F466104
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 581 | 246 | 581 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300047444|Ga0495675_0402791|Ga0495675_0402791_330_638 |
| Length | 102 |
| Sequence | MNVGLEHYLVVSALLFCLGLMGVIVRRNLLVIYMSLELMLNAANLALVAFSRFSKDSLDGQVFVFFIITVAAAEVSVGLALIVALYRKRQTAHVEDLTSMRL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 10 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 30 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 45 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 46 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 52 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 53 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 54 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 55 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 59 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 60 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 61 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 118 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 119 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 120 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 122 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 123 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 124 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 125 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 126 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 127 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 128 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 129 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 130 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 131 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 132 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 133 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 134 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 135 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 136 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 137 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 138 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 139 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 140 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 141 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 142 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 143 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 144 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 145 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 146 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 147 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 148 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 149 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 150 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 152 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 153 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 154 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 155 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 156 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 157 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 158 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 159 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 160 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 161 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 162 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 163 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 167 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 168 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 169 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 170 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 171 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 172 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 173 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 174 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 175 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 178 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 179 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 180 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 181 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 182 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 183 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 184 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 185 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 186 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 228 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 229 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 244 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 245 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 1.38 |
| Rhizosphere | 97.93 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_12717097 | 2162886012 | Unclassified | 1062 |
| 2 | CNXas_1002134 | 3300000545 | Bacteria | 1362 |
| 3 | Ga0065707_10340233 | 3300005295 | Bacteria | 935 |
| 4 | Ga0070658_10802087 | 3300005327 | Bacteria | 818 |
| 5 | Ga0070658_10933391 | 3300005327 | Bacteria | 755 |
| 6 | Ga0070683_100240949 | 3300005329 | Bacteria | 1720 |
| 7 | Ga0070690_100340087 | 3300005330 | Bacteria | 1086 |
| 8 | Ga0070690_100784226 | 3300005330 | Bacteria | 738 |
| 9 | Ga0070670_100787039 | 3300005331 | Bacteria | 858 |
| 10 | Ga0070677_10212551 | 3300005333 | Bacteria | 940 |
| 11 | Ga0070677_10596111 | 3300005333 | Bacteria | 611 |
| 12 | Ga0068869_102072277 | 3300005334 | Bacteria | 511 |
| 13 | Ga0070666_10011337 | 3300005335 | Bacteria | 5593 |
| 14 | Ga0070680_100784055 | 3300005336 | Unclassified | 821 |
| 15 | Ga0070689_100020023 | 3300005340 | Bacteria | 4959 |
| 16 | Ga0070689_100044621 | 3300005340 | Bacteria | 3411 |
| 17 | Ga0070689_100245345 | 3300005340 | Bacteria | 1476 |
| 18 | Ga0070689_100382224 | 3300005340 | Bacteria | 1187 |
| 19 | Ga0070689_100419399 | 3300005340 | Bacteria | 1134 |
| 20 | Ga0070689_100867040 | 3300005340 | Unclassified | 797 |
| 21 | Ga0070689_101066437 | 3300005340 | Bacteria | 721 |
| 22 | Ga0070689_102047811 | 3300005340 | Bacteria | 524 |
| 23 | Ga0070691_10043530 | 3300005341 | Bacteria | 2127 |
| 24 | Ga0070691_10343443 | 3300005341 | Bacteria | 827 |
| 25 | Ga0070691_10492401 | 3300005341 | Bacteria | 707 |
| 26 | Ga0070687_100406706 | 3300005343 | Bacteria | 894 |
| 27 | Ga0070687_100916662 | 3300005343 | Unclassified | 629 |
| 28 | Ga0070674_101741120 | 3300005356 | Bacteria | 564 |
| 29 | Ga0070688_100176123 | 3300005365 | Unclassified | 1480 |
| 30 | Ga0070688_100244884 | 3300005365 | Bacteria | 1274 |
| 31 | Ga0070688_101073858 | 3300005365 | Bacteria | 642 |
| 32 | Ga0070688_101183979 | 3300005365 | Unclassified | 613 |
| 33 | Ga0070688_101251180 | 3300005365 | Bacteria | 598 |
| 34 | Ga0070659_101522694 | 3300005366 | Bacteria | 596 |
| 35 | Ga0070709_10656682 | 3300005434 | Unclassified | 812 |
| 36 | Ga0070714_100300146 | 3300005435 | Bacteria | 1497 |
| 37 | Ga0070713_100489960 | 3300005436 | Bacteria | 1159 |
| 38 | Ga0070713_100914350 | 3300005436 | Bacteria | 844 |
| 39 | Ga0070710_10889577 | 3300005437 | Unclassified | 642 |
| 40 | Ga0070711_100317758 | 3300005439 | Bacteria | 1243 |
| 41 | Ga0070711_101075046 | 3300005439 | Bacteria | 692 |
| 42 | Ga0070711_101946635 | 3300005439 | Bacteria | 517 |
| 43 | Ga0070705_100044317 | 3300005440 | Bacteria | 2555 |
| 44 | Ga0070705_100072025 | 3300005440 | Bacteria | 2092 |
| 45 | Ga0070705_100165050 | 3300005440 | Unclassified | 1485 |
| 46 | Ga0070705_100287343 | 3300005440 | Bacteria | 1172 |
| 47 | Ga0070700_100217341 | 3300005441 | Bacteria | 1352 |
| 48 | Ga0070700_100541924 | 3300005441 | Bacteria | 902 |
| 49 | Ga0070694_100363534 | 3300005444 | Bacteria | 1124 |
| 50 | Ga0070708_101803050 | 3300005445 | Bacteria | 568 |
| 51 | Ga0070708_101987771 | 3300005445 | Unclassified | 538 |
| 52 | Ga0070678_100984803 | 3300005456 | Bacteria | 774 |
| 53 | Ga0070681_11638911 | 3300005458 | Bacteria | 569 |
| 54 | Ga0068867_100658930 | 3300005459 | Bacteria | 919 |
| 55 | Ga0068867_101992778 | 3300005459 | Bacteria | 549 |
| 56 | Ga0070685_10726668 | 3300005466 | Unclassified | 726 |
| 57 | Ga0070685_10927646 | 3300005466 | Bacteria | 649 |
| 58 | Ga0070685_10970877 | 3300005466 | Bacteria | 636 |
| 59 | Ga0070685_11064887 | 3300005466 | Unclassified | 609 |
| 60 | Ga0070707_101517758 | 3300005468 | Bacteria | 637 |
| 61 | Ga0070698_101362798 | 3300005471 | Bacteria | 660 |
| 62 | Ga0070698_101383762 | 3300005471 | Bacteria | 654 |
| 63 | Ga0070679_100122690 | 3300005530 | Bacteria | 2582 |
| 64 | Ga0070679_100143599 | 3300005530 | Bacteria | 2365 |
| 65 | Ga0070679_100194328 | 3300005530 | Bacteria | 1997 |
| 66 | Ga0070684_100442919 | 3300005535 | Bacteria | 1200 |
| 67 | Ga0070684_100583023 | 3300005535 | Bacteria | 1039 |
| 68 | Ga0070684_102092582 | 3300005535 | Bacteria | 534 |
| 69 | Ga0070686_100138195 | 3300005544 | Bacteria | 1693 |
| 70 | Ga0070686_100162157 | 3300005544 | Bacteria | 1575 |
| 71 | Ga0070686_100680752 | 3300005544 | Bacteria | 818 |
| 72 | Ga0070693_101065905 | 3300005547 | Bacteria | 615 |
| 73 | Ga0070704_100297165 | 3300005549 | Bacteria | 1344 |
| 74 | Ga0070704_101292066 | 3300005549 | Bacteria | 667 |
| 75 | Ga0068855_100087596 | 3300005563 | Bacteria | 3598 |
| 76 | Ga0068855_100134319 | 3300005563 | Bacteria | 2823 |
| 77 | Ga0068855_100233000 | 3300005563 | Bacteria | 2061 |
| 78 | Ga0068855_102276872 | 3300005563 | Bacteria | 543 |
| 79 | Ga0068857_100479935 | 3300005577 | Bacteria | 1165 |
| 80 | Ga0068857_101058347 | 3300005577 | Unclassified | 782 |
