F466107

General Info

Members Datasets Scaffolds Average Seq Length
581 369 1162 258

Family's Representative Sequence

Representative Sequence 3300048918|Ga0496115_0471184|Ga0496115_0471184_37_786
Length 249
Sequence MTTTPSDPTTALPGRPPVVDLATWQAARDELLVREKAYTREGDALAAARRRLPMVELDGAVEVVGPDGPVPFLDLFQHRDGAPHQGQCEGCTTTAWHLRDAVYLNARDVSFAILTTGRWDEVASYLEFMGYTQPWYSVRGVDAPVGGSMGYLTCFLRDGDRVFLTYSTTGRGNERVNGSLGLLDMTPYGRGEAWEDNPQGWSEGRHSCWSWRTDAEGNPTWGPTSRPVPQWTRHGATPVESLGRHGQHP

Samples

Sample ID Description Type Environment
1 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
102 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
103 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
164 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
168 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
169 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
170 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
171 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
172 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
173 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
190 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
194 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
195 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
196 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
197 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
198 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
199 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
200 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
201 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
202 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
203 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
206 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
207 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
208 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
209 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
218 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
219 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
224 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
225 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
230 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
231 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
232 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
246 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
247 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
250 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
251 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
254 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
255 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
256 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
257 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
258 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
259 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
260 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
261 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
262 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
265 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
266 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
267 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
268 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
269 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
275 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
276 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
277 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
278 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
282 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
283 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
289 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
291 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
295 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
298 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
299 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
300 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
301 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
302 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
303 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
304 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
305 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
306 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
307 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
308 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
309 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
310 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
314 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
315 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
316 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
317 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
318 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
319 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
320 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
324 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
325 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
326 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
327 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
328 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
329 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
330 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
331 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
332 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
333 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
334 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
335 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
336 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
338 2527291627 Frankia casuarinae Thr Isolate Nodule
339 2527291629 Frankia sp. BMG5.23 Isolate Nodule
340 2546825537 Frankia sp. CcI6 Isolate Rhizoplane
341 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
342 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
343 2643221647 Streptomyces sp. Root369 Isolate Unclassified
344 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
345 2684623036 Frankia sp. CgIM4 Isolate Nodule
