307716 | 3300048904 | Bacteria | 1242 |
| 362 | Ga0496102_0350782 | 3300048905 | Bacteria | 1389 |
| 363 | Ga0496104_0252433 | 3300048907 | Bacteria | 1676 |
| 364 | Ga0496105_0024615 | 3300048908 | Bacteria | 4892 |
| 365 | Ga0496108_0026034 | 3300048911 | Bacteria | 4825 |
| 366 | Ga0496109_0025388 | 3300048912 | Bacteria | 5280 |
| 367 | Ga0496109_0131937 | 3300048912 | Bacteria | 2332 |
| 368 | Ga0496112_0000486 | 3300048915 | Bacteria | 26671 |
| 369 | Ga0496113_0034792 | 3300048916 | Bacteria | 3679 |
| 370 | Ga0496113_0486957 | 3300048916 | Bacteria | 991 |
| 371 | Ga0496114_0226525 | 3300048917 | Bacteria | 1642 |
| 372 | Ga0501306_005898 | 3300049127 | Bacteria | 1420 |
| 373 | Ga0501306_006413 | 3300049127 | Bacteria | 1379 |
| 374 | Ga0501309_016562 | 3300049129 | Bacteria | 1006 |
| 375 | Ga0501310_008726 | 3300049130 | Bacteria | 1105 |
| 376 | Ga0501311_013126 | 3300049527 | Bacteria | 1042 |
| 377 | Ga0501315_010781 | 3300049531 | Bacteria | 1105 |
| 378 | Ga0501316_009069 | 3300049532 | Bacteria | 1110 |
| 379 | Ga0501318_007984 | 3300049534 | Bacteria | 1120 |
| 380 | Ga0501319_005320 | 3300049535 | Bacteria | 921 |
| 381 | Ga0501320_005143 | 3300049536 | Bacteria | 1182 |
| 382 | Ga0501323_012362 | 3300049539 | Bacteria | 1042 |
| 383 | Ga0501031_0001404 | 3300049568 | Bacteria | 14894 |
| 384 | Ga0501031_0003700 | 3300049568 | Bacteria | 9836 |
| 385 | Ga0501031_0220065 | 3300049568 | Bacteria | 1236 |
| 386 | Ga0501031_0227190 | 3300049568 | Bacteria | 1215 |
| 387 | Ga0501032_0001354 | 3300049569 | Bacteria | 19476 |
| 388 | Ga0501032_0056047 | 3300049569 | Bacteria | 2650 |
| 389 | Ga0501032_0083447 | 3300049569 | Bacteria | 2125 |
| 390 | Ga0501032_0173669 | 3300049569 | Bacteria | 1412 |
| 391 | Ga0501033_0005743 | 3300049570 | Bacteria | 9775 |
| 392 | Ga0501033_0009393 | 3300049570 | Bacteria | 7530 |
| 393 | Ga0501033_0017067 | 3300049570 | Bacteria | 5487 |
| 394 | Ga0501033_0029886 | 3300049570 | Bacteria | 4095 |
| 395 | Ga0501033_0039578 | 3300049570 | Bacteria | 3521 |
| 396 | Ga0501033_0165008 | 3300049570 | Bacteria | 1593 |
| 397 | Ga0501034_0003199 | 3300049571 | Bacteria | 18801 |
| 398 | Ga0501034_0020934 | 3300049571 | Bacteria | 6676 |
| 399 | Ga0501034_0023110 | 3300049571 | Bacteria | 6336 |
| 400 | Ga0501034_0030916 | 3300049571 | Bacteria | 5442 |
| 401 | Ga0501034_0157379 | 3300049571 | Bacteria | 2245 |
| 402 | Ga0501034_0334872 | 3300049571 | Bacteria | 1444 |
| 403 | Ga0501034_0562774 | 3300049571 | Bacteria | 1048 |
| 404 | Ga0501036_0001153 | 3300049572 | Bacteria | 20096 |
| 405 | Ga0501036_0002718 | 3300049572 | Bacteria | 13979 |
| 406 | Ga0501036_0029647 | 3300049572 | Bacteria | 4621 |
| 407 | Ga0501036_0038480 | 3300049572 | Bacteria | 4049 |
| 408 | Ga0501036_0094376 | 3300049572 | Bacteria | 2528 |
| 409 | Ga0501036_0421756 | 3300049572 | Bacteria | 1112 |
| 410 | Ga0501037_0001251 | 3300049573 | Bacteria | 18721 |
| 411 | Ga0501037_0001697 | 3300049573 | Bacteria | 15984 |
| 412 | Ga0501037_0016874 | 3300049573 | Bacteria | 5372 |
| 413 | Ga0501037_0404175 | 3300049573 | Bacteria | 936 |
| 414 | Ga0501038_0000870 | 3300049574 | Bacteria | 26736 |
| 415 | Ga0501038_0011684 | 3300049574 | Bacteria | 8009 |
| 416 | Ga0501038_0011952 | 3300049574 | Bacteria | 7926 |
| 417 | Ga0501039_0010092 | 3300049575 | Bacteria | 7194 |
| 418 | Ga0501039_0046419 | 3300049575 | Bacteria | 3355 |
| 419 | Ga0501039_0324511 | 3300049575 | Bacteria | 1210 |
| 420 | Ga0501040_0007890 | 3300049576 | Bacteria | 6900 |
| 421 | Ga0501041_0001249 | 3300049577 | Bacteria | 13940 |
| 422 | Ga0501042_0057951 | 3300049578 | Bacteria | 2764 |
| 423 | Ga0501042_0167073 | 3300049578 | Bacteria | 1587 |
| 424 | Ga0501042_0668349 | 3300049578 | Bacteria | 755 |
| 425 | Ga0501043_0003900 | 3300049579 | Bacteria | 12244 |
| 426 | Ga0501043_0006281 | 3300049579 | Bacteria | 9538 |
| 427 | Ga0501043_0007294 | 3300049579 | Bacteria | 8775 |
| 428 | Ga0501043_0050795 | 3300049579 | Bacteria | 3259 |
| 429 | Ga0501046_0002857 | 3300049580 | Bacteria | 16064 |
| 430 | Ga0501046_0048397 | 3300049580 | Bacteria | 3366 |
| 431 | Ga0501047_0000025 | 3300049581 | Bacteria | 225560 |