| 81 | Ga0068856_100001472 | 3300005614 | Bacteria | 24668 |
| 82 | Ga0068856_100156059 | 3300005614 | Bacteria | 2292 |
| 83 | Ga0068856_100188235 | 3300005614 | Bacteria | 2078 |
| 84 | Ga0068856_100195917 | 3300005614 | Bacteria | 2034 |
| 85 | Ga0068856_100273763 | 3300005614 | Bacteria | 1704 |
| 86 | Ga0068856_102064366 | 3300005614 | Bacteria | 580 |
| 87 | Ga0070702_101305404 | 3300005615 | Bacteria | 589 |
| 88 | Ga0068859_100004968 | 3300005617 | Bacteria | 13511 |
| 89 | Ga0068859_100134529 | 3300005617 | Bacteria | 2544 |
| 90 | Ga0068859_100265873 | 3300005617 | Bacteria | 1807 |
| 91 | Ga0068859_102231001 | 3300005617 | Unclassified | 604 |
| 92 | Ga0068859_102832364 | 3300005617 | Bacteria | 532 |
| 93 | Ga0068864_100026221 | 3300005618 | Bacteria | 4914 |
| 94 | Ga0068864_102222992 | 3300005618 | Bacteria | 555 |
| 95 | Ga0068861_101431017 | 3300005719 | Bacteria | 676 |
| 96 | Ga0068863_100024694 | 3300005841 | Bacteria | 5732 |
| 97 | Ga0068863_100124594 | 3300005841 | Bacteria | 2458 |
| 98 | Ga0068863_100444383 | 3300005841 | Bacteria | 1272 |
| 99 | Ga0068863_100692705 | 3300005841 | Bacteria | 1012 |
| 100 | Ga0068863_102355954 | 3300005841 | Bacteria | 542 |
| 101 | Ga0068863_102642182 | 3300005841 | Bacteria | 511 |
| 102 | Ga0068860_100844683 | 3300005843 | Bacteria | 930 |
| 103 | Ga0081455_10365903 | 3300005937 | Bacteria | 1012 |
| 104 | Ga0070717_10566718 | 3300006028 | Bacteria | 1029 |
| 105 | Ga0070716_101362899 | 3300006173 | Unclassified | 575 |
| 106 | Ga0070712_101447006 | 3300006175 | Bacteria | 600 |
| 107 | Ga0097621_100327109 | 3300006237 | Bacteria | 1359 |
| 108 | Ga0068871_101756438 | 3300006358 | Bacteria | 589 |
| 109 | Ga0075428_100003239 | 3300006844 | Bacteria | 17824 |
| 110 | Ga0075431_100160575 | 3300006847 | Bacteria | 2311 |
| 111 | Ga0075434_100215256 | 3300006871 | Bacteria | 1941 |
| 112 | Ga0075434_101555871 | 3300006871 | Bacteria | 670 |
| 113 | Ga0068865_101169670 | 3300006881 | Bacteria | 680 |
| 114 | Ga0068865_101651208 | 3300006881 | Bacteria | 577 |
| 115 | Ga0097620_100004968 | 3300006931 | Bacteria | 13511 |
| 116 | Ga0097620_100134526 | 3300006931 | Bacteria | 2544 |
| 117 | Ga0097620_100265877 | 3300006931 | Bacteria | 1807 |
| 118 | Ga0097620_102230650 | 3300006931 | Unclassified | 604 |
| 119 | Ga0097620_102830959 | 3300006931 | Bacteria | 532 |
| 120 | Ga0075435_100189564 | 3300007076 | Bacteria | 1740 |
| 121 | Ga0075435_100387961 | 3300007076 | Bacteria | 1200 |
| 122 | Ga0075435_101122376 | 3300007076 | Unclassified | 687 |
| 123 | Ga0099794_10628155 | 3300007265 | Bacteria | 570 |
| 124 | Ga0099795_10438343 | 3300007788 | Bacteria | 599 |
| 125 | Ga0105240_10002292 | 3300009093 | Bacteria | 30998 |
| 126 | Ga0105240_10075008 | 3300009093 | Bacteria | 4173 |
| 127 | Ga0105240_10275551 | 3300009093 | Bacteria | 1935 |
| 128 | Ga0105240_10327190 | 3300009093 | Bacteria | 1745 |
| 129 | Ga0105240_10355920 | 3300009093 | Bacteria | 1660 |
| 130 | Ga0105240_10549536 | 3300009093 | Bacteria | 1278 |
| 131 | Ga0111539_10004958 | 3300009094 | Bacteria | 17316 |
| 132 | Ga0111539_10553070 | 3300009094 | Bacteria | 1340 |
| 133 | Ga0111539_10851994 | 3300009094 | Bacteria | 1060 |
| 134 | Ga0105245_10384377 | 3300009098 | Bacteria | 1399 |
| 135 | Ga0105245_11112250 | 3300009098 | Unclassified | 836 |
| 136 | Ga0105245_12417309 | 3300009098 | Bacteria | 579 |
| 137 | Ga0114129_11393681 | 3300009147 | Bacteria | 865 |
| 138 | Ga0114129_13381760 | 3300009147 | Bacteria | 514 |
| 139 | Ga0105241_11173988 | 3300009174 | Bacteria | 726 |
| 140 | Ga0105242_10365668 | 3300009176 | Bacteria | 1336 |
| 141 | Ga0105242_10955328 | 3300009176 | Bacteria | 861 |
| 142 | Ga0105242_11608342 | 3300009176 | Unclassified | 684 |
| 143 | Ga0105248_11013986 | 3300009177 | Unclassified | 938 |
| 144 | Ga0105248_11439820 | 3300009177 | Bacteria | 780 |
| 145 | Ga0105248_11506857 | 3300009177 | Bacteria | 761 |
| 146 | Ga0105237_10519599 | 3300009545 | Bacteria | 1197 |
| 147 | Ga0105238_10019653 | 3300009551 | Bacteria | 6879 |
| 148 | Ga0105238_10024440 | 3300009551 | Bacteria | 6158 |
| 149 | Ga0105238_10110124 | 3300009551 | Bacteria | 2735 |
| 150 | Ga0105238_10378912 | 3300009551 | Bacteria | 1406 |
| 151 | Ga0105249_11325990 | 3300009553 | Bacteria | 791 |
| 152 | Ga0105249_11757359 | 3300009553 | Bacteria | 693 |
| 153 | Ga0157370_10051388 | 3300013104 | Bacteria | 3937 |
| 154 | Ga0157369_12547985 | 3300013105 | Bacteria | 518 |
| 155 | Ga0157374_10264923 | 3300013296 | Bacteria | 1694 |
| 156 | Ga0157374_10343348 | 3300013296 | Bacteria | 1482 |
| 157 | Ga0157378_11527480 | 3300013297 | Bacteria | 713 |
| 158 | Ga0157378_12856588 | 3300013297 | Bacteria | 535 |
| 159 | Ga0163162_11284802 | 3300013306 | Bacteria | 831 |
| 160 | Ga0163162_11792829 | 3300013306 | Unclassified | 701 |
| 161 | Ga0157372_10547801 | 3300013307 | Bacteria | 1348 |