346 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
347 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
348 2773857924 Frankia sp. CgIS1 Isolate Nodule
349 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
350 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
351 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
352 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
353 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
354 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
355 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
356 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
357 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
358 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
359 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
360 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
361 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
362 637000116 Frankia casuarinae CcI3 Isolate Nodule
363 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
364 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
365 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
366 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
367 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
368 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
369 8056207758 Saccharopolyspora indica KCTC 29208 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.63
Metatranscriptomes 0.86
Isolates 5.51

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.41
Nodule 1.03
Rhizoplane 3.61
Rhizosphere 83.99
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496115_0471184 3300048918 Bacteria 1012
2 JGI24737J22298_10018950 3300001990 Bacteria 2202
3 JGI25406J46586_10007407 3300003203 Bacteria 5010
4 Ga0006562J51391_1030338 3300003578 Bacteria 5140
5 Ga0006562J51391_1030341 3300003578 Bacteria 1620
6 Ga0058863_11472347 3300004799 Bacteria 950
7 Ga0070658_10010918 3300005327 Bacteria 7280
8 Ga0070676_10062973 3300005328 Bacteria 2208
9 Ga0070683_100024347 3300005329 Bacteria 5422
10 Ga0070683_100163697 3300005329 Bacteria 2110
11 Ga0070683_100180012 3300005329 Bacteria 2006
12 Ga0070683_100559218 3300005329 Bacteria 1094
13 Ga0070690_100085334 3300005330 Bacteria 2071
14 Ga0070690_100188145 3300005330 Bacteria 1430
15 Ga0068869_100172661 3300005334 Bacteria 1690
16 Ga0070666_10020285 3300005335 Bacteria 4296
17 Ga0070680_100237405 3300005336 Bacteria 1540
18 Ga0070682_100022020 3300005337 Bacteria 3769
19 Ga0070682_100057436 3300005337 Bacteria 2451
20 Ga0070682_100070221 3300005337 Bacteria 2238
21 Ga0068868_100221654 3300005338 Bacteria 1583
22 Ga0068868_100242284 3300005338 Bacteria 1515
23 Ga0068868_100568000 3300005338 Bacteria 1001
24 Ga0070692_10160488 3300005345 Bacteria 1288
25 Ga0070668_100000242 3300005347 Bacteria 35872
26 Ga0070668_100132506 3300005347 Bacteria 2001
27 Ga0070668_100436346 3300005347 Bacteria 1123
28 Ga0070668_100487113 3300005347 Bacteria 1066
29 Ga0070669_100002447 3300005353 Bacteria 13440
30 Ga0070669_100041537 3300005353 Bacteria 3345
31 Ga0070671_100030887 3300005355 Bacteria 4422
32 Ga0070674_100002578 3300005356 Bacteria 10036
33 Ga0070674_100055657 3300005356 Bacteria 2740
34 Ga0070673_100310379 3300005364 Bacteria 1391
35 Ga0070688_100050279 3300005365 Bacteria 2596
36 Ga0070659_100171415 3300005366 Bacteria 1778
37 Ga0070667_100000059 3300005367 Bacteria 147078
38 Ga0070667_100024256 3300005367 Bacteria 5038
39 Ga0070667_100099292 3300005367 Bacteria 2513
40 Ga0070667_100526564 3300005367 Bacteria 1085
41 Ga0070703_10112041 3300005406 Bacteria 978
42 Ga0070714_100341981 3300005435 Bacteria 1404
43 Ga0070710_10005775 3300005437 Bacteria 5896
44 Ga0070710_10057894 3300005437 Bacteria 2197
45 Ga0070701_10025897 3300005438 Bacteria 2853
46 Ga0070711_100000663 3300005439 Bacteria 17961
47 Ga0070711_100015010 3300005439 Bacteria 4894
48 Ga0070705_100001802 3300005440 Bacteria 11056
49 Ga0070705_100166565 3300005440 Bacteria 1479
50 Ga0070700_100013912 3300005441 Bacteria 4531
51 Ga0070663_100051394 3300005455 Bacteria 2936
52 Ga0070663_100181080 3300005455 Bacteria 1635
53 Ga0070678_100000459 3300005456 Bacteria 19456
54 Ga0070678_100265884 3300005456 Bacteria 1444
55 Ga0070662_100010619 3300005457 Bacteria 6055
56 Ga0070662_100023068 3300005457 Bacteria 4271
57 Ga0070662_100082961 3300005457 Bacteria 2391
58 Ga0070681_10025862 3300005458 Bacteria 5901
59 Ga0068867_100000673 3300005459 Bacteria 22618
60 Ga0068867_100185234 3300005459 Bacteria 1658
61 Ga0070685_10017642 3300005466 Bacteria 3824
62 Ga0070685_10072603 3300005466 Bacteria 2043
63 Ga0070706_100057160 3300005467 Bacteria 3600
64 Ga0070706_100205660 3300005467 Bacteria 1838
65 Ga0070698_100034147 3300005471 Bacteria 5268
66 Ga0070679_100378986 3300005530 Bacteria 1361
67 Ga0068853_100051471 3300005539 Bacteria 3544
68 Ga0070695_100101007 3300005545 Bacteria 1943
69 Ga0070695_100172793 3300005545 Bacteria 1525
70 Ga0070693_100063505 3300005547 Bacteria 2152
71 Ga0070665_100023512 3300005548 Bacteria 6205
72 Ga0070665_100036935 3300005548 Bacteria 4912
73 Ga0070704_100000646 3300005549 Bacteria 16816
74 Ga0070704_100060784 3300005549 Bacteria 2700
75 Ga0068855_100068163 3300005563 Bacteria 4142
76 Ga0070664_100165400 3300005564 Bacteria 1960
77 Ga0070664_100445366 3300005564 Bacteria 1188
78 Ga0068857_100223963 3300005577 Bacteria 1719
79 Ga0068854_100000608 3300005578 Bacteria 21244
80 Ga0068854_100161734 3300005578 Bacteria 1735
81 Ga0070702_100108169 3300005615 Bacteria 1718
82 Ga0068852_100015238 3300005616 Bacteria 5953
83 Ga0068852_100222549 3300005616 Bacteria 1795
84 Ga0068852_100626520 3300005616 Bacteria 1081
85 Ga0068859_100003195 3300005617 Bacteria 16682
86 Ga0068859_100023913 3300005617 Bacteria 6131
87 Ga0068859_100103705 3300005617 Bacteria 2902
88 Ga0068864_100048450 3300005618 Bacteria 3653
89 Ga0068866_10000559 3300005718 Bacteria 17000
90 Ga0068861_100000590 3300005719 Bacteria 21487
91 Ga0068851_10158689 3300005834 Bacteria 1241
92 Ga0068870_10155100 3300005840 Bacteria 1352
93 Ga0068863_100684208 3300005841 Bacteria 1019
94 Ga0068858_100004076 3300005842 Bacteria 14395
95 Ga0068860_100000048 3300005843 Bacteria 209375
96 Ga0068860_100032425 3300005843 Bacteria 5019
97 Ga0068862_100008197 3300005844 Bacteria 8638