| 432 | Ga0501047_0000031 | 3300049581 | Bacteria | 215903 |
| 433 | Ga0501047_0002182 | 3300049581 | Bacteria | 18725 |
| 434 | Ga0501047_0005252 | 3300049581 | Bacteria | 12167 |
| 435 | Ga0501047_0008544 | 3300049581 | Bacteria | 9661 |
| 436 | Ga0501047_0011159 | 3300049581 | Bacteria | 8504 |
| 437 | Ga0501047_0015981 | 3300049581 | Bacteria | 7156 |
| 438 | Ga0501047_0070516 | 3300049581 | Bacteria | 3365 |
| 439 | Ga0501047_0159191 | 3300049581 | Bacteria | 2130 |
| 440 | Ga0501047_0244710 | 3300049581 | Bacteria | 1643 |
| 441 | Ga0501047_0252173 | 3300049581 | Bacteria | 1613 |
| 442 | Ga0501048_0006529 | 3300049582 | Bacteria | 8866 |
| 443 | Ga0501048_0152718 | 3300049582 | Bacteria | 1633 |
| 444 | Ga0501048_0260274 | 3300049582 | Bacteria | 1233 |
| 445 | Ga0501067_0002728 | 3300049583 | Bacteria | 9715 |
| 446 | Ga0501068_0000751 | 3300049584 | Bacteria | 16633 |
| 447 | Ga0501068_0246235 | 3300049584 | Bacteria | 1138 |
| 448 | Ga0501069_0050300 | 3300049585 | Bacteria | 2317 |
| 449 | Ga0501070_0006937 | 3300049586 | Bacteria | 9633 |
| 450 | Ga0501070_0007350 | 3300049586 | Bacteria | 9353 |
| 451 | Ga0501070_0262197 | 3300049586 | Bacteria | 1412 |
| 452 | Ga0501070_0372740 | 3300049586 | Bacteria | 1157 |
| 453 | Ga0501071_0000873 | 3300049587 | Bacteria | 16278 |
| 454 | Ga0501072_0003631 | 3300049588 | Bacteria | 11610 |
| 455 | Ga0501073_0016451 | 3300049589 | Bacteria | 5360 |
| 456 | Ga0501073_0202583 | 3300049589 | Bacteria | 1372 |
| 457 | Ga0501074_0005791 | 3300049590 | Bacteria | 8914 |
| 458 | Ga0501074_0009748 | 3300049590 | Bacteria | 6973 |
| 459 | Ga0501076_0006283 | 3300049592 | Bacteria | 8610 |
| 460 | Ga0501077_0257794 | 3300049593 | Bacteria | 1109 |
| 461 | Ga0501079_0012558 | 3300049741 | Bacteria | 6467 |
| 462 | Ga0501080_0748811 | 3300049742 | Bacteria | 859 |
| 463 | Ga0501035_0002332 | 3300049822 | Bacteria | 18716 |
| 464 | Ga0501035_0016537 | 3300049822 | Bacteria | 6801 |
| 465 | Ga0501035_0018777 | 3300049822 | Bacteria | 6368 |
| 466 | Ga0501035_0065670 | 3300049822 | Bacteria | 3221 |
| 467 | Ga0501035_0072937 | 3300049822 | Bacteria | 3037 |
| 468 | Ga0501035_0164448 | 3300049822 | Bacteria | 1919 |
| 469 | Ga0501035_0386165 | 3300049822 | Bacteria | 1167 |
| 470 | Ga0501044_0002414 | 3300049823 | Bacteria | 21312 |
| 471 | Ga0501044_0003111 | 3300049823 | Bacteria | 18802 |
| 472 | Ga0501044_0013714 | 3300049823 | Bacteria | 8759 |
| 473 | Ga0501044_0019719 | 3300049823 | Bacteria | 7205 |
| 474 | Ga0501044_0068809 | 3300049823 | Bacteria | 3605 |
| 475 | Ga0501044_0071847 | 3300049823 | Bacteria | 3519 |
| 476 | Ga0501044_0262555 | 3300049823 | Bacteria | 1665 |
| 477 | Ga0501044_0474108 | 3300049823 | Bacteria | 1155 |
| 478 | Ga0501045_0144303 | 3300049824 | Bacteria | 1770 |
| 479 | nmdc:mga06z11_896_c1 | 3300050494 | Bacteria | 10843 |
| 480 | nmdc:mga05p37_211183_c1 | 3300050507 | Bacteria | 2346 |
| 481 | nmdc:mga09592_338673_c1 | 3300050508 | Bacteria | 1302 |
| 482 | nmdc:mga0qj67_44312_c1 | 3300050509 | Bacteria | 3505 |
| 483 | Ga0495601_0213186 | 3300053077 | Bacteria | 1261 |
| 484 | Ga0500610_0070393 | 3300053079 | Bacteria | 1824 |
| 485 | Ga0495655_0001607 | 3300053083 | Bacteria | 3483 |
| 486 | Ga0495619_0108214 | 3300053085 | Bacteria | 1897 |
| 487 | Ga0500578_0068043 | 3300053086 | Bacteria | 2270 |
| 488 | Ga0500640_006124 | 3300053095 | Bacteria | 4563 |
| 489 | Ga0500660_115804 | 3300053100 | Bacteria | 1130 |
| 490 | Ga0500553_041418 | 3300053101 | Bacteria | 2256 |
| 491 | Ga0500553_135089 | 3300053101 | Bacteria | 985 |
| 492 | Ga0500560_021192 | 3300053107 | Bacteria | 1854 |
| 493 | Ga0500594_0057588 | 3300053118 | Bacteria | 1112 |
| 494 | Ga0500652_016761 | 3300053131 | Bacteria | 2673 |
| 495 | Ga0500658_0008548 | 3300053134 | Bacteria | 3781 |
| 496 | Ga0500561_0030198 | 3300053137 | Bacteria | 1359 |
| 497 | Ga0500573_0002476 | 3300053140 | Bacteria | 9241 |
| 498 | Ga0500586_127935 | 3300053145 | Bacteria | 881 |
| 499 | Ga0500600_0004832 | 3300053149 | Bacteria | 7919 |
| 500 | Ga0500603_071377 | 3300053150 | Bacteria | 990 |