| 162 | Ga0157372_10621504 | 3300013307 | Bacteria | 1259 |
| 163 | Ga0157372_10770192 | 3300013307 | Bacteria | 1119 |
| 164 | Ga0157375_10000086 | 3300013308 | Bacteria | 93377 |
| 165 | Ga0157375_10854998 | 3300013308 | Bacteria | 1056 |
| 166 | Ga0157375_12222821 | 3300013308 | Bacteria | 654 |
| 167 | Ga0163163_10019087 | 3300014325 | Bacteria | 6433 |
| 168 | Ga0163163_10437443 | 3300014325 | Bacteria | 1367 |
| 169 | Ga0157380_11060780 | 3300014326 | Bacteria | 847 |
| 170 | Ga0157379_10383658 | 3300014968 | Bacteria | 1289 |
| 171 | Ga0157379_11150987 | 3300014968 | Unclassified | 745 |
| 172 | Ga0207682_10189019 | 3300025893 | Bacteria | 943 |
| 173 | Ga0207692_10666290 | 3300025898 | Unclassified | 673 |
| 174 | Ga0207680_10068302 | 3300025903 | Bacteria | 2192 |
| 175 | Ga0207699_10583542 | 3300025906 | Unclassified | 813 |
| 176 | Ga0207705_10351738 | 3300025909 | Bacteria | 1135 |
| 177 | Ga0207705_10662747 | 3300025909 | Bacteria | 811 |
| 178 | Ga0207695_10025957 | 3300025913 | Bacteria | 6547 |
| 179 | Ga0207695_10028567 | 3300025913 | Bacteria | 6180 |
| 180 | Ga0207695_10253737 | 3300025913 | Bacteria | 1658 |
| 181 | Ga0207695_10255476 | 3300025913 | Bacteria | 1651 |
| 182 | Ga0207695_10371505 | 3300025913 | Bacteria | 1316 |
| 183 | Ga0207695_10379811 | 3300025913 | Bacteria | 1299 |
| 184 | Ga0207663_10001010 | 3300025916 | Bacteria | 12879 |
| 185 | Ga0207663_10316654 | 3300025916 | Bacteria | 1171 |
| 186 | Ga0207663_10837264 | 3300025916 | Bacteria | 734 |
| 187 | Ga0207662_10194547 | 3300025918 | Bacteria | 1310 |
| 188 | Ga0207657_11077041 | 3300025919 | Bacteria | 615 |
| 189 | Ga0207652_10245481 | 3300025921 | Bacteria | 1614 |
| 190 | Ga0207652_10312673 | 3300025921 | Bacteria | 1418 |
| 191 | Ga0207694_10028210 | 3300025924 | Bacteria | 4279 |
| 192 | Ga0207694_10067143 | 3300025924 | Bacteria | 2799 |
| 193 | Ga0207694_10071433 | 3300025924 | Bacteria | 2712 |
| 194 | Ga0207650_10581199 | 3300025925 | Bacteria | 941 |
| 195 | Ga0207659_11598040 | 3300025926 | Bacteria | 557 |
| 196 | Ga0207687_10793602 | 3300025927 | Unclassified | 807 |
| 197 | Ga0207700_11833712 | 3300025928 | Bacteria | 533 |
| 198 | Ga0207686_10638785 | 3300025934 | Bacteria | 841 |
| 199 | Ga0207670_10015941 | 3300025936 | Bacteria | 4502 |
| 200 | Ga0207670_10114746 | 3300025936 | Bacteria | 1947 |
| 201 | Ga0207670_10150449 | 3300025936 | Bacteria | 1727 |
| 202 | Ga0207670_10178956 | 3300025936 | Bacteria | 1596 |
| 203 | Ga0207670_10209307 | 3300025936 | Bacteria | 1486 |
| 204 | Ga0207670_10303432 | 3300025936 | Bacteria | 1251 |
| 205 | Ga0207670_10543860 | 3300025936 | Bacteria | 948 |
| 206 | Ga0207670_10598088 | 3300025936 | Bacteria | 905 |
| 207 | Ga0207670_10926646 | 3300025936 | Unclassified | 731 |
| 208 | Ga0207670_11093391 | 3300025936 | Bacteria | 673 |
| 209 | Ga0207704_10867994 | 3300025938 | Bacteria | 757 |
| 210 | Ga0207711_10785402 | 3300025941 | Bacteria | 887 |
| 211 | Ga0207689_11699845 | 3300025942 | Bacteria | 523 |
| 212 | Ga0207667_10051360 | 3300025949 | Bacteria | 4347 |
| 213 | Ga0207667_10258381 | 3300025949 | Bacteria | 1781 |
| 214 | Ga0207667_10483029 | 3300025949 | Bacteria | 1258 |
| 215 | Ga0207667_11616996 | 3300025949 | Bacteria | 616 |
| 216 | Ga0207651_11309888 | 3300025960 | Unclassified | 651 |
| 217 | Ga0207712_10593548 | 3300025961 | Bacteria | 957 |
| 218 | Ga0207639_10762182 | 3300026041 | Bacteria | 900 |
| 219 | Ga0207708_10999313 | 3300026075 | Bacteria | 727 |
| 220 | Ga0207702_10002049 | 3300026078 | Bacteria | 19503 |
| 221 | Ga0207702_10011792 | 3300026078 | Bacteria | 7279 |
| 222 | Ga0207702_10173900 | 3300026078 | Bacteria | 1977 |
| 223 | Ga0207702_11260282 | 3300026078 | Bacteria | 733 |
| 224 | Ga0207641_10018189 | 3300026088 | Bacteria | 5761 |
| 225 | Ga0207641_11147895 | 3300026088 | Bacteria | 776 |
| 226 | Ga0207648_10200676 | 3300026089 | Bacteria | 1769 |
| 227 | Ga0207676_10970556 | 3300026095 | Bacteria | 836 |
| 228 | Ga0207674_10300018 | 3300026116 | Bacteria | 1555 |
| 229 | Ga0207674_10632239 | 3300026116 | Bacteria | 1034 |
| 230 | Ga0207675_101302608 | 3300026118 | Bacteria | 747 |
| 231 | Ga0207683_10493150 | 3300026121 | Bacteria | 1131 |
| 232 | Ga0207683_11402734 | 3300026121 | Bacteria | 646 |
| 233 | Ga0209588_1263695 | 3300027671 | Bacteria | 524 |
| 234 | Ga0209974_10157399 | 3300027876 | Unclassified | 823 |
| 235 | Ga0268265_11797707 | 3300028380 | Bacteria | 619 |
| 236 | Ga0268265_12039520 | 3300028380 | Bacteria | 581 |
| 237 | Ga0268264_11577944 | 3300028381 | Bacteria | 667 |
| 238 | Ga0265337_1000140 | 3300028556 | Bacteria | 36107 |
| 239 | Ga0265337_1000920 | 3300028556 | Bacteria | 15425 |
| 240 | Ga0265337_1004569 | 3300028556 | Bacteria | 5709 |
| 241 | Ga0265337_1007544 | 3300028556 | Bacteria | 4062 |
| 242 | Ga0265337_1009032 | 3300028556 | Bacteria | 3582 |