98 Ga0068862_100050877 3300005844 Bacteria 3542
99 Ga0068862_100252607 3300005844 Bacteria 1607
100 Ga0081538_10000476 3300005981 Bacteria 45096
101 Ga0081539_10000915 3300005985 Bacteria 55784
102 Ga0081539_10017072 3300005985 Bacteria 5125
103 Ga0070717_10082557 3300006028 Bacteria 2701
104 Ga0070716_100045080 3300006173 Bacteria 2474
105 Ga0070716_100094687 3300006173 Bacteria 1816
106 Ga0070716_100102207 3300006173 Bacteria 1760
107 Ga0070716_100425434 3300006173 Bacteria 961
108 Ga0070712_100001159 3300006175 Bacteria 15943
109 Ga0070712_100174495 3300006175 Bacteria 1670
110 Ga0070712_100269031 3300006175 Bacteria 1368
111 Ga0075428_100001295 3300006844 Bacteria 26560
112 Ga0075428_100011197 3300006844 Bacteria 9982
113 Ga0075428_100184097 3300006844 Bacteria 2260
114 Ga0075428_100230382 3300006844 Bacteria 1999
115 Ga0075430_100110030 3300006846 Bacteria 2297
116 Ga0075431_100297998 3300006847 Bacteria 1629
117 Ga0075433_10010057 3300006852 Bacteria 7582
118 Ga0075434_100003049 3300006871 Bacteria 14905
119 Ga0068865_100006968 3300006881 Bacteria 6931
120 Ga0068865_100153628 3300006881 Bacteria 1748
121 Ga0097620_100003195 3300006931 Bacteria 16682
122 Ga0097620_100023913 3300006931 Bacteria 6131
123 Ga0097620_100103712 3300006931 Bacteria 2902
124 Ga0075435_100002992 3300007076 Bacteria 11372
125 Ga0111539_10006978 3300009094 Bacteria 14495
126 Ga0111539_10288731 3300009094 Bacteria 1909
127 Ga0111539_10291002 3300009094 Bacteria 1901
128 Ga0111539_10317750 3300009094 Bacteria 1812
129 Ga0105245_10001283 3300009098 Bacteria 22648
130 Ga0105245_10028146 3300009098 Bacteria 4954
131 Ga0105245_10066806 3300009098 Bacteria 3255
132 Ga0105245_10286247 3300009098 Bacteria 1613
133 Ga0105247_10000559 3300009101 Bacteria 30273
134 Ga0105247_10001525 3300009101 Bacteria 16561
135 Ga0114129_10055524 3300009147 Bacteria 5550
136 Ga0105243_10000773 3300009148 Bacteria 30624
137 Ga0105243_10014486 3300009148 Bacteria 5966
138 Ga0105241_10012914 3300009174 Bacteria 6127
139 Ga0105241_10422602 3300009174 Bacteria 1173
140 Ga0105242_10015970 3300009176 Bacteria 5834
141 Ga0105242_10016154 3300009176 Bacteria 5799
142 Ga0105248_10000098 3300009177 Bacteria 96532
143 Ga0105237_10004715 3300009545 Bacteria 15692
144 Ga0105237_10610972 3300009545 Bacteria 1097
145 Ga0105238_10356039 3300009551 Bacteria 1453
146 Ga0105238_10810110 3300009551 Bacteria 952
147 Ga0105249_10000022 3300009553 Bacteria 258377
148 Ga0105249_10002308 3300009553 Bacteria 16563
149 Ga0105249_10319174 3300009553 Bacteria 1564
150 Ga0105239_10021963 3300010375 Bacteria 7034
151 Ga0105239_10043395 3300010375 Bacteria 4928
152 Ga0105239_10113103 3300010375 Bacteria 3010
153 Ga0105239_11257851 3300010375 Bacteria 853
154 Ga0105246_10121815 3300011119 Bacteria 1934
155 Ga0157313_1006747 3300012503 Bacteria 874
156 Ga0157371_10159373 3300013102 Bacteria 1611
157 Ga0157370_10261115 3300013104 Bacteria 1601
158 Ga0157369_10042450 3300013105 Bacteria 4961
159 Ga0157369_10359065 3300013105 Bacteria 1513
160 Ga0157374_10095425 3300013296 Bacteria 2844
161 Ga0157378_10002823 3300013297 Bacteria 15493
162 Ga0163162_10002292 3300013306 Bacteria 17964
163 Ga0163162_10168090 3300013306 Bacteria 2317
164 Ga0163162_10184567 3300013306 Bacteria 2212
165 Ga0163162_10340069 3300013306 Bacteria 1633
166 Ga0157372_10000652 3300013307 Bacteria 38133
167 Ga0157372_10041329 3300013307 Bacteria 5098
168 Ga0157372_10327081 3300013307 Bacteria 1785
169 Ga0157375_10007902 3300013308 Bacteria 9312
170 Ga0163163_10218115 3300014325 Bacteria 1956
171 Ga0157380_10008648 3300014326 Bacteria 7279
172 Ga0157377_10161536 3300014745 Bacteria 1394
173 Ga0157379_10041184 3300014968 Bacteria 4124
174 Ga0157379_10444006 3300014968 Bacteria 1197
175 Ga0157376_11042132 3300014969 Bacteria 842
176 Ga0183367_1004 3300015688 Bacteria 716880
177 Ga0163161_10000939 3300017792 Bacteria 22414
178 Ga0206350_10880292 3300020080 Bacteria 1199
179 Ga0213875_10009465 3300021388 Bacteria 4935
180 Ga0224712_10047470 3300022467 Bacteria 1653
181 Ga0207692_10061602 3300025898 Bacteria 1945
182 Ga0207642_10001793 3300025899 Bacteria 6649
183 Ga0207642_10021243 3300025899 Bacteria 2552
184 Ga0207710_10000081 3300025900 Bacteria 138729
185 Ga0207710_10005560 3300025900 Bacteria 5424
186 Ga0207688_10005861 3300025901 Bacteria 6685
187 Ga0207688_10021090 3300025901 Bacteria 3558
188 Ga0207680_10044254 3300025903 Bacteria 2617
189 Ga0207699_10515642 3300025906 Bacteria 864
190 Ga0207645_10192305 3300025907 Bacteria 1341
191 Ga0207643_10008968 3300025908 Bacteria 5370
192 Ga0207705_10180276 3300025909 Bacteria 1594
193 Ga0207684_10063624 3300025910 Bacteria 3132
194 Ga0207654_10007526 3300025911 Bacteria 5491
195 Ga0207654_10308189 3300025911 Bacteria 1079
196 Ga0207707_10039312 3300025912 Bacteria 4136
197 Ga0207671_10016416 3300025914 Bacteria 5756
198 Ga0207693_10000513 3300025915 Bacteria 34994
199 Ga0207693_10013212 3300025915 Bacteria 6663
200 Ga0207693_10032204 3300025915 Bacteria 4138
201 Ga0207663_10005018 3300025916 Bacteria 6644
202 Ga0207660_10048388 3300025917 Bacteria 3009
203 Ga0207662_10018670 3300025918 Bacteria 3939
204 Ga0207657_10202980 3300025919 Bacteria 1594
205 Ga0207657_10318287 3300025919 Bacteria 1231
206 Ga0207652_10176400 3300025921 Bacteria 1919
207 Ga0207652_10807398 3300025921 Bacteria 833
208 Ga0207681_10001422 3300025923 Bacteria 15445
209 Ga0207681_10042974 3300025923 Bacteria 3022
210 Ga0207659_10067678 3300025926 Bacteria 2595
211 Ga0207659_10208100 3300025926 Bacteria 1566
212 Ga0207687_10008086 3300025927 Bacteria 6883
213 Ga0207700_10013679 3300025928 Bacteria 5290
214 Ga0207664_10285883 3300025929 Bacteria 1448
215 Ga0207644_10057271 3300025931 Bacteria 2814
216 Ga0207644_10276321 3300025931 Bacteria 1348
217 Ga0207690_10392635 3300025932 Bacteria 1105
218 Ga0207706_10004404 3300025933 Bacteria 13229
219 Ga0207706_10011441 3300025933 Bacteria 8082
220 Ga0207706_10033431 3300025933 Bacteria 4578
221 Ga0207686_10058002 3300025934 Bacteria 2439
222 Ga0207709_10013876 3300025935 Bacteria 4448
223 Ga0207669_10073932 3300025937 Bacteria 2153
224 Ga0207704_10034979 3300025938 Bacteria 2873
225 Ga0207704_10103847 3300025938 Bacteria 1902
226 Ga0207665_10021915 3300025939 Bacteria 4201
227 Ga0207665_10033766 3300025939 Bacteria 3393
228 Ga0207665_10044915 3300025939 Bacteria 2957