| 501 | Ga0500633_0033738 | 3300053160 | Bacteria | 1672 |
| 502 | Ga0500634_0079154 | 3300053161 | Bacteria | 1698 |
| 503 | Ga0500636_0092174 | 3300053177 | Bacteria | 1734 |
| 504 | Ga0500656_000635 | 3300053732 | Bacteria | 2703 |
| 505 | Ga0500587_006094 | 3300053739 | Bacteria | 1610 |
| 506 | Ga0501084_0021137 | 3300054114 | Bacteria | 5427 |
| 507 | Ga0501082_0001787 | 3300060353 | Bacteria | 18906 |
| 508 | Ga0466962_0008770 | 3300061719 | Bacteria | 4847 |
| 509 | Ga0466962_0019164 | 3300061719 | Bacteria | 3285 |
| 510 | Ga0466962_0037837 | 3300061719 | Bacteria | 2311 |
| 511 | Ga0466962_0063271 | 3300061719 | Bacteria | 1766 |
| 512 | 2547412852 | 2547132111 | Bacteria | 8013147 |
| 513 | 2585304871 | 2582581313 | Bacteria | 10042643 |
| 514 | 2585319421 | 2582581314 | Bacteria | 11452267 |
| 515 | 2616701839 | 2616644814 | Bacteria | 11555299 |
| 516 | 2644269222 | 2643221647 | Bacteria | 10741251 |
| 517 | 2644436340 | 2643221678 | Bacteria | 9540101 |
| 518 | 2644625797 | 2643221714 | Bacteria | 9015452 |
| 519 | 2676496498 | 2675903060 | Bacteria | 10051191 |
| 520 | 2731907845 | 2731639228 | Bacteria | 4187555 |
| 521 | 2784587839 | 2784132148 | Bacteria | 8627943 |
| 522 | 2785344303 | 2784746763 | Bacteria | 9783172 |
| 523 | 2785368547 | 2784746768 | Bacteria | 10036182 |
| 524 | 2786669636 | 2786546132 | Bacteria | 10419719 |
| 525 | 2799184344 | 2799112218 | Bacteria | 4315149 |
| 526 | 2804844855 | 2802429296 | Bacteria | 7227771 |
| 527 | 2808841237 | 2808606359 | Bacteria | 9866990 |
| 528 | 2808919753 | 2808606375 | Bacteria | 9466072 |
| 529 | 2809231424 | 2808606448 | Bacteria | 8656184 |
| 530 | 2811848243 | 2808606982 | Bacteria | 7791042 |
| 531 | 2812359016 | 2811994879 | Bacteria | 9313447 |
| 532 | 2812481264 | 2811994917 | Bacteria | 7761064 |
| 533 | 2852641241 | 2852635781 | Bacteria | 8251373 |
| 534 | 2856743226 | 2856741275 | Bacteria | 8096094 |
| 535 | 2862288180 | 2862281513 | Bacteria | 9621493 |
| 536 | 2862385348 | 2862382967 | Bacteria | 10317375 |
| 537 | 2862509460 | 2862507626 | Bacteria | 9425308 |
| 538 | 2862580024 | 2862574272 | Bacteria | 10567477 |
| 539 | 2863405557 | 2863404153 | Bacteria | 9672205 |
| 540 | 2867371059 | 2867369537 | Bacteria | 6501581 |
| 541 | 2867431328 | 2867428634 | Bacteria | 9590268 |
| 542 | 2873156584 | 2873151551 | Bacteria | 8625867 |
| 543 | 2873318020 | 2873314349 | Bacteria | 8512634 |
| 544 | 2877681987 | 2877676314 | Bacteria | 9512378 |
| 545 | 2884701795 | 2884693830 | Bacteria | 11273186 |
| 546 | 2891396165 | 2891395885 | Bacteria | 9251614 |
| 547 | 2891558553 | 2891554331 | Bacteria | 8812224 |
| 548 | 2891568705 | 2891562705 | Bacteria | 8039471 |
| 549 | 2895439066 | 2895427314 | Bacteria | 13147766 |
| 550 | 2895446523 | 2895442618 | Bacteria | 11027144 |
| 551 | 2912720950 | 2912715099 | Bacteria | 9460473 |
| 552 | 2912725043 | 2912723979 | Bacteria | 8557534 |
| 553 | 2919468638 | 2919468124 | Bacteria | 9133025 |
| 554 | 2946066861 | 2946064051 | Bacteria | 8957905 |
| 555 | 2946075185 | 2946072368 | Bacteria | 8999607 |
| 556 | 2947230368 | 2947224130 | Bacteria | 9938529 |
| 557 | 2954003700 | 2954002825 | Bacteria | 9173742 |
| 558 | 2954387100 | 2954380949 | Bacteria | 10050426 |
| 559 | 2954688105 | 2954682443 | Bacteria | 9862841 |
| 560 | 2954697933 | 2954691527 | Bacteria | 10720516 |
| 561 | 2954704283 | 2954701450 | Bacteria | 10834262 |
| 562 | 2954717053 | 2954711539 | Bacteria | 10867210 |
| 563 | 2954727001 | 2954721474 | Bacteria | 10456478 |
| 564 | 2954734780 | 2954731030 | Bacteria | 10243860 |
| 565 | 2954753666 | 2954749733 | Bacteria | 10366972 |
| 566 | 2954764896 | 2954759201 | Bacteria | 9358192 |
| 567 | 2990061921 | 2990059506 | Bacteria | 9321252 |
| 568 | 2990094442 | 2990088156 | Bacteria | 6657676 |
| 569 | 2997608188 | 2997600082 | Bacteria | 9896405 |
| 570 | 3002998728 | 3002998708 | Bacteria | 11715108 |
| 571 | 3006398162 | 3006393351 | Bacteria | 6615579 |
| 572 | 3006500981 | 3006493962 | Bacteria | 8825450 |
| 573 | 8008559519 | 8008558824 | Bacteria | 10610750 |
| 574 | 8008579640 | 8008574985 | Bacteria | 7815457 |