| 243 | Ga0265337_1020782 | 3300028556 | Bacteria | 2054 |
| 244 | Ga0265337_1055732 | 3300028556 | Bacteria | 1103 |
| 245 | Ga0265337_1085897 | 3300028556 | Bacteria | 859 |
| 246 | Ga0265337_1105318 | 3300028556 | Bacteria | 767 |
| 247 | Ga0265326_10051322 | 3300028558 | Bacteria | 1168 |
| 248 | Ga0265326_10099858 | 3300028558 | Bacteria | 823 |
| 249 | Ga0265326_10103142 | 3300028558 | Unclassified | 809 |
| 250 | Ga0265326_10124954 | 3300028558 | Bacteria | 732 |
| 251 | Ga0265326_10167869 | 3300028558 | Bacteria | 628 |
| 252 | Ga0265319_1000007 | 3300028563 | Bacteria | 217194 |
| 253 | Ga0265319_1003681 | 3300028563 | Bacteria | 7891 |
| 254 | Ga0265319_1011822 | 3300028563 | Bacteria | 3554 |
| 255 | Ga0265319_1167746 | 3300028563 | Bacteria | 677 |
| 256 | Ga0265319_1169444 | 3300028563 | Bacteria | 673 |
| 257 | Ga0265334_10021782 | 3300028573 | Bacteria | 2616 |
| 258 | Ga0265334_10064430 | 3300028573 | Bacteria | 1376 |
| 259 | Ga0265318_10035245 | 3300028577 | Bacteria | 1925 |
| 260 | Ga0265318_10045073 | 3300028577 | Bacteria | 1667 |
| 261 | Ga0265318_10315353 | 3300028577 | Bacteria | 571 |
| 262 | Ga0265323_10000237 | 3300028653 | Bacteria | 32647 |
| 263 | Ga0265323_10026728 | 3300028653 | Bacteria | 2173 |
| 264 | Ga0265323_10030725 | 3300028653 | Bacteria | 1999 |
| 265 | Ga0265323_10077387 | 3300028653 | Bacteria | 1128 |
| 266 | Ga0265322_10001686 | 3300028654 | Bacteria | 7024 |
| 267 | Ga0265322_10044124 | 3300028654 | Bacteria | 1270 |
| 268 | Ga0265322_10063228 | 3300028654 | Bacteria | 1050 |
| 269 | Ga0265322_10101086 | 3300028654 | Bacteria | 820 |
| 270 | Ga0265336_10006142 | 3300028666 | Bacteria | 4352 |
| 271 | Ga0265336_10016947 | 3300028666 | Bacteria | 2375 |
| 272 | Ga0265336_10036849 | 3300028666 | Bacteria | 1505 |
| 273 | Ga0265336_10073420 | 3300028666 | Bacteria | 1022 |
| 274 | Ga0265336_10095956 | 3300028666 | Bacteria | 884 |
| 275 | Ga0265336_10142212 | 3300028666 | Bacteria | 714 |
| 276 | Ga0265336_10213733 | 3300028666 | Bacteria | 573 |
| 277 | Ga0265338_10000431 | 3300028800 | Bacteria | 75210 |
| 278 | Ga0265338_10001555 | 3300028800 | Bacteria | 37061 |
| 279 | Ga0265338_10008592 | 3300028800 | Bacteria | 12357 |
| 280 | Ga0265338_10009353 | 3300028800 | Bacteria | 11706 |
| 281 | Ga0265338_10010919 | 3300028800 | Bacteria | 10561 |
| 282 | Ga0265338_10011481 | 3300028800 | Bacteria | 10227 |
| 283 | Ga0265338_10013859 | 3300028800 | Bacteria | 9057 |
| 284 | Ga0265338_10014147 | 3300028800 | Bacteria | 8919 |
| 285 | Ga0265338_10019255 | 3300028800 | Bacteria | 7259 |
| 286 | Ga0265338_10021384 | 3300028800 | Bacteria | 6748 |
| 287 | Ga0265338_10024132 | 3300028800 | Bacteria | 6224 |
| 288 | Ga0265338_10027437 | 3300028800 | Bacteria | 5713 |
| 289 | Ga0265338_10032402 | 3300028800 | Bacteria | 5098 |
| 290 | Ga0265338_10045342 | 3300028800 | Bacteria | 4044 |
| 291 | Ga0265338_10048780 | 3300028800 | Bacteria | 3848 |
| 292 | Ga0265338_10052571 | 3300028800 | Bacteria | 3653 |
| 293 | Ga0265338_10076720 | 3300028800 | Bacteria | 2829 |
| 294 | Ga0265338_10137665 | 3300028800 | Bacteria | 1916 |
| 295 | Ga0265338_10193904 | 3300028800 | Bacteria | 1537 |
| 296 | Ga0265338_10233317 | 3300028800 | Bacteria | 1367 |
| 297 | Ga0265338_10334064 | 3300028800 | Bacteria | 1094 |
| 298 | Ga0265338_10387676 | 3300028800 | Bacteria | 998 |
| 299 | Ga0265338_10416422 | 3300028800 | Bacteria | 956 |
| 300 | Ga0265338_10437016 | 3300028800 | Bacteria | 928 |
| 301 | Ga0265338_10479050 | 3300028800 | Bacteria | 878 |
| 302 | Ga0265338_10711517 | 3300028800 | Bacteria | 693 |
| 303 | Ga0265338_10758404 | 3300028800 | Bacteria | 667 |
| 304 | Ga0265338_10782530 | 3300028800 | Bacteria | 654 |
| 305 | Ga0265324_10002329 | 3300029957 | Bacteria | 9831 |
| 306 | Ga0265324_10015253 | 3300029957 | Bacteria | 2829 |
| 307 | Ga0265324_10015285 | 3300029957 | Bacteria | 2825 |
| 308 | Ga0265324_10019169 | 3300029957 | Bacteria | 2466 |
| 309 | Ga0265324_10019506 | 3300029957 | Bacteria | 2443 |
| 310 | Ga0265324_10034697 | 3300029957 | Bacteria | 1757 |
| 311 | Ga0265324_10039188 | 3300029957 | Bacteria | 1643 |
| 312 | Ga0265324_10067478 | 3300029957 | Bacteria | 1220 |
| 313 | Ga0265324_10143451 | 3300029957 | Bacteria | 811 |
| 314 | Ga0265324_10170240 | 3300029957 | Bacteria | 740 |
| 315 | Ga0307511_10125600 | 3300030521 | Bacteria | 1567 |
| 316 | Ga0265330_10030858 | 3300031235 | Bacteria | 2404 |
| 317 | Ga0265332_10199062 | 3300031238 | Bacteria | 833 |
| 318 | Ga0265320_10000188 | 3300031240 | Bacteria | 51229 |
| 319 | Ga0265320_10003925 | 3300031240 | Bacteria | 9826 |
| 320 | Ga0265320_10004415 | 3300031240 | Bacteria | 9228 |
| 321 | Ga0265320_10011472 | 3300031240 | Bacteria | 5213 |
| 322 | Ga0265320_10048479 | 3300031240 | Bacteria | 2072 |
| 323 | Ga0265320_10094740 | 3300031240 | Bacteria | 1380 |