229 Ga0207691_10055273 3300025940 Bacteria 3618
230 Ga0207691_10305782 3300025940 Bacteria 1365
231 Ga0207711_10002636 3300025941 Bacteria 15877
232 Ga0207689_10037780 3300025942 Bacteria 4002
233 Ga0207689_10408244 3300025942 Bacteria 1133
234 Ga0207661_10019752 3300025944 Bacteria 5029
235 Ga0207667_10115031 3300025949 Bacteria 2773
236 Ga0207667_10220664 3300025949 Bacteria 1942
237 Ga0207651_10197349 3300025960 Bacteria 1610
238 Ga0207651_10449182 3300025960 Bacteria 1106
239 Ga0207712_10000005 3300025961 Bacteria 608697
240 Ga0207712_10358850 3300025961 Bacteria 1214
241 Ga0207668_10006339 3300025972 Bacteria 6995
242 Ga0207668_10231141 3300025972 Bacteria 1491
243 Ga0207640_10068652 3300025981 Bacteria 2376
244 Ga0207640_10477587 3300025981 Bacteria 1033
245 Ga0207658_10000228 3300025986 Bacteria 58995
246 Ga0207658_10036075 3300025986 Bacteria 3544
247 Ga0207658_10453138 3300025986 Bacteria 1136
248 Ga0207677_10016372 3300026023 Bacteria 4389
249 Ga0207677_10171624 3300026023 Bacteria 1696
250 Ga0207703_10021173 3300026035 Bacteria 5089
251 Ga0207639_10014568 3300026041 Bacteria 5536
252 Ga0207678_10064076 3300026067 Bacteria 3158
253 Ga0207678_10110666 3300026067 Bacteria 2343
254 Ga0207708_10008812 3300026075 Bacteria 7466
255 Ga0207708_10107572 3300026075 Bacteria 2162
256 Ga0207641_10003007 3300026088 Bacteria 15230
257 Ga0207648_10001669 3300026089 Bacteria 24324
258 Ga0207674_10088919 3300026116 Bacteria 3081
259 Ga0207675_100006562 3300026118 Bacteria 11011
260 Ga0207675_100099878 3300026118 Bacteria 2733
261 Ga0207675_100172115 3300026118 Bacteria 2070
262 Ga0207683_10001309 3300026121 Bacteria 22501
263 Ga0207683_10048135 3300026121 Bacteria 3734
264 Ga0207683_10093694 3300026121 Bacteria 2676
265 Ga0207683_10242704 3300026121 Bacteria 1643
266 Ga0207698_10098666 3300026142 Bacteria 2414
267 Ga0207698_10294004 3300026142 Bacteria 1509
268 Ga0207698_10295899 3300026142 Bacteria 1504
269 Ga0207428_10002308 3300027907 Bacteria 19098
270 Ga0268266_10051845 3300028379 Bacteria 3523
271 Ga0268266_10595716 3300028379 Bacteria 1061
272 Ga0268265_10000005 3300028380 Bacteria 535350
273 Ga0268265_10006426 3300028380 Bacteria 7967
274 Ga0268265_10097441 3300028380 Bacteria 2366
275 Ga0268265_10331480 3300028380 Bacteria 1382
276 Ga0268264_10000005 3300028381 Bacteria 934972
277 Ga0268264_10006161 3300028381 Bacteria 10127
278 Ga0307517_10006976 3300028786 Bacteria 16599
279 Ga0307515_10000995 3300028794 Bacteria 64758
280 Ga0307511_10041656 3300030521 Bacteria 3874
281 Ga0307512_10007812 3300030522 Bacteria 10523
282 Ga0307512_10022815 3300030522 Bacteria 5609
283 Ga0307512_10066658 3300030522 Bacteria 2718
284 Ga0314311_1036123 3300030733 Bacteria 2565
285 Ga0314311_1225001 3300030733 Bacteria 1244
286 Ga0316180_1014567 3300030736 Bacteria 1135
287 Ga0265340_10002298 3300031247 Bacteria 10932
288 Ga0307513_10046863 3300031456 Bacteria 4708
289 Ga0307508_10003663 3300031616 Bacteria 15401
290 Ga0307508_10084585 3300031616 Bacteria 2754
291 Ga0307508_10150192 3300031616 Bacteria 1934
292 Ga0307508_10192379 3300031616 Bacteria 1641
293 Ga0307514_10127341 3300031649 Bacteria 1761
294 Ga0307514_10144328 3300031649 Bacteria 1611
295 Ga0307518_10074443 3300031838 Bacteria 2457
296 Ga0307518_10288213 3300031838 Bacteria 1009
297 Ga0307410_10007438 3300031852 Bacteria 5995
298 Ga0307410_10151523 3300031852 Bacteria 1727
299 Ga0307406_10000391 3300031901 Bacteria 25359
300 Ga0307406_10006196 3300031901 Bacteria 6585
301 Ga0307407_10006039 3300031903 Bacteria 5336
302 Ga0307412_10296494 3300031911 Bacteria 1276
303 Ga0307409_100000329 3300031995 Bacteria 19526
304 Ga0307409_100125237 3300031995 Bacteria 2184
305 Ga0307409_100416575 3300031995 Bacteria 1287
306 Ga0307416_100013434 3300032002 Bacteria 5565
307 Ga0307416_100056687 3300032002 Bacteria 3164
308 Ga0307416_100232854 3300032002 Bacteria 1777
309 Ga0307416_100332082 3300032002 Bacteria 1528
310 Ga0307414_10005709 3300032004 Bacteria 6874
311 Ga0307411_10008394 3300032005 Bacteria 5347
312 Ga0307411_10011366 3300032005 Bacteria 4802
313 Ga0307415_100014803 3300032126 Bacteria 4599
314 Ga0307415_100020162 3300032126 Bacteria 4065
315 Ga0307415_100141443 3300032126 Bacteria 1838
316 Ga0307415_100572468 3300032126 Bacteria 1000
317 Ga0307507_10000329 3300033179 Bacteria 96032
318 Ga0307507_10023243 3300033179 Bacteria 6811
319 Ga0307510_10002773 3300033180 Bacteria 20078
320 Ga0373958_0055596 3300034819 Bacteria 846
321 Ga0373951_0000225 3300035091 Bacteria 19637
322 Ga0373955_0193084 3300035172 Bacteria 1211
323 Ga0373942_0043051 3300035207 Bacteria 1239
324 Ga0373962_0084775 3300035242 Bacteria 967
325 Ga0373933_0044562 3300035724 Bacteria 2628
326 Ga0373937_0571084 3300036401 Bacteria 1074
327 Ga0373925_0088455 3300037068 Bacteria 2366
328 Ga0395900_0008840 3300037418 Bacteria 10344
329 Ga0395898_0011950 3300037466 Bacteria 8989
330 Ga0395898_0019488 3300037466 Bacteria 6902
331 Ga0395905_0260692 3300037471 Bacteria 1618
332 Ga0436364_0265841 3300037853 Bacteria 68488
333 Ga0436364_1168162 3300037853 Bacteria 1996
334 Ga0395901_0022806 3300038443 Bacteria 6418
335 Ga0451793_0322208 3300041452 Bacteria 5183
336 Ga0451797_1226667 3300041453 Bacteria 4989
337 Ga0451837_1640538 3300041494 Bacteria 1611
338 Ga0451841_0544407 3300041498 Bacteria 3313
339 Ga0451843_0608002 3300041509 Bacteria 3177
340 Ga0451853_1487951 3300041512 Bacteria 1940
341 Ga0439431_0079267 3300041997 Bacteria 884
342 Ga0439463_055927 3300042016 Bacteria 1007
343 Ga0439440_0015268 3300042993 Bacteria 1668
344 Ga0466972_0218798 3300044658 Bacteria 891
345 Ga0466965_0009776 3300044683 Bacteria 4463
346 Ga0466966_0002231 3300044684 Bacteria 12596
347 Ga0466966_0003431 3300044684 Bacteria 10458
348 Ga0466966_0248914 3300044684 Bacteria 1071
349 Ga0466961_0015136 3300044693 Bacteria 4951
350 Ga0466961_0195419 3300044693 Bacteria 1252
351 Ga0466963_0002088 3300044694 Bacteria 11035
352 Ga0466963_0126540 3300044694 Bacteria 1762
353 Ga0466971_0011467 3300044719 Bacteria 3882
354 Ga0466971_0056474 3300044719 Bacteria 1771
355 Ga0466970_0004930 3300044765 Bacteria 6592
356 Ga0466970_0008619 3300044765 Bacteria 5137
357 Ga0466970_0026712 3300044765 Bacteria 3026
358 Ga0466957_0001897 3300044842 Bacteria 11079
359 Ga0466957_0006722 3300044842 Bacteria 6501