| 575 | 8023630830 | 8023623736 | Bacteria | 8593882 |
| 576 | 8025419296 | 8025413630 | Bacteria | 7014048 |
| 577 | 8033687390 | 8033684223 | Bacteria | 6906479 |
| 578 | 8048408412 | 8048406513 | Bacteria | 8936924 |
| 579 | 8053950208 | 8053945823 | Bacteria | 8962862 |
| 580 | 8055068692 | 8055066027 | Bacteria | 9479577 |
| 581 | 8055177159 | 8055172936 | Bacteria | 9305943 |
| 582 | 8056836911 | 8056829672 | Bacteria | 9045328 |
| 583 | Ga0466961_0000785 | |||
| 584 | rootH2_10025259 | |||
| 585 | Ga0006562J51391_1108414 | |||
| 586 | Ga0006562J51391_1108415 | |||
| 587 | Ga0006562J51391_1196098 | |||
| 588 | Ga0006562J51391_1196099 | |||
| 589 | Ga0070658_10034093 | |||
| 590 | Ga0070658_10068535 | |||
| 591 | Ga0070658_10200951 | |||
| 592 | Ga0070660_100436731 | |||
| 593 | Ga0070667_100270230 | |||
| 594 | Ga0070713_100300151 | |||
| 595 | Ga0070679_100286642 | |||
| 596 | Ga0070679_100645037 | |||
| 597 | Ga0070684_100543161 | |||
| 598 | Ga0068853_100023713 | |||
| 599 | Ga0070672_100378341 | |||
| 600 | Ga0070696_100000319 | |||
| 601 | Ga0068855_100013334 | |||
| 602 | Ga0070664_100318074 | |||
| 603 | Ga0068856_100248762 | |||
| 604 | Ga0068856_100473757 | |||
| 605 | Ga0081455_10001502 | |||
| 606 | Ga0070717_10234663 | |||
| 607 | Ga0070715_10007791 | |||
| 608 | Ga0075428_100042771 | |||
| 609 | Ga0075430_100140386 | |||
| 610 | Ga0075429_100046409 | |||
| 611 | Ga0075429_100265637 | |||
| 612 | Ga0099826_10081918 | |||
| 613 | Ga0105251_10017321 | |||
| 614 | Ga0105240_10037865 | |||
| 615 | Ga0105245_10266260 | |||
| 616 | Ga0114129_10082591 | |||
| 617 | Ga0105243_10353508 | |||
| 618 | Ga0105239_10178520 | |||
| 619 | Ga0105246_10030162 | |||
| 620 | Ga0157369_10138863 | |||
| 621 | Ga0157369_10438806 | |||
| 622 | Ga0157372_10151647 | |||
| 623 | Ga0157375_11021341 | |||
| 624 | Ga0182008_10002664 | |||
| 625 | Ga0182007_10000257 | |||
| 626 | Ga0206356_11506728 | |||
| 627 | Ga0206354_11276608 | |||
| 628 | Ga0213875_10006219 | |||
| 629 | Ga0224712_10123168 | |||
| 630 | Ga0209758_1003194 | |||
| 631 | Ga0207426_1014399 | |||
| 632 | Ga0207426_1014479 | |||
| 633 | Ga0207713_1054773 | |||
| 634 | Ga0207647_10041485 | |||
| 635 | Ga0207705_10053453 | |||
| 636 | Ga0207695_10633099 | |||
| 637 | Ga0207663_10062562 | |||
| 638 | Ga0207657_10217898 | |||
| 639 | Ga0207652_10173077 | |||
| 640 | Ga0207664_10032867 | |||
| 641 | Ga0207665_10002397 | |||
| 642 | Ga0207667_10082959 | |||
| 643 | Ga0207639_10028788 | |||
| 644 | Ga0207702_10515167 | |||
| 645 | Ga0209371_1012071 | |||
| 646 | Ga0209371_1044350 | |||
| 647 | Ga0268266_10021285 | |||
| 648 | Ga0268266_10416959 | |||
| 649 | Ga0307517_10003835 | |||
| 650 | Ga0307517_10051657 | |||
| 651 | Ga0307515_10001149 | |||
| 652 | Ga0307515_10087927 | |||
| 653 | Ga0265338_10001308 | |||
| 654 | Ga0268256_1004756 | |||
| 655 | Ga0268256_1016424 | |||
| 656 | Ga0307511_10017850 | |||
| 657 | Ga0307511_10031583 | |||
| 658 | Ga0307511_10123730 | |||
| 659 | Ga0307512_10001899 | |||
| 660 | Ga0307512_10008535 | |||
| 661 | Ga0307512_10131706 | |||
| 662 | Ga0307513_10005208 | |||
| 663 | Ga0307513_10166215 | |||
| 664 | Ga0307509_10203736 | |||
| 665 | Ga0307509_10274444 | |||
| 666 | Ga0307509_10528956 | |||
| 667 | Ga0307509_10565405 | |||
| 668 | Ga0307508_10037453 | |||
| 669 | Ga0307508_10095800 | |||
| 670 | Ga0307508_10159963 | |||
| 671 | Ga0307508_10257269 | |||
| 672 | Ga0307514_10043441 | |||
| 673 | Ga0307514_10134388 | |||
| 674 | Ga0307514_10205864 | |||
| 675 | Ga0307514_10354625 | |||
| 676 | Ga0316576_10329357 | |||
| 677 | Ga0307516_10007342 | |||
| 678 | Ga0307516_10019837 | |||
| 679 | Ga0307516_10063363 | |||
| 680 | Ga0307516_10236616 | |||
| 681 | Ga0307411_10826959 | |||
| 682 | Ga0307507_10000024 | |||
| 683 | Ga0307507_10189819 | |||
| 684 | Ga0307510_10020096 | |||
| 685 | Ga0373926_0013159 | |||
| 686 | Ga0373925_0002102 | |||
| 687 | Ga0395900_0072481 | |||
| 688 | Ga0395900_0343322 | |||
| 689 | Ga0395900_0623746 | |||
| 690 | Ga0395900_0794876 | |||
| 691 | Ga0395898_0002277 | |||
| 692 | Ga0395898_0047547 | |||
| 693 | Ga0395898_0068337 | |||
| 694 | Ga0395905_0150347 | |||