| 324 | Ga0265320_10182402 | 3300031240 | Bacteria | 940 |
| 325 | Ga0265320_10256439 | 3300031240 | Bacteria | 775 |
| 326 | Ga0265320_10449597 | 3300031240 | Bacteria | 569 |
| 327 | Ga0265325_10023559 | 3300031241 | Bacteria | 3358 |
| 328 | Ga0265325_10050609 | 3300031241 | Bacteria | 2138 |
| 329 | Ga0265325_10312137 | 3300031241 | Bacteria | 700 |
| 330 | Ga0265329_10109577 | 3300031242 | Bacteria | 882 |
| 331 | Ga0265340_10058985 | 3300031247 | Bacteria | 1842 |
| 332 | Ga0265340_10069957 | 3300031247 | Bacteria | 1665 |
| 333 | Ga0265340_10433150 | 3300031247 | Bacteria | 580 |
| 334 | Ga0265339_10017090 | 3300031249 | Bacteria | 4302 |
| 335 | Ga0265339_10199786 | 3300031249 | Bacteria | 987 |
| 336 | Ga0265331_10077949 | 3300031250 | Bacteria | 1543 |
| 337 | Ga0265331_10182628 | 3300031250 | Unclassified | 947 |
| 338 | Ga0265327_10000752 | 3300031251 | Bacteria | 50420 |
| 339 | Ga0265327_10008595 | 3300031251 | Bacteria | 7572 |
| 340 | Ga0265327_10230600 | 3300031251 | Bacteria | 830 |
| 341 | Ga0265316_10006885 | 3300031344 | Bacteria | 10789 |
| 342 | Ga0265316_10009696 | 3300031344 | Bacteria | 8839 |
| 343 | Ga0265316_10010502 | 3300031344 | Bacteria | 8432 |
| 344 | Ga0265316_10010930 | 3300031344 | Bacteria | 8241 |
| 345 | Ga0265316_10066910 | 3300031344 | Bacteria | 2779 |
| 346 | Ga0265316_10079893 | 3300031344 | Bacteria | 2509 |
| 347 | Ga0265316_10147414 | 3300031344 | Bacteria | 1764 |
| 348 | Ga0265316_10213115 | 3300031344 | Bacteria | 1428 |
| 349 | Ga0265316_10268736 | 3300031344 | Bacteria | 1248 |
| 350 | Ga0265313_10001008 | 3300031595 | Bacteria | 27543 |
| 351 | Ga0265313_10012570 | 3300031595 | Bacteria | 5154 |
| 352 | Ga0265313_10131179 | 3300031595 | Bacteria | 1085 |
| 353 | Ga0265314_10024198 | 3300031711 | Bacteria | 4608 |
| 354 | Ga0265314_10043005 | 3300031711 | Bacteria | 3216 |
| 355 | Ga0265314_10248883 | 3300031711 | Bacteria | 1021 |
| 356 | Ga0265314_10618729 | 3300031711 | Bacteria | 556 |
| 357 | Ga0265314_10687799 | 3300031711 | Bacteria | 518 |
| 358 | Ga0265342_10055412 | 3300031712 | Bacteria | 2353 |
| 359 | Ga0265342_10362426 | 3300031712 | Bacteria | 753 |
| 360 | Ga0265342_10432801 | 3300031712 | Bacteria | 676 |
| 361 | Ga0265342_10459597 | 3300031712 | Bacteria | 653 |
| 362 | Ga0316576_10670239 | 3300031727 | Bacteria | 753 |
| 363 | Ga0316585_10075010 | 3300032137 | Bacteria | 1100 |
| 364 | Ga0373930_0000589 | 3300034816 | Bacteria | 5037 |
| 365 | Ga0373948_0115770 | 3300034817 | Bacteria | 644 |
| 366 | Ga0373950_0009528 | 3300034818 | Bacteria | 1553 |
| 367 | Ga0373958_0143320 | 3300034819 | Bacteria | 593 |
| 368 | Ga0373926_0298641 | 3300035083 | Unclassified | 628 |
| 369 | Ga0373928_0000124 | 3300035084 | Bacteria | 14419 |
| 370 | Ga0373929_0002245 | 3300035085 | Bacteria | 3573 |
| 371 | Ga0373934_0313006 | 3300035086 | Bacteria | 652 |
| 372 | Ga0373940_0002420 | 3300035088 | Bacteria | 3627 |
| 373 | Ga0373944_0005149 | 3300035089 | Bacteria | 3435 |
| 374 | Ga0373949_0002141 | 3300035090 | Bacteria | 5191 |
| 375 | Ga0373949_0286782 | 3300035090 | Bacteria | 519 |
| 376 | Ga0373951_0004091 | 3300035091 | Bacteria | 3489 |
| 377 | Ga0373951_0047262 | 3300035091 | Bacteria | 1051 |
| 378 | Ga0373923_0250547 | 3300035111 | Unclassified | 829 |
| 379 | Ga0373932_0000001 | 3300035112 | Bacteria | 1459067 |
| 380 | Ga0373939_0169406 | 3300035114 | Bacteria | 807 |
| 381 | Ga0373945_0035902 | 3300035116 | Bacteria | 1774 |
| 382 | Ga0373953_0228589 | 3300035117 | Bacteria | 807 |
| 383 | Ga0373954_0239919 | 3300035118 | Unclassified | 892 |
| 384 | Ga0373956_0005667 | 3300035119 | Bacteria | 4994 |
| 385 | Ga0373957_0473886 | 3300035120 | Bacteria | 543 |
| 386 | Ga0373946_0075615 | 3300035171 | Bacteria | 1464 |
| 387 | Ga0373946_0156698 | 3300035171 | Bacteria | 1066 |
| 388 | Ga0373955_0744331 | 3300035172 | Bacteria | 602 |
| 389 | Ga0373942_0185163 | 3300035207 | Bacteria | 684 |
| 390 | Ga0373962_0000018 | 3300035242 | Bacteria | 47177 |
| 391 | Ga0316574_0304294 | 3300035398 | Bacteria | 1013 |
| 392 | Ga0373931_0000002 | 3300035691 | Bacteria | 599830 |
| 393 | Ga0373935_0003342 | 3300035692 | Bacteria | 9294 |
| 394 | Ga0373935_0104655 | 3300035692 | Bacteria | 1871 |
| 395 | Ga0373927_0002183 | 3300035695 | Bacteria | 14381 |
| 396 | Ga0373927_0032231 | 3300035695 | Bacteria | 3412 |
| 397 | Ga0373927_0036781 | 3300035695 | Bacteria | 3182 |
| 398 | Ga0373927_0929953 | 3300035695 | Unclassified | 574 |
| 399 | Ga0373933_0200470 | 3300035724 | Bacteria | 1277 |
| 400 | Ga0373947_0121838 | 3300035725 | Bacteria | 1657 |
| 401 | Ga0373947_0175980 | 3300035725 | Bacteria | 1391 |
| 402 | Ga0373937_0001956 | 3300036401 | Bacteria | 17266 |
| 403 | Ga0373937_0176416 | 3300036401 | Bacteria | 2006 |
| 404 | Ga0373937_0289399 | 3300036401 | Unclassified | 1548 |