360 Ga0466957_0251042 3300044842 Bacteria 1176
361 Ga0466960_0007840 3300044901 Bacteria 4355
362 Ga0466960_0026744 3300044901 Bacteria 2624
363 Ga0466959_0023686 3300045049 Bacteria 4544
364 Ga0466958_0000308 3300045836 Bacteria 19260
365 Ga0466958_0048053 3300045836 Bacteria 2577
366 Ga0466958_0309904 3300045836 Bacteria 1014
367 Ga0495592_0102860 3300046454 Bacteria 2033
368 Ga0495629_0012131 3300046459 Bacteria 6245
369 Ga0495651_0086659 3300046462 Bacteria 2355
370 Ga0495653_0006324 3300046463 Bacteria 9719
371 Ga0495653_0125941 3300046463 Bacteria 1819
372 Ga0495580_0021154 3300046472 Bacteria 4803
373 Ga0495662_0001446 3300046476 Bacteria 11748
374 Ga0495664_0001349 3300046477 Bacteria 12925
375 Ga0495606_0021517 3300046507 Bacteria 4724
376 Ga0495608_0008605 3300046511 Bacteria 7147
377 Ga0495618_0013534 3300046514 Bacteria 4963
378 Ga0495628_0037894 3300046516 Bacteria 3862
379 Ga0495628_0098330 3300046516 Bacteria 2260
380 Ga0495630_0169996 3300046517 Bacteria 1660
381 Ga0495632_0190306 3300046519 Bacteria 937
382 Ga0495643_0042866 3300046522 Bacteria 2464
383 Ga0495648_0068169 3300046524 Bacteria 2077
384 Ga0495666_0051248 3300046526 Bacteria 1983
385 Ga0495652_0018568 3300046529 Bacteria 6198
386 Ga0495652_0035875 3300046529 Bacteria 4314
387 Ga0495652_0306371 3300046529 Bacteria 1152
388 Ga0495665_0004304 3300046531 Bacteria 7692
389 Ga0495640_0187538 3300046533 Bacteria 1315
390 Ga0495586_0016344 3300046535 Bacteria 3947
391 Ga0495587_0005692 3300046536 Bacteria 8126
392 Ga0495645_0269306 3300046543 Bacteria 1124
393 Ga0495633_0077496 3300046558 Bacteria 1548
394 Ga0495667_0009434 3300046559 Bacteria 6611
395 Ga0495634_0093903 3300046642 Bacteria 1944
396 Ga0495611_0020400 3300046648 Bacteria 2852
397 Ga0495625_0037030 3300046660 Bacteria 3581
398 Ga0495625_0092325 3300046660 Bacteria 2092
399 Ga0495635_0017096 3300046663 Bacteria 5064
400 Ga0495635_0055634 3300046663 Bacteria 2725
401 Ga0495635_0173253 3300046663 Bacteria 1467
402 Ga0495657_0009694 3300046675 Bacteria 7282
403 Ga0495657_0010805 3300046675 Bacteria 6856
404 Ga0495599_0019797 3300046678 Bacteria 4191
405 Ga0495623_0154683 3300046679 Bacteria 1352
406 Ga0495646_0012623 3300046680 Bacteria 5368
407 Ga0495613_0007151 3300046689 Bacteria 8310
408 Ga0495613_0036539 3300046689 Bacteria 3642
409 Ga0495613_0091283 3300046689 Bacteria 2205
410 Ga0495670_0116600 3300046691 Bacteria 1385
411 Ga0495671_0004298 3300046692 Bacteria 8561
412 Ga0495589_0003516 3300046794 Bacteria 8475
413 Ga0495589_0006861 3300046794 Bacteria 5989
414 Ga0495600_0028515 3300046809 Bacteria 3612
415 Ga0495600_0052072 3300046809 Bacteria 2673
416 Ga0495600_0069902 3300046809 Bacteria 2294
417 Ga0495600_0217309 3300046809 Bacteria 1223
418 Ga0495581_0000967 3300047315 Bacteria 15443
419 Ga0495604_0001127 3300047317 Bacteria 22177
420 Ga0495604_0045503 3300047317 Bacteria 3425
421 Ga0495604_0099364 3300047317 Bacteria 2141
422 Ga0495674_0028563 3300047319 Bacteria 5083
423 Ga0495674_0283041 3300047319 Bacteria 1358
424 Ga0495676_0177764 3300047321 Bacteria 1493
425 Ga0495680_0033492 3300047322 Bacteria 4158
426 Ga0495675_0015184 3300047444 Bacteria 4868
427 Ga0495685_003776 3300047447 Bacteria 4851
428 Ga0495685_004902 3300047447 Bacteria 4345
429 Ga0495685_020604 3300047447 Bacteria 2266
430 Ga0495681_0003262 3300047470 Bacteria 11316
431 Ga0495681_0012575 3300047470 Bacteria 4965
432 Ga0495684_0299842 3300047471 Bacteria 1154
433 Ga0495602_0066871 3300048088 Bacteria 3094
434 Ga0495614_0081036 3300048089 Bacteria 1406
435 Ga0496100_0001527 3300048903 Bacteria 11349
436 Ga0496100_0026666 3300048903 Bacteria 3545
437 Ga0496101_0001280 3300048904 Bacteria 15038
438 Ga0496101_0025110 3300048904 Bacteria 4130
439 Ga0496102_0000167 3300048905 Bacteria 88562
440 Ga0496102_0002930 3300048905 Bacteria 14479
441 Ga0496103_0000756 3300048906 Bacteria 23844
442 Ga0496106_0002000 3300048909 Bacteria 15340
443 Ga0496106_0025032 3300048909 Bacteria 4440
444 Ga0496107_0003585 3300048910 Bacteria 10406
445 Ga0496107_0073539 3300048910 Bacteria 2486
446 Ga0496108_0219123 3300048911 Bacteria 1653
447 Ga0496108_0671975 3300048911 Bacteria 899
448 Ga0496109_0592652 3300048912 Bacteria 1044
449 Ga0496114_0005577 3300048917 Bacteria 9864
450 Ga0496115_0010173 3300048918 Bacteria 7020
451 Ga0496116_0013479 3300048919 Bacteria 6587
452 Ga0496116_0028833 3300048919 Bacteria 4013
453 Ga0496117_0000447 3300048920 Bacteria 68541
454 Ga0496118_0000286 3300048921 Bacteria 88166
455 Ga0496118_0061597 3300048921 Bacteria 2777
456 Ga0496119_0017635 3300048922 Bacteria 5362
457 Ga0496120_0145805 3300048923 Bacteria 1196
458 Ga0496121_0002177 3300048924 Bacteria 30686
459 Ga0496121_0024636 3300048924 Bacteria 5746
460 Ga0496124_0002462 3300048927 Bacteria 24202
461 Ga0496124_0003542 3300048927 Bacteria 18989
462 Ga0496126_0001691 3300048929 Bacteria 32861
463 Ga0496126_0002684 3300048929 Bacteria 23506
464 Ga0496126_0003999 3300048929 Bacteria 17991
465 Ga0496126_0143954 3300048929 Bacteria 2049
466 Ga0501031_0002451 3300049568 Bacteria 11825
467 Ga0501031_0144775 3300049568 Bacteria 1553
468 Ga0501032_0009387 3300049569 Bacteria 7085
469 Ga0501032_0027887 3300049569 Bacteria 3881
470 Ga0501032_0252652 3300049569 Bacteria 1144
471 Ga0501033_0097738 3300049570 Bacteria 2144
472 Ga0501033_0139865 3300049570 Bacteria 1750
473 Ga0501034_0005072 3300049571 Bacteria 14468
474 Ga0501036_0000537 3300049572 Bacteria 27143
475 Ga0501036_0006492 3300049572 Bacteria 9502
476 Ga0501036_0129501 3300049572 Bacteria 2131
477 Ga0501037_0000477 3300049573 Bacteria 32398
478 Ga0501037_0032542 3300049573 Bacteria 3851
479 Ga0501038_0010427 3300049574 Bacteria 8499
480 Ga0501038_0037215 3300049574 Bacteria 4267
481 Ga0501038_0107014 3300049574 Bacteria 2320
482 Ga0501039_0110042 3300049575 Bacteria 2153
483 Ga0501039_0306964 3300049575 Bacteria 1247
484 Ga0501041_0000607 3300049577 Bacteria 18727
485 Ga0501041_0028409 3300049577 Bacteria 3374
486 Ga0501042_0002337 3300049578 Bacteria 11613
487 Ga0501043_0000268 3300049579 Bacteria 47030
488 Ga0501043_0064738 3300049579 Bacteria 2871
489 Ga0501046_0002681 3300049580 Bacteria 16590
490 Ga0501046_0005007 3300049580 Bacteria 11894
491 Ga0501047_0000211 3300049581 Bacteria 70079
492 Ga0501047_0001983 3300049581 Bacteria 19633