| 695 | Ga0395905_0173947 | |||
| 696 | Ga0436364_1043328 | |||
| 697 | Ga0395901_0170452 | |||
| 698 | Ga0395901_0272691 | |||
| 699 | Ga0395901_0290618 | |||
| 700 | Ga0395901_0803436 | |||
| 701 | Ga0439436_0000415 | |||
| 702 | Ga0439436_0004869 | |||
| 703 | Ga0439439_0005044 | |||
| 704 | Ga0451802_2066529 | |||
| 705 | Ga0451853_1066400 | |||
| 706 | Ga0451853_3574142 | |||
| 707 | Ga0451853_4001808 | |||
| 708 | Ga0439433_0000725 | |||
| 709 | Ga0439433_0003607 | |||
| 710 | Ga0439442_006208 | |||
| 711 | Ga0439442_014223 | |||
| 712 | Ga0439448_0001643 | |||
| 713 | Ga0439449_0001870 | |||
| 714 | Ga0439449_0041752 | |||
| 715 | Ga0439449_0046804 | |||
| 716 | Ga0439455_0001561 | |||
| 717 | Ga0439457_000038 | |||
| 718 | Ga0439457_015535 | |||
| 719 | Ga0439462_0043435 | |||
| 720 | Ga0450894_000092 | |||
| 721 | Ga0450895_001832 | |||
| 722 | Ga0450898_001309 | |||
| 723 | Ga0450898_046848 | |||
| 724 | Ga0450899_000182 | |||
| 725 | Ga0450900_012150 | |||
| 726 | Ga0450906_000810 | |||
| 727 | Ga0439458_0000330 | |||
| 728 | Ga0439458_0106072 | |||
| 729 | Ga0466969_0006625 | |||
| 730 | Ga0466969_0016499 | |||
| 731 | Ga0466969_0072603 | |||
| 732 | Ga0466972_0009322 | |||
| 733 | Ga0466972_0027952 | |||
| 734 | Ga0466972_0058494 | |||
| 735 | Ga0466972_0223814 | |||
| 736 | Ga0466965_0015598 | |||
| 737 | Ga0466965_0060639 | |||
| 738 | Ga0466966_0005141 | |||
| 739 | Ga0466966_0021483 | |||
| 740 | Ga0466966_0052729 | |||
| 741 | Ga0466966_0442399 | |||
| 742 | Ga0466961_0004261 | |||
| 743 | Ga0466961_0044552 | |||
| 744 | Ga0466961_0051397 | |||
| 745 | Ga0466963_0004350 | |||
| 746 | Ga0466963_0004527 | |||
| 747 | Ga0466963_0014560 | |||
| 748 | Ga0466963_0263836 | |||
| 749 | Ga0466964_0026835 | |||
| 750 | Ga0466971_0000499 | |||
| 751 | Ga0466971_0063659 | |||
| 752 | Ga0466971_0106939 | |||
| 753 | Ga0466971_0175276 | |||
| 754 | Ga0466968_0099072 | |||
| 755 | Ga0466968_0114842 | |||
| 756 | Ga0466970_0002580 | |||
| 757 | Ga0466970_0013053 | |||
| 758 | Ga0466970_0032563 | |||
| 759 | Ga0466970_0128406 | |||
| 760 | Ga0466957_0002868 | |||
| 761 | Ga0466957_0190537 | |||
| 762 | Ga0466960_0009571 | |||
| 763 | Ga0466960_0041466 | |||
| 764 | Ga0466959_0000705 | |||
| 765 | Ga0466959_0009945 | |||
| 766 | Ga0466959_0019398 | |||
| 767 | Ga0466959_0106178 | |||
| 768 | Ga0466959_0214349 | |||
| 769 | Ga0466958_0001314 | |||
| 770 | Ga0466958_0135560 | |||
| 771 | Ga0466958_0138693 | |||
| 772 | Ga0466958_0205310 | |||
| 773 | Ga0466967_0001824 | |||
| 774 | Ga0466967_0036387 | |||
| 775 | Ga0466967_0182496 | |||
| 776 | Ga0495617_068547 | |||
| 777 | Ga0495592_0001663 | |||
| 778 | Ga0495592_0165381 | |||
| 779 | Ga0495592_0307192 | |||
| 780 | Ga0495603_0003752 | |||
| 781 | Ga0495603_0006258 | |||
| 782 | Ga0495603_0015271 | |||
| 783 | Ga0495590_0062019 | |||
| 784 | Ga0495590_0066254 | |||
| 785 | Ga0495629_0042359 | |||
| 786 | Ga0495629_0119604 | |||
| 787 | Ga0495629_0159420 | |||
| 788 | Ga0495629_0165656 | |||
| 789 | Ga0495629_0299031 | |||
| 790 | Ga0495638_0044500 | |||
| 791 | Ga0495638_0189176 | |||
| 792 | Ga0495651_0000382 | |||
| 793 | Ga0495651_0000984 | |||
| 794 | Ga0495651_0113298 | |||
| 795 | Ga0495651_0141601 | |||
| 796 | Ga0495580_0296051 | |||
| 797 | Ga0495582_0027486 | |||
| 798 | Ga0495605_0078047 | |||
| 799 | Ga0495639_0052399 | |||
| 800 | Ga0495639_0266946 | |||
| 801 | Ga0495662_0000634 | |||
| 802 | Ga0495662_0083968 | |||
| 803 | Ga0495662_0113007 | |||
| 804 | Ga0495664_0001800 | |||
| 805 | Ga0495664_0377549 | |||
| 806 | Ga0495585_0085805 | |||
| 807 | Ga0495585_0194393 | |||
| 808 | Ga0495594_0004347 | |||
| 809 | Ga0495594_0018978 | |||
| 810 | Ga0495594_0086998 | |||
| 811 | Ga0495594_0140381 | |||
| 812 | Ga0495594_0281256 | |||
| 813 | Ga0495596_0047092 | |||
| 814 | Ga0495583_0018789 | |||
| 815 | Ga0495583_0063885 | |||
| 816 | Ga0495606_0036359 | |||
| 817 | Ga0495608_0260253 | |||
| 818 | Ga0495610_0008225 | |||
| 819 | Ga0495616_0005243 | |||
| 820 | Ga0495618_0052952 | |||
| 821 | Ga0495618_0097679 | |||
| 822 | Ga0495620_0042762 | |||
| 823 | Ga0495620_0057791 | |||
| 824 | Ga0495628_0010264 | |||