| 405 | Ga0373937_1897835 | 3300036401 | Bacteria | 542 |
| 406 | Ga0316582_0411437 | 3300036647 | Bacteria | 932 |
| 407 | Ga0316584_0391748 | 3300036712 | Bacteria | 991 |
| 408 | Ga0373925_0000272 | 3300037068 | Bacteria | 54186 |
| 409 | Ga0373925_0000552 | 3300037068 | Bacteria | 36801 |
| 410 | Ga0373925_0479213 | 3300037068 | Bacteria | 1020 |
| 411 | Ga0373925_0705058 | 3300037068 | Bacteria | 832 |
| 412 | Ga0373925_1262262 | 3300037068 | Unclassified | 606 |
| 413 | Ga0451793_1237591 | 3300041452 | Bacteria | 520 |
| 414 | Ga0451793_1754102 | 3300041452 | Bacteria | 1021 |
| 415 | Ga0451798_0735027 | 3300041458 | Bacteria | 637 |
| 416 | Ga0451804_0855333 | 3300041463 | Bacteria | 1100 |
| 417 | Ga0451807_1698768 | 3300041486 | Bacteria | 508 |
| 418 | Ga0451835_1202569 | 3300041492 | Bacteria | 768 |
| 419 | Ga0451851_0359195 | 3300041507 | Unclassified | 711 |
| 420 | Ga0451577_0022868 | 3300042876 | Bacteria | 5706 |
| 421 | Ga0451577_0454120 | 3300042876 | Bacteria | 1164 |
| 422 | Ga0451577_0519599 | 3300042876 | Bacteria | 1081 |
| 423 | Ga0451577_0528200 | 3300042876 | Bacteria | 1071 |
| 424 | Ga0451577_1006692 | 3300042876 | Bacteria | 748 |
| 425 | Ga0451577_1935628 | 3300042876 | Bacteria | 516 |
| 426 | Ga0453684_0000382 | 3300044712 | Bacteria | 181519 |
| 427 | Ga0453684_0042720 | 3300044712 | Bacteria | 6107 |
| 428 | Ga0453684_0181132 | 3300044712 | Bacteria | 2473 |
| 429 | Ga0453684_0183568 | 3300044712 | Bacteria | 2454 |
| 430 | Ga0453684_0508984 | 3300044712 | Bacteria | 1332 |
| 431 | Ga0453684_0539021 | 3300044712 | Bacteria | 1287 |
| 432 | Ga0453684_1082216 | 3300044712 | Bacteria | 848 |
| 433 | Ga0453684_1483298 | 3300044712 | Bacteria | 700 |
| 434 | Ga0453684_1513850 | 3300044712 | Bacteria | 692 |
| 435 | Ga0451576_0055495 | 3300045051 | Bacteria | 4145 |
| 436 | Ga0451576_0128791 | 3300045051 | Bacteria | 2638 |
| 437 | Ga0451576_0152496 | 3300045051 | Bacteria | 2410 |
| 438 | Ga0451576_0242441 | 3300045051 | Bacteria | 1883 |
| 439 | Ga0451576_0267301 | 3300045051 | Bacteria | 1788 |
| 440 | Ga0451576_0271525 | 3300045051 | Bacteria | 1773 |
| 441 | Ga0451576_0292562 | 3300045051 | Bacteria | 1703 |
| 442 | Ga0451576_0397458 | 3300045051 | Bacteria | 1445 |
| 443 | Ga0451576_0414709 | 3300045051 | Bacteria | 1413 |
| 444 | Ga0451576_0460641 | 3300045051 | Bacteria | 1335 |
| 445 | Ga0451576_1076366 | 3300045051 | Bacteria | 842 |
| 446 | Ga0451576_1123499 | 3300045051 | Bacteria | 822 |
| 447 | Ga0451576_1145526 | 3300045051 | Bacteria | 813 |
| 448 | Ga0451576_1178293 | 3300045051 | Bacteria | 800 |
| 449 | Ga0451576_1288547 | 3300045051 | Bacteria | 762 |
| 450 | Ga0451576_1394800 | 3300045051 | Bacteria | 729 |
| 451 | Ga0451576_1418583 | 3300045051 | Bacteria | 722 |
| 452 | Ga0495592_0257417 | 3300046454 | Bacteria | 1151 |
| 453 | Ga0495592_0941057 | 3300046454 | Bacteria | 506 |
| 454 | Ga0495629_0057947 | 3300046459 | Bacteria | 2708 |
| 455 | Ga0495629_0116292 | 3300046459 | Bacteria | 1864 |
| 456 | Ga0495641_0421790 | 3300046461 | Bacteria | 606 |
| 457 | Ga0495651_0217288 | 3300046462 | Bacteria | 1326 |
| 458 | Ga0495651_0564197 | 3300046462 | Bacteria | 722 |
| 459 | Ga0495653_0578664 | 3300046463 | Bacteria | 692 |
| 460 | Ga0495653_0980169 | 3300046463 | Bacteria | 501 |
| 461 | Ga0495582_0014639 | 3300046473 | Bacteria | 4309 |
| 462 | Ga0495639_0050410 | 3300046475 | Bacteria | 1891 |
| 463 | Ga0495662_0206451 | 3300046476 | Bacteria | 968 |
| 464 | Ga0495664_0722600 | 3300046477 | Unclassified | 588 |
| 465 | Ga0495608_0494945 | 3300046511 | Bacteria | 741 |
| 466 | Ga0495618_0007045 | 3300046514 | Bacteria | 6811 |
| 467 | Ga0495618_0503619 | 3300046514 | Bacteria | 730 |
| 468 | Ga0495618_0532837 | 3300046514 | Bacteria | 705 |
| 469 | Ga0495628_0221748 | 3300046516 | Bacteria | 1420 |
| 470 | Ga0495628_0280391 | 3300046516 | Bacteria | 1238 |
| 471 | Ga0495630_0000191 | 3300046517 | Bacteria | 47951 |
| 472 | Ga0495630_0048171 | 3300046517 | Bacteria | 3189 |
| 473 | Ga0495630_0163882 | 3300046517 | Bacteria | 1692 |
| 474 | Ga0495630_0398941 | 3300046517 | Bacteria | 1054 |
| 475 | Ga0495630_0565100 | 3300046517 | Bacteria | 872 |
| 476 | Ga0495630_0753295 | 3300046517 | Bacteria | 744 |
| 477 | Ga0495630_0875101 | 3300046517 | Unclassified | 685 |
| 478 | Ga0495666_0038069 | 3300046526 | Bacteria | 2340 |
| 479 | Ga0495666_0089250 | 3300046526 | Bacteria | 1455 |
| 480 | Ga0495666_0456908 | 3300046526 | Bacteria | 572 |
| 481 | Ga0495666_0474489 | 3300046526 | Unclassified | 560 |
| 482 | Ga0495652_0104627 | 3300046529 | Bacteria | 2289 |
| 483 | Ga0495652_0416786 | 3300046529 | Bacteria | 947 |
| 484 | Ga0495652_0607032 | 3300046529 | Bacteria | 746 |
| 485 | Ga0495665_0371006 | 3300046531 | Bacteria | 728 |
| 486 | Ga0495640_0039591 | 3300046533 | Bacteria | 3306 |
| 487 | Ga0495640_0400436 | 3300046533 | Bacteria | 843 |