493 Ga0501047_0263095 3300049581 Bacteria 1572
494 Ga0501047_0417600 3300049581 Bacteria 1173
495 Ga0501048_0003621 3300049582 Bacteria 11765
496 Ga0501048_0054942 3300049582 Bacteria 2828
497 Ga0501067_0012841 3300049583 Bacteria 4637
498 Ga0501068_0015731 3300049584 Bacteria 4350
499 Ga0501069_0094133 3300049585 Bacteria 1695
500 Ga0501070_0196517 3300049586 Bacteria 1656
501 Ga0501071_0000706 3300049587 Bacteria 17516
502 Ga0501072_0050956 3300049588 Bacteria 3259
503 Ga0501074_0013064 3300049590 Bacteria 6036
504 Ga0501075_0018763 3300049591 Bacteria 5012
505 Ga0501076_0033002 3300049592 Bacteria 4041
506 Ga0501076_0092617 3300049592 Bacteria 2431
507 Ga0501077_0039694 3300049593 Bacteria 2999
508 Ga0501079_0005473 3300049741 Bacteria 9459
509 Ga0501079_0204476 3300049741 Bacteria 1542
510 Ga0501080_0011989 3300049742 Bacteria 7939
511 Ga0501080_0115014 3300049742 Bacteria 2494
512 Ga0501080_0644569 3300049742 Bacteria 938
513 Ga0501081_0005989 3300049743 Bacteria 7871
514 Ga0501083_0000458 3300049744 Bacteria 26157
515 Ga0501035_0023393 3300049822 Bacteria 5667
516 Ga0501044_0000779 3300049823 Bacteria 38641
517 Ga0501044_0147878 3300049823 Bacteria 2333
518 Ga0501044_0636817 3300049823 Bacteria 956
519 Ga0501045_0004444 3300049824 Bacteria 9676
520 Ga0501045_0224448 3300049824 Bacteria 1398
521 nmdc:mga05p37_457005_c1 3300050507 Bacteria 1477
522 nmdc:mga06r32_101664_c1 3300050510 Bacteria 2822
523 nmdc:mga08y16_11894_c1 3300050511 Bacteria 9140
524 nmdc:mga08y16_8780_c1 3300050511 Bacteria 10607
525 nmdc:mga0n895_12587_c1 3300050512 Bacteria 7594
526 nmdc:mga0rr50_612451_c1 3300050513 Bacteria 929
527 nmdc:mga0a205_77318_c1 3300050515 Bacteria 3216
528 Ga0495601_0021975 3300053077 Bacteria 3913
529 Ga0495619_0023972 3300053085 Bacteria 3913
530 Ga0500578_0049752 3300053086 Bacteria 2688
531 Ga0500643_005312 3300053087 Bacteria 5573
532 Ga0500646_0000395 3300053090 Bacteria 13050
533 Ga0500566_0024289 3300053094 Bacteria 3559
534 Ga0500654_047241 3300053099 Bacteria 2365
535 Ga0500569_015852 3300053109 Bacteria 1896
536 Ga0500652_013386 3300053131 Bacteria 2903
537 Ga0500561_0000540 3300053137 Bacteria 6114
538 Ga0500573_0091959 3300053140 Bacteria 1713
539 Ga0500600_0034588 3300053149 Bacteria 2948
540 Ga0500600_0054905 3300053149 Bacteria 2245
541 Ga0500616_0059853 3300053153 Bacteria 1976
542 Ga0500633_0026464 3300053160 Bacteria 1826
543 Ga0500634_0115825 3300053161 Bacteria 1313
544 Ga0501084_0001385 3300054114 Bacteria 19172
545 Ga0501084_0006026 3300054114 Bacteria 9969
546 Ga0501082_0004599 3300060353 Bacteria 12048
547 Ga0501082_0061612 3300060353 Bacteria 3229
548 Ga0530510_0019106 3300061734 Bacteria 4860
549 Ga0530510_0022331 3300061734 Bacteria 4506
550 2528205125 2527291627 Bacteria 5309833
551 2528215364 2527291629 Bacteria 5267418
552 2546950725 2546825537 Bacteria 5389291
553 2558914908 2558860112 Bacteria 9931328
554 2616693461 2616644814 Bacteria 11555299
555 2644270278 2643221647 Bacteria 10741251
556 2644442230 2643221678 Bacteria 9540101
557 2686540910 2684623036 Bacteria 5199090
558 2689993686 2687453743 Bacteria 8361025
559 2768645834 2767802112 Bacteria 6465194
560 2774863775 2773857924 Bacteria 5256821
561 2785366381 2784746768 Bacteria 10036182
562 2795785478 2795385470 Bacteria 8317180
563 2795796149 2795385472 Bacteria 6627535
564 2862290344 2862281513 Bacteria 9621493
565 2862290607 2862290372 Bacteria 7471434
566 2870724998 2870721527 Bacteria 9689237
567 2877684136 2877676314 Bacteria 9512378
568 2902795744 2902792274 Bacteria 7270173
569 2935894659 2935890801 Bacteria 4593001
570 2947225144 2947224130 Bacteria 9938529
571 2954389420 2954380949 Bacteria 10050426
572 2990067075 2990059506 Bacteria 9321252
573 2995464159 2995463766 Bacteria 8577691
574 637878954 637000116 Bacteria 5433628
575 8008490703 8008485437 Bacteria 7198341
576 8025525791 8025524527 Bacteria 7197316
577 8047898982 8047893842 Bacteria 11723082
578 8048359937 8048356638 Bacteria 11044339
579 8048375946 8048369669 Bacteria 11666822
580 8048382267 8048379754 Bacteria 11877923
581 8056212861 8056207758 Bacteria 8639239
582 Ga0496115_0471184
583 JGI24737J22298_10018950
584 JGI25406J46586_10007407
585 Ga0006562J51391_1030338
586 Ga0006562J51391_1030341
587 Ga0058863_11472347
588 Ga0070658_10010918
589 Ga0070676_10062973
590 Ga0070683_100024347
591 Ga0070683_100163697
592 Ga0070683_100180012
593 Ga0070683_100559218
594 Ga0070690_100085334
595 Ga0070690_100188145
596 Ga0068869_100172661
597 Ga0070666_10020285
598 Ga0070680_100237405
599 Ga0070682_100022020
600 Ga0070682_100057436
601 Ga0070682_100070221
602 Ga0068868_100221654
603 Ga0068868_100242284
604 Ga0068868_100568000
605 Ga0070692_10160488
606 Ga0070668_100000242
607 Ga0070668_100132506
608 Ga0070668_100436346
609 Ga0070668_100487113
610 Ga0070669_100002447
611 Ga0070669_100041537
612 Ga0070671_100030887
613 Ga0070674_100002578
614 Ga0070674_100055657
615 Ga0070673_100310379
616 Ga0070688_100050279
617 Ga0070659_100171415
618 Ga0070667_100000059
619 Ga0070667_100024256
620 Ga0070667_100099292
621 Ga0070667_100526564
622 Ga0070703_10112041
623 Ga0070714_100341981
624 Ga0070710_10005775
625 Ga0070710_10057894
626 Ga0070701_10025897
627 Ga0070711_100000663
628 Ga0070711_100015010
629 Ga0070705_100001802
630 Ga0070705_100166565
631 Ga0070700_100013912
632 Ga0070663_100051394
633 Ga0070663_100181080
634 Ga0070678_100000459
635 Ga0070678_100265884
636 Ga0070662_100010619
637 Ga0070662_100023068
638 Ga0070662_100082961
639 Ga0070681_10025862
640 Ga0068867_100000673
641 Ga0068867_100185234
642 Ga0070685_10017642
643 Ga0070685_10072603
644 Ga0070706_100057160
645 Ga0070706_100205660
646 Ga0070698_100034147
647 Ga0070679_100378986
648 Ga0068853_100051471
649 Ga0070695_100101007
650 Ga0070695_100172793
651 Ga0070693_100063505
652 Ga0070665_100023512
653 Ga0070665_100036935
654 Ga0070704_100000646
655 Ga0070704_100060784
656 Ga0068855_100068163
657 Ga0070664_100165400
658 Ga0070664_100445366
659 Ga0068857_100223963
660 Ga0068854_100000608
661 Ga0068854_100161734
662 Ga0070702_100108169
663 Ga0068852_100015238
664 Ga0068852_100222549
665 Ga0068852_100626520
666 Ga0068859_100003195
667 Ga0068859_100023913
668 Ga0068859_100103705
669 Ga0068864_100048450
670 Ga0068866_10000559
671 Ga0068861_100000590
672 Ga0068851_10158689
673 Ga0068870_10155100