| 825 | Ga0495628_0022365 | |||
| 826 | Ga0495628_0054678 | |||
| 827 | Ga0495628_0138112 | |||
| 828 | Ga0495628_0279311 | |||
| 829 | Ga0495630_0025726 | |||
| 830 | Ga0495631_0009437 | |||
| 831 | Ga0495631_0067577 | |||
| 832 | Ga0495632_0078839 | |||
| 833 | Ga0495643_0000999 | |||
| 834 | Ga0495643_0061441 | |||
| 835 | Ga0495643_0204474 | |||
| 836 | Ga0495666_0014060 | |||
| 837 | Ga0495666_0142536 | |||
| 838 | Ga0495666_0158333 | |||
| 839 | Ga0495642_0116641 | |||
| 840 | Ga0495652_0000991 | |||
| 841 | Ga0495652_0009088 | |||
| 842 | Ga0495652_0024424 | |||
| 843 | Ga0495652_0120628 | |||
| 844 | Ga0495654_0016773 | |||
| 845 | Ga0495640_0002942 | |||
| 846 | Ga0495640_0046882 | |||
| 847 | Ga0495640_0139515 | |||
| 848 | Ga0495640_0184943 | |||
| 849 | Ga0495640_0316973 | |||
| 850 | Ga0495587_0000643 | |||
| 851 | Ga0495597_0045768 | |||
| 852 | Ga0495597_0087713 | |||
| 853 | Ga0495645_0011885 | |||
| 854 | Ga0495645_0015783 | |||
| 855 | Ga0495645_0103617 | |||
| 856 | Ga0495645_0259587 | |||
| 857 | Ga0495622_0004333 | |||
| 858 | Ga0495622_0027513 | |||
| 859 | Ga0495622_0095175 | |||
| 860 | Ga0495622_0113529 | |||
| 861 | Ga0495667_0084315 | |||
| 862 | Ga0495656_0142794 | |||
| 863 | Ga0495668_0023182 | |||
| 864 | Ga0495668_0138434 | |||
| 865 | Ga0495634_0003674 | |||
| 866 | Ga0495634_0033374 | |||
| 867 | Ga0495611_0039223 | |||
| 868 | Ga0495611_0119888 | |||
| 869 | Ga0495625_0015286 | |||
| 870 | Ga0495625_0021903 | |||
| 871 | Ga0495635_0001049 | |||
| 872 | Ga0495635_0021203 | |||
| 873 | Ga0495635_0068480 | |||
| 874 | Ga0495635_0256154 | |||
| 875 | Ga0495661_0008094 | |||
| 876 | Ga0495588_0014849 | |||
| 877 | Ga0495588_0241013 | |||
| 878 | Ga0495657_0006445 | |||
| 879 | Ga0495657_0027804 | |||
| 880 | Ga0495599_0103598 | |||
| 881 | Ga0495623_0021867 | |||
| 882 | Ga0495623_0103982 | |||
| 883 | Ga0495646_0000782 | |||
| 884 | Ga0495646_0002348 | |||
| 885 | Ga0495613_0001126 | |||
| 886 | Ga0495613_0057945 | |||
| 887 | Ga0495613_0078050 | |||
| 888 | Ga0495624_0148664 | |||
| 889 | Ga0495670_0002468 | |||
| 890 | Ga0495670_0026173 | |||
| 891 | Ga0495671_0107665 | |||
| 892 | Ga0495649_0129725 | |||
| 893 | Ga0495649_0144000 | |||
| 894 | Ga0495589_0107793 | |||
| 895 | Ga0495589_0109526 | |||
| 896 | Ga0495589_0143026 | |||
| 897 | Ga0495589_0160524 | |||
| 898 | Ga0495600_0000527 | |||
| 899 | Ga0495600_0015370 | |||
| 900 | Ga0495600_0121535 | |||
| 901 | Ga0495600_0206360 | |||
| 902 | Ga0495660_0070556 | |||
| 903 | Ga0495581_0019710 | |||
| 904 | Ga0495581_0081056 | |||
| 905 | Ga0495604_0002748 | |||
| 906 | Ga0495604_0014507 | |||
| 907 | Ga0495604_0335578 | |||
| 908 | Ga0495636_0014080 | |||
| 909 | Ga0495636_0018933 | |||
| 910 | Ga0495636_0066999 | |||
| 911 | Ga0495674_0034274 | |||
| 912 | Ga0495674_0038786 | |||
| 913 | Ga0495672_0165805 | |||
| 914 | Ga0495676_0024401 | |||
| 915 | Ga0495676_0039911 | |||
| 916 | Ga0495676_0320428 | |||
| 917 | Ga0495680_0002771 | |||
| 918 | Ga0495683_0031381 | |||
| 919 | Ga0495687_005037 | |||
| 920 | Ga0495687_005042 | |||
| 921 | Ga0495687_007978 | |||
| 922 | Ga0495675_0074698 | |||
| 923 | Ga0495675_0094094 | |||
| 924 | Ga0495685_001515 | |||
| 925 | Ga0495685_006081 | |||
| 926 | Ga0495685_010126 | |||
| 927 | Ga0495685_025013 | |||
| 928 | Ga0495685_064340 | |||
| 929 | Ga0495681_0002625 | |||
| 930 | Ga0495681_0006932 | |||
| 931 | Ga0495681_0009811 | |||
| 932 | Ga0495681_0148071 | |||
| 933 | Ga0495684_0081170 | |||
| 934 | Ga0495686_0011886 | |||
| 935 | Ga0495686_0027231 | |||
| 936 | Ga0495686_0194156 | |||
| 937 | Ga0495686_0406413 | |||
| 938 | Ga0495593_0000961 | |||
| 939 | Ga0495602_0008700 | |||
| 940 | Ga0495602_0172098 | |||
| 941 | Ga0495614_0016707 | |||
| 942 | Ga0495614_0165539 | |||
| 943 | Ga0496101_0307716 | |||
| 944 | Ga0496102_0350782 | |||
| 945 | Ga0496104_0252433 | |||
| 946 | Ga0496105_0024615 | |||
| 947 | Ga0496108_0026034 | |||
| 948 | Ga0496109_0025388 | |||
| 949 | Ga0496109_0131937 | |||
| 950 | Ga0496112_0000486 | |||
| 951 | Ga0496113_0034792 | |||
| 952 | Ga0496113_0486957 | |||
| 953 | Ga0496114_0226525 | |||
| 954 | Ga0501306_005898 | |||