| 488 | Ga0495640_0656898 | 3300046533 | Bacteria | 631 |
| 489 | Ga0495586_0000113 | 3300046535 | Bacteria | 48115 |
| 490 | Ga0495586_0000762 | 3300046535 | Bacteria | 18510 |
| 491 | Ga0495586_0132552 | 3300046535 | Bacteria | 1395 |
| 492 | Ga0495586_0359376 | 3300046535 | Bacteria | 837 |
| 493 | Ga0495586_0429961 | 3300046535 | Bacteria | 761 |
| 494 | Ga0495586_0505149 | 3300046535 | Bacteria | 698 |
| 495 | Ga0495586_0567179 | 3300046535 | Bacteria | 656 |
| 496 | Ga0495586_0603991 | 3300046535 | Bacteria | 634 |
| 497 | Ga0495586_0719579 | 3300046535 | Bacteria | 576 |
| 498 | Ga0495587_0094429 | 3300046536 | Bacteria | 1727 |
| 499 | Ga0495587_0329809 | 3300046536 | Bacteria | 852 |
| 500 | Ga0495587_0720489 | 3300046536 | Bacteria | 546 |
| 501 | Ga0495587_0822743 | 3300046536 | Bacteria | 507 |
| 502 | Ga0495598_0456914 | 3300046537 | Unclassified | 506 |
| 503 | Ga0495645_0346487 | 3300046543 | Bacteria | 958 |
| 504 | Ga0495645_0792406 | 3300046543 | Bacteria | 569 |
| 505 | Ga0495645_0854282 | 3300046543 | Bacteria | 543 |
| 506 | Ga0495622_0071719 | 3300046557 | Bacteria | 1598 |
| 507 | Ga0495667_0188726 | 3300046559 | Bacteria | 1321 |
| 508 | Ga0495667_0643235 | 3300046559 | Bacteria | 659 |
| 509 | Ga0495634_0003404 | 3300046642 | Bacteria | 12775 |
| 510 | Ga0495634_0035539 | 3300046642 | Bacteria | 3411 |
| 511 | Ga0495634_0325725 | 3300046642 | Bacteria | 924 |
| 512 | Ga0495635_0137607 | 3300046663 | Bacteria | 1664 |
| 513 | Ga0495635_0746684 | 3300046663 | Bacteria | 633 |
| 514 | Ga0495635_0751319 | 3300046663 | Bacteria | 630 |
| 515 | Ga0495635_0758668 | 3300046663 | Bacteria | 627 |
| 516 | Ga0495588_0260492 | 3300046674 | Archaea | 914 |
| 517 | Ga0495599_0176526 | 3300046678 | Bacteria | 1317 |
| 518 | Ga0495647_0007529 | 3300046681 | Bacteria | 3654 |
| 519 | Ga0495647_0416399 | 3300046681 | Unclassified | 619 |
| 520 | Ga0495658_0050999 | 3300046683 | Bacteria | 2343 |
| 521 | Ga0495658_1106817 | 3300046683 | Bacteria | 505 |
| 522 | Ga0495613_0015524 | 3300046689 | Bacteria | 5663 |
| 523 | Ga0495613_0046614 | 3300046689 | Bacteria | 3205 |
| 524 | Ga0495613_0073050 | 3300046689 | Bacteria | 2500 |
| 525 | Ga0495613_0144254 | 3300046689 | Bacteria | 1700 |
| 526 | Ga0495613_0190604 | 3300046689 | Bacteria | 1449 |
| 527 | Ga0495624_0058784 | 3300046690 | Bacteria | 2414 |
| 528 | Ga0495600_0294514 | 3300046809 | Bacteria | 1025 |
| 529 | Ga0495600_0458257 | 3300046809 | Unclassified | 788 |
| 530 | Ga0495600_0632823 | 3300046809 | Bacteria | 648 |
| 531 | Ga0495581_0300341 | 3300047315 | Bacteria | 938 |
| 532 | Ga0495581_0492685 | 3300047315 | Bacteria | 713 |
| 533 | Ga0495581_0769378 | 3300047315 | Bacteria | 553 |
| 534 | Ga0495604_0174104 | 3300047317 | Bacteria | 1511 |
| 535 | Ga0495604_0601547 | 3300047317 | Bacteria | 705 |
| 536 | Ga0495636_0621457 | 3300047318 | Bacteria | 529 |
| 537 | Ga0495674_0000804 | 3300047319 | Bacteria | 29853 |
| 538 | Ga0495674_0047043 | 3300047319 | Bacteria | 3827 |
| 539 | Ga0495674_0476349 | 3300047319 | Unclassified | 1001 |
| 540 | Ga0495676_0027244 | 3300047321 | Bacteria | 4903 |
| 541 | Ga0495680_0025241 | 3300047322 | Bacteria | 4921 |
| 542 | Ga0495680_0147541 | 3300047322 | Bacteria | 1717 |
| 543 | Ga0495675_0084151 | 3300047444 | Bacteria | 2002 |
| 544 | Ga0495675_0288194 | 3300047444 | Bacteria | 978 |
| 545 | Ga0495675_0402791 | 3300047444 | Bacteria | 797 |
| 546 | Ga0495684_0306500 | 3300047471 | Bacteria | 1139 |
| 547 | Ga0495684_0446400 | 3300047471 | Bacteria | 900 |
| 548 | Ga0495602_0656030 | 3300048088 | Bacteria | 716 |
| 549 | Ga0496107_0463069 | 3300048910 | Bacteria | 941 |
| 550 | Ga0496115_0047285 | 3300048918 | Bacteria | 3440 |
| 551 | Ga0496115_0863250 | 3300048918 | Bacteria | 700 |
| 552 | Ga0501031_0002393 | 3300049568 | Bacteria | 11921 |
| 553 | Ga0501031_0015398 | 3300049568 | Bacteria | 4966 |
| 554 | Ga0501032_0036615 | 3300049569 | Bacteria | 3349 |
| 555 | Ga0501032_0054217 | 3300049569 | Bacteria | 2699 |
| 556 | Ga0501033_0003744 | 3300049570 | Bacteria | 12364 |
| 557 | Ga0501033_0151947 | 3300049570 | Bacteria | 1670 |
| 558 | Ga0501033_0270137 | 3300049570 | Bacteria | 1202 |
| 559 | Ga0501037_0690164 | 3300049573 | Bacteria | 680 |
| 560 | Ga0501043_0097979 | 3300049579 | Bacteria | 2305 |
| 561 | Ga0501043_1304500 | 3300049579 | Bacteria | 507 |
| 562 | Ga0501046_0576848 | 3300049580 | Bacteria | 800 |
| 563 | Ga0501047_0357830 | 3300049581 | Bacteria | 1296 |
| 564 | Ga0501047_0443573 | 3300049581 | Bacteria | 1128 |
| 565 | Ga0501080_0023318 | 3300049742 | Bacteria | 5738 |
| 566 | Ga0501080_1006692 | 3300049742 | Bacteria | 723 |
| 567 | Ga0501083_0190839 | 3300049744 | Bacteria | 1337 |
| 568 | Ga0501035_0331669 | 3300049822 | Bacteria | 1276 |
| 569 | Ga0501035_0438925 | 3300049822 | Bacteria | 1081 |
| 570