674 Ga0068863_100684208
675 Ga0068858_100004076
676 Ga0068860_100000048
677 Ga0068860_100032425
678 Ga0068862_100008197
679 Ga0068862_100050877
680 Ga0068862_100252607
681 Ga0081538_10000476
682 Ga0081539_10000915
683 Ga0081539_10017072
684 Ga0070717_10082557
685 Ga0070716_100045080
686 Ga0070716_100094687
687 Ga0070716_100102207
688 Ga0070716_100425434
689 Ga0070712_100001159
690 Ga0070712_100174495
691 Ga0070712_100269031
692 Ga0075428_100001295
693 Ga0075428_100011197
694 Ga0075428_100184097
695 Ga0075428_100230382
696 Ga0075430_100110030
697 Ga0075431_100297998
698 Ga0075433_10010057
699 Ga0075434_100003049
700 Ga0068865_100006968
701 Ga0068865_100153628
702 Ga0097620_100003195
703 Ga0097620_100023913
704 Ga0097620_100103712
705 Ga0075435_100002992
706 Ga0111539_10006978
707 Ga0111539_10288731
708 Ga0111539_10291002
709 Ga0111539_10317750
710 Ga0105245_10001283
711 Ga0105245_10028146
712 Ga0105245_10066806
713 Ga0105245_10286247
714 Ga0105247_10000559
715 Ga0105247_10001525
716 Ga0114129_10055524
717 Ga0105243_10000773
718 Ga0105243_10014486
719 Ga0105241_10012914
720 Ga0105241_10422602
721 Ga0105242_10015970
722 Ga0105242_10016154
723 Ga0105248_10000098
724 Ga0105237_10004715
725 Ga0105237_10610972
726 Ga0105238_10356039
727 Ga0105238_10810110
728 Ga0105249_10000022
729 Ga0105249_10002308
730 Ga0105249_10319174
731 Ga0105239_10021963
732 Ga0105239_10043395
733 Ga0105239_10113103
734 Ga0105239_11257851
735 Ga0105246_10121815
736 Ga0157313_1006747
737 Ga0157371_10159373
738 Ga0157370_10261115
739 Ga0157369_10042450
740 Ga0157369_10359065
741 Ga0157374_10095425
742 Ga0157378_10002823
743 Ga0163162_10002292
744 Ga0163162_10168090
745 Ga0163162_10184567
746 Ga0163162_10340069
747 Ga0157372_10000652
748 Ga0157372_10041329
749 Ga0157372_10327081
750 Ga0157375_10007902
751 Ga0163163_10218115
752 Ga0157380_10008648
753 Ga0157377_10161536
754 Ga0157379_10041184
755 Ga0157379_10444006
756 Ga0157376_11042132
757 Ga0183367_1004
758 Ga0163161_10000939
759 Ga0206350_10880292
760 Ga0213875_10009465
761 Ga0224712_10047470
762 Ga0207692_10061602
763 Ga0207642_10001793
764 Ga0207642_10021243
765 Ga0207710_10000081
766 Ga0207710_10005560
767 Ga0207688_10005861
768 Ga0207688_10021090
769 Ga0207680_10044254
770 Ga0207699_10515642
771 Ga0207645_10192305
772 Ga0207643_10008968
773 Ga0207705_10180276
774 Ga0207684_10063624
775 Ga0207654_10007526
776 Ga0207654_10308189
777 Ga0207707_10039312
778 Ga0207671_10016416
779 Ga0207693_10000513
780 Ga0207693_10013212
781 Ga0207693_10032204
782 Ga0207663_10005018
783 Ga0207660_10048388
784 Ga0207662_10018670
785 Ga0207657_10202980
786 Ga0207657_10318287
787 Ga0207652_10176400
788 Ga0207652_10807398
789 Ga0207681_10001422
790 Ga0207681_10042974
791 Ga0207659_10067678
792 Ga0207659_10208100
793 Ga0207687_10008086
794 Ga0207700_10013679
795 Ga0207664_10285883
796 Ga0207644_10057271
797 Ga0207644_10276321
798 Ga0207690_10392635
799 Ga0207706_10004404
800 Ga0207706_10011441
801 Ga0207706_10033431
802 Ga0207686_10058002
803 Ga0207709_10013876
804 Ga0207669_10073932
805 Ga0207704_10034979
806 Ga0207704_10103847
807 Ga0207665_10021915
808 Ga0207665_10033766
809 Ga0207665_10044915
810 Ga0207691_10055273
811 Ga0207691_10305782
812 Ga0207711_10002636
813 Ga0207689_10037780
814 Ga0207689_10408244
815 Ga0207661_10019752
816 Ga0207667_10115031
817 Ga0207667_10220664
818 Ga0207651_10197349
819 Ga0207651_10449182
820 Ga0207712_10000005
821 Ga0207712_10358850
822 Ga0207668_10006339
823 Ga0207668_10231141
824 Ga0207640_10068652
825 Ga0207640_10477587
826 Ga0207658_10000228
827 Ga0207658_10036075
828 Ga0207658_10453138
829 Ga0207677_10016372
830 Ga0207677_10171624
831 Ga0207703_10021173
832 Ga0207639_10014568
833 Ga0207678_10064076
834 Ga0207678_10110666
835 Ga0207708_10008812
836 Ga0207708_10107572
837 Ga0207641_10003007
838 Ga0207648_10001669
839 Ga0207674_10088919
840 Ga0207675_100006562
841 Ga0207675_100099878
842 Ga0207675_100172115
843 Ga0207683_10001309
844 Ga0207683_10048135
845 Ga0207683_10093694
846 Ga0207683_10242704
847 Ga0207698_10098666
848 Ga0207698_10294004
849 Ga0207698_10295899
850 Ga0207428_10002308
851 Ga0268266_10051845
852 Ga0268266_10595716
853 Ga0268265_10000005
854 Ga0268265_10006426
855 Ga0268265_10097441
856 Ga0268265_10331480
857 Ga0268264_10000005
858 Ga0268264_10006161
859 Ga0307517_10006976
860 Ga0307515_10000995
861 Ga0307511_10041656
862 Ga0307512_10007812
863 Ga0307512_10022815
864 Ga0307512_10066658
865 Ga0314311_1036123
866 Ga0314311_1225001
867 Ga0316180_1014567
868 Ga0265340_10002298
869 Ga0307513_10046863
870 Ga0307508_10003663
871 Ga0307508_10084585
872 Ga0307508_10150192
873 Ga0307508_10192379
874 Ga0307514_10127341
875 Ga0307514_10144328
876 Ga0307518_10074443
877 Ga0307518_10288213
878 Ga0307410_10007438
879 Ga0307410_10151523
880 Ga0307406_10000391
881 Ga0307406_10006196
882 Ga0307407_10006039
883 Ga0307412_10296494
884 Ga0307409_100000329
885 Ga0307409_100125237
886 Ga0307409_100416575
887 Ga0307416_100013434
888 Ga0307416_100056687
889 Ga0307416_100232854
890 Ga0307416_100332082
891 Ga0307414_10005709
892 Ga0307411_10008394
893 Ga0307411_10011366
894 Ga0307415_100014803
895 Ga0307415_100020162
896 Ga0307415_100141443
897 Ga0307415_100572468
898 Ga0307507_10000329
899 Ga0307507_10023243
900 Ga0307510_10002773
901 Ga0373958_0055596
902 Ga0373951_0000225
903 Ga0373955_0193084
904 Ga0373942_0043051
905 Ga0373962_0084775
906 Ga0373933_0044562
907 Ga0373937_0571084
908 Ga0373925_0088455
909 Ga0395900_0008840
910 Ga0395898_0011950
911 Ga0395898_0019488
912 Ga0395905_0260692
913 Ga0436364_0265841
914 Ga0436364_1168162
915 Ga0395901_0022806
916 Ga0451793_0322208
917 Ga0451797_1226667
918 Ga0451837_1640538
919 Ga0451841_0544407
920 Ga0451843_0608002
921 Ga0451853_1487951
922 Ga0439431_0079267
923 Ga0439463_055927
924 Ga0439440_0015268
925 Ga0466972_0218798
926 Ga0466965_0009776
927 Ga0466966_0002231
928 Ga0466966_0003431
929 Ga0466966_0248914
930 Ga0466961_0015136
931 Ga0466961_0195419
932 Ga0466963_0002088
933 Ga0466963_0126540
934 Ga0466971_0011467
935 Ga0466971_0056474
936 Ga0466970_0004930
937 Ga0466970_0008619
938 Ga0466970_0026712
939 Ga0466957_0001897
940 Ga0466957_0006722
941 Ga0466957_0251042
942 Ga0466960_0007840
943 Ga0466960_0026744
944 Ga0466959_0023686
945 Ga0466958_0000308
946 Ga0466958_0048053
947 Ga0466958_0309904
948 Ga0495592_0102860