| 955 | Ga0501306_006413 | |||
| 956 | Ga0501309_016562 | |||
| 957 | Ga0501310_008726 | |||
| 958 | Ga0501311_013126 | |||
| 959 | Ga0501315_010781 | |||
| 960 | Ga0501316_009069 | |||
| 961 | Ga0501318_007984 | |||
| 962 | Ga0501319_005320 | |||
| 963 | Ga0501320_005143 | |||
| 964 | Ga0501323_012362 | |||
| 965 | Ga0501031_0001404 | |||
| 966 | Ga0501031_0003700 | |||
| 967 | Ga0501031_0220065 | |||
| 968 | Ga0501031_0227190 | |||
| 969 | Ga0501032_0001354 | |||
| 970 | Ga0501032_0056047 | |||
| 971 | Ga0501032_0083447 | |||
| 972 | Ga0501032_0173669 | |||
| 973 | Ga0501033_0005743 | |||
| 974 | Ga0501033_0009393 | |||
| 975 | Ga0501033_0017067 | |||
| 976 | Ga0501033_0029886 | |||
| 977 | Ga0501033_0039578 | |||
| 978 | Ga0501033_0165008 | |||
| 979 | Ga0501034_0003199 | |||
| 980 | Ga0501034_0020934 | |||
| 981 | Ga0501034_0023110 | |||
| 982 | Ga0501034_0030916 | |||
| 983 | Ga0501034_0157379 | |||
| 984 | Ga0501034_0334872 | |||
| 985 | Ga0501034_0562774 | |||
| 986 | Ga0501036_0001153 | |||
| 987 | Ga0501036_0002718 | |||
| 988 | Ga0501036_0029647 | |||
| 989 | Ga0501036_0038480 | |||
| 990 | Ga0501036_0094376 | |||
| 991 | Ga0501036_0421756 | |||
| 992 | Ga0501037_0001251 | |||
| 993 | Ga0501037_0001697 | |||
| 994 | Ga0501037_0016874 | |||
| 995 | Ga0501037_0404175 | |||
| 996 | Ga0501038_0000870 | |||
| 997 | Ga0501038_0011684 | |||
| 998 | Ga0501038_0011952 | |||
| 999 | Ga0501039_0010092 | |||
| 1000 | Ga0501039_0046419 | |||
| 1001 | Ga0501039_0324511 | |||
| 1002 | Ga0501040_0007890 | |||
| 1003 | Ga0501041_0001249 | |||
| 1004 | Ga0501042_0057951 | |||
| 1005 | Ga0501042_0167073 | |||
| 1006 | Ga0501042_0668349 | |||
| 1007 | Ga0501043_0003900 | |||
| 1008 | Ga0501043_0006281 | |||
| 1009 | Ga0501043_0007294 | |||
| 1010 | Ga0501043_0050795 | |||
| 1011 | Ga0501046_0002857 | |||
| 1012 | Ga0501046_0048397 | |||
| 1013 | Ga0501047_0000025 | |||
| 1014 | Ga0501047_0000031 | |||
| 1015 | Ga0501047_0002182 | |||
| 1016 | Ga0501047_0005252 | |||
| 1017 | Ga0501047_0008544 | |||
| 1018 | Ga0501047_0011159 | |||
| 1019 | Ga0501047_0015981 | |||
| 1020 | Ga0501047_0070516 | |||
| 1021 | Ga0501047_0159191 | |||
| 1022 | Ga0501047_0244710 | |||
| 1023 | Ga0501047_0252173 | |||
| 1024 | Ga0501048_0006529 | |||
| 1025 | Ga0501048_0152718 | |||
| 1026 | Ga0501048_0260274 | |||
| 1027 | Ga0501067_0002728 | |||
| 1028 | Ga0501068_0000751 | |||
| 1029 | Ga0501068_0246235 | |||
| 1030 | Ga0501069_0050300 | |||
| 1031 | Ga0501070_0006937 | |||
| 1032 | Ga0501070_0007350 | |||
| 1033 | Ga0501070_0262197 | |||
| 1034 | Ga0501070_0372740 | |||
| 1035 | Ga0501071_0000873 | |||
| 1036 | Ga0501072_0003631 | |||
| 1037 | Ga0501073_0016451 | |||
| 1038 | Ga0501073_0202583 | |||
| 1039 | Ga0501074_0005791 | |||
| 1040 | Ga0501074_0009748 | |||
| 1041 | Ga0501076_0006283 | |||
| 1042 | Ga0501077_0257794 | |||
| 1043 | Ga0501079_0012558 | |||
| 1044 | Ga0501080_0748811 | |||
| 1045 | Ga0501035_0002332 | |||
| 1046 | Ga0501035_0016537 | |||
| 1047 | Ga0501035_0018777 | |||
| 1048 | Ga0501035_0065670 | |||
| 1049 | Ga0501035_0072937 | |||
| 1050 | Ga0501035_0164448 | |||
| 1051 | Ga0501035_0386165 | |||
| 1052 | Ga0501044_0002414 | |||
| 1053 | Ga0501044_0003111 | |||
| 1054 | Ga0501044_0013714 | |||
| 1055 | Ga0501044_0019719 | |||
| 1056 | Ga0501044_0068809 | |||
| 1057 | Ga0501044_0071847 | |||
| 1058 | Ga0501044_0262555 | |||
| 1059 | Ga0501044_0474108 | |||
| 1060 | Ga0501045_0144303 | |||
| 1061 | nmdc:mga06z11_896_c1 | |||
| 1062 | nmdc:mga05p37_211183_c1 | |||
| 1063 | nmdc:mga09592_338673_c1 | |||
| 1064 | nmdc:mga0qj67_44312_c1 | |||
| 1065 | Ga0495601_0213186 | |||
| 1066 | Ga0500610_0070393 | |||
| 1067 | Ga0495655_0001607 | |||
| 1068 | Ga0495619_0108214 | |||
| 1069 | Ga0500578_0068043 | |||
| 1070 | Ga0500640_006124 | |||
| 1071 | Ga0500660_115804 | |||
| 1072 | Ga0500553_041418 | |||
| 1073 | Ga0500553_135089 | |||
| 1074 | Ga0500560_021192 | |||
| 1075 | Ga0500594_0057588 | |||
| 1076 | Ga0500652_016761 | |||
| 1077 | Ga0500658_0008548 | |||
| 1078 | Ga0500561_0030198 | |||
| 1079 | Ga0500573_0002476 | |||
| 1080 | Ga0500586_127935 | |||
| 1081 | Ga0500600_0004832 | |||
| 1082 | Ga0500603_071377 | |||
| 1083 | Ga0500633_0033738 | |||
| 1084 | Ga0500634_0079154 | |||
| 1085 | Ga0500636_0092174 | |||
| 1086 | Ga0500656_000635 | |||
| 1087 | Ga0500587_006094 | |||
| 1088 | Ga0501084_0021137 | |||
| 1089 | Ga0501082_0001787 | |||
| 1090 | Ga0466962_0008770 | |||
| 1091 | Ga0466962_0019164 | |||
| 1092 | Ga0466962_0037837 | |||
| 1093 | Ga0466962_0063271 | |||
| 1094 | 2547412852 | |||
| 1095 | 2585304871 | |||
| 1096 | 2585319421 | |||
| 1097 | 2616701839 | |||
| 1098 | 2644269222 | |||
| 1099 | 2644436340 | |||
| 1100 | 2644625797 | |||
| 1101 | 2676496498 | |||
| 1102 | 2731907845 | |||
| 1103 | 2784587839 | |||
| 1104 | 2785344303 | |||
| 1105 | 2785368547 | |||
| 1106 | 2786669636 | |||
| 1107 | 2799184344 | |||
| 1108 | 2804844855 | |||
| 1109 | 2808841237 | |||
| 1110 | 2808919753 | |||
| 1111 | 2809231424 | |||
| 1112 | 2811848243 | |||
| 1113 | 2812359016 | |||
| 1114 | 2812481264 | |||
| 1115 | 2852641241 | |||
| 1116 | 2856743226 | |||
| 1117 | 2862288180 | |||
| 1118 | 2862385348 | |||
| 1119 | 2862509460 | |||
| 1120 | 2862580024 | |||
| 1121 | 2863405557 | |||
| 1122 | 2867371059 | |||
| 1123 | 2867431328 | |||
| 1124 | 2873156584 | |||
| 1125 | 2873318020 | |||
| 1126 | 2877681987 | |||
| 1127 | 2884701795 | |||
| 1128 | 2891396165 | |||
| 1129 | 2891558553 | |||
| 1130 | 2891568705 | |||
| 1131 | 2895439066 | |||
| 1132 | 2895446523 | |||
| 1133 | 2912720950 | |||
| 1134 | 2912725043 | |||
| 1135 | 2919468638 | |||
| 1136 | 2946066861 | |||
| 1137 | 2946075185 | |||
| 1138 | 2947230368 | |||
| 1139 | 2954003700 | |||
| 1140 | 2954387100 | |||
| 1141 | 2954688105 | |||
| 1142 | 2954697933 | |||
| 1143 | 2954704283 | |||
| 1144 | 2954717053 | |||
| 1145 | 2954727001 | |||
| 1146 | 2954734780 | |||
| 1147 | 2954753666 | |||
| 1148 | 2954764896 | |||
| 1149 | 2990061921 | |||
| 1150 | 2990094442 | |||
| 1151 | 2997608188 | |||
| 1152 | 3002998728 | |||
| 1153 | 3006398162 | |||
| 1154 | 3006500981 | |||
| 1155 | 8008559519 | |||
| 1156 | 8008579640 | |||
| 1157 | 8023630830 | |||
| 1158 | 8025419296 | |||
| 1159 | 8033687390 | |||
| 1160 | 8048408412 | |||
| 1161 | 8053950208 | |||
| 1162 | 8055068692 | |||
| 1163 | 8055177159 | |||
| 1164 | 8056836911 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6s2q-assembly2.cif.gz_D | mycobacterial hydrolase 1 | 0.9179 | 30 | 229 |
| 6s2q-assembly2.cif.gz_C | mycobacterial hydrolase 1 | 0.9106 | 30 | 229 |
| 4ij6-assembly1.cif.gz_B | crystal structure of a novel-type phosphoserine phosphatase mutant (h9a) from <i>hydrogenobacter thermophilus</i> tk-6 in complex with l-phosphoserine | 0.909 | 31 | 226 |
| 4qih-assembly1.cif.gz_B | the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 | 0.901 | 31 | 228 |
| 4qih-assembly1.cif.gz_A | the structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 | 0.9007 | 31 | 228 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ij6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.9089 | 31 | 226 | 3.40.50.1240 |
| 4qihB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.901 | 31 | 228 | 3.40.50.1240 |
| af_P9WLH5_165_364_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8874 | 32 | 230 | 3.40.50.1240 |
| af_A0A1D6QHM8_37_228_3.40.50.1240 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.8862 | 32 | 213 | 3.40.50.1240 |
| 4qihB00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like | 0.884 | 31 | 228 | 3.40.50.1240 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I3BNL5-F1-model_v4 | Histidine phosphatase family protein | 1 | 36 | 118 |
GO:0004331
GO:0005829 GO:0043456 GO:0045820 |
| AF-A0A2W4L7Z0-F1-model_v4 | Histidine phosphatase family protein | 0.9813 | 37 | 130 |
GO:0005737
GO:0016791 |
| AF-X1LSK0-F1-model_v4 | Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) | 0.9798 | 37 | 121 |
GO:0004331
GO:0005829 GO:0043456 GO:0045820 |
| AF-X0Z1D0-F1-model_v4 | Phosphoglycerate mutase (2,3-diphosphoglycerate-dependent) | 0.9781 | 37 | 158 |
GO:0004331
GO:0005829 GO:0043456 GO:0045820 |
| AF-A0A5D0SNR0-F1-model_v4 | Histidine phosphatase family protein | 0.9696 | 31 | 201 |
GO:0005737
GO:0016791 |