949 Ga0495629_0012131
950 Ga0495651_0086659
951 Ga0495653_0006324
952 Ga0495653_0125941
953 Ga0495580_0021154
954 Ga0495662_0001446
955 Ga0495664_0001349
956 Ga0495606_0021517
957 Ga0495608_0008605
958 Ga0495618_0013534
959 Ga0495628_0037894
960 Ga0495628_0098330
961 Ga0495630_0169996
962 Ga0495632_0190306
963 Ga0495643_0042866
964 Ga0495648_0068169
965 Ga0495666_0051248
966 Ga0495652_0018568
967 Ga0495652_0035875
968 Ga0495652_0306371
969 Ga0495665_0004304
970 Ga0495640_0187538
971 Ga0495586_0016344
972 Ga0495587_0005692
973 Ga0495645_0269306
974 Ga0495633_0077496
975 Ga0495667_0009434
976 Ga0495634_0093903
977 Ga0495611_0020400
978 Ga0495625_0037030
979 Ga0495625_0092325
980 Ga0495635_0017096
981 Ga0495635_0055634
982 Ga0495635_0173253
983 Ga0495657_0009694
984 Ga0495657_0010805
985 Ga0495599_0019797
986 Ga0495623_0154683
987 Ga0495646_0012623
988 Ga0495613_0007151
989 Ga0495613_0036539
990 Ga0495613_0091283
991 Ga0495670_0116600
992 Ga0495671_0004298
993 Ga0495589_0003516
994 Ga0495589_0006861
995 Ga0495600_0028515
996 Ga0495600_0052072
997 Ga0495600_0069902
998 Ga0495600_0217309
999 Ga0495581_0000967
1000 Ga0495604_0001127
1001 Ga0495604_0045503
1002 Ga0495604_0099364
1003 Ga0495674_0028563
1004 Ga0495674_0283041
1005 Ga0495676_0177764
1006 Ga0495680_0033492
1007 Ga0495675_0015184
1008 Ga0495685_003776
1009 Ga0495685_004902
1010 Ga0495685_020604
1011 Ga0495681_0003262
1012 Ga0495681_0012575
1013 Ga0495684_0299842
1014 Ga0495602_0066871
1015 Ga0495614_0081036
1016 Ga0496100_0001527
1017 Ga0496100_0026666
1018 Ga0496101_0001280
1019 Ga0496101_0025110
1020 Ga0496102_0000167
1021 Ga0496102_0002930
1022 Ga0496103_0000756
1023 Ga0496106_0002000
1024 Ga0496106_0025032
1025 Ga0496107_0003585
1026 Ga0496107_0073539
1027 Ga0496108_0219123
1028 Ga0496108_0671975
1029 Ga0496109_0592652
1030 Ga0496114_0005577
1031 Ga0496115_0010173
1032 Ga0496116_0013479
1033 Ga0496116_0028833
1034 Ga0496117_0000447
1035 Ga0496118_0000286
1036 Ga0496118_0061597
1037 Ga0496119_0017635
1038 Ga0496120_0145805
1039 Ga0496121_0002177
1040 Ga0496121_0024636
1041 Ga0496124_0002462
1042 Ga0496124_0003542
1043 Ga0496126_0001691
1044 Ga0496126_0002684
1045 Ga0496126_0003999
1046 Ga0496126_0143954
1047 Ga0501031_0002451
1048 Ga0501031_0144775
1049 Ga0501032_0009387
1050 Ga0501032_0027887
1051 Ga0501032_0252652
1052 Ga0501033_0097738
1053 Ga0501033_0139865
1054 Ga0501034_0005072
1055 Ga0501036_0000537
1056 Ga0501036_0006492
1057 Ga0501036_0129501
1058 Ga0501037_0000477
1059 Ga0501037_0032542
1060 Ga0501038_0010427
1061 Ga0501038_0037215
1062 Ga0501038_0107014
1063 Ga0501039_0110042
1064 Ga0501039_0306964
1065 Ga0501041_0000607
1066 Ga0501041_0028409
1067 Ga0501042_0002337
1068 Ga0501043_0000268
1069 Ga0501043_0064738
1070 Ga0501046_0002681
1071 Ga0501046_0005007
1072 Ga0501047_0000211
1073 Ga0501047_0001983
1074 Ga0501047_0263095
1075 Ga0501047_0417600
1076 Ga0501048_0003621
1077 Ga0501048_0054942
1078 Ga0501067_0012841
1079 Ga0501068_0015731
1080 Ga0501069_0094133
1081 Ga0501070_0196517
1082 Ga0501071_0000706
1083 Ga0501072_0050956
1084 Ga0501074_0013064
1085 Ga0501075_0018763
1086 Ga0501076_0033002
1087 Ga0501076_0092617
1088 Ga0501077_0039694
1089 Ga0501079_0005473
1090 Ga0501079_0204476
1091 Ga0501080_0011989
1092 Ga0501080_0115014
1093 Ga0501080_0644569
1094 Ga0501081_0005989
1095 Ga0501083_0000458
1096 Ga0501035_0023393
1097 Ga0501044_0000779
1098 Ga0501044_0147878
1099 Ga0501044_0636817
1100 Ga0501045_0004444
1101 Ga0501045_0224448
1102 nmdc:mga05p37_457005_c1
1103 nmdc:mga06r32_101664_c1
1104 nmdc:mga08y16_11894_c1
1105 nmdc:mga08y16_8780_c1
1106 nmdc:mga0n895_12587_c1
1107 nmdc:mga0rr50_612451_c1
1108 nmdc:mga0a205_77318_c1
1109 Ga0495601_0021975
1110 Ga0495619_0023972
1111 Ga0500578_0049752
1112 Ga0500643_005312
1113 Ga0500646_0000395
1114 Ga0500566_0024289
1115 Ga0500654_047241
1116 Ga0500569_015852
1117 Ga0500652_013386
1118 Ga0500561_0000540
1119 Ga0500573_0091959
1120 Ga0500600_0034588
1121 Ga0500600_0054905
1122 Ga0500616_0059853
1123 Ga0500633_0026464
1124 Ga0500634_0115825
1125 Ga0501084_0001385
1126 Ga0501084_0006026
1127 Ga0501082_0004599
1128 Ga0501082_0061612
1129 Ga0530510_0019106
1130 Ga0530510_0022331
1131 2528205125
1132 2528215364
1133 2546950725
1134 2558914908
1135 2616693461
1136 2644270278
1137 2644442230
1138 2686540910
1139 2689993686
1140 2768645834
1141 2774863775
1142 2785366381
1143 2795785478
1144 2795796149
1145 2862290344
1146 2862290607
1147 2870724998
1148 2877684136
1149 2902795744
1150 2935894659
1151 2947225144
1152 2954389420
1153 2990067075
1154 2995464159
1155 637878954
1156 8008490703
1157 8025525791
1158 8047898982
1159 8048359937
1160 8048375946
1161 8048382267
1162 8056212861

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05988

DUF899

Bacterial protein of unknown function (DUF899)

13

216

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
5xbr-assembly1.cif.gz_A peroxiredoxin from pyrococcus horikoshii (sulfonic acid form) 0.7124 60 179
3gkn-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.6788 59 183
3w6g-assembly1.cif.gz_C structure of peroxiredoxin from anaerobic hyperthermophilic archaeon pyrococcus horikoshii 0.6777 56 179
3raz-assembly1.cif.gz_A the crystal structure of thioredoxin-related protein from neisseria meningitidis serogroup b 0.6749 62 196
2lrn-assembly1.cif.gz_A solution structure of a thiol:disulfide interchange protein from bacteroides sp. 0.6724 61 188
ID Description Score Start End Superfamily
af_A0A1D6L317_60_192_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7146 36 148 3.40.30.10
af_Q9D1A0_27_140_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.7048 59 148 3.40.30.10
2ls5A00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6877 56 185 3.40.30.10
af_A0A0R0K508_6_109_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.6865 60 150 3.40.30.10
3ub1A02 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6776 160 185 3.10.450.540
ID Description Score Start End GO Terms
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.8917 63 174
AF-A0A845HT60-F1-model_v4 DUF899 domain-containing protein 0.8692 43 179
AF-A0A848QGV2-F1-model_v4 deleted 0.8583 57 217
AF-A0A0L1KI92-F1-model_v4 DUF899 domain-containing protein 0.8577 32 198
AF-A0A2S9FP09-F1-model_v4 DUF899 domain-containing protein 0.8547 63 174

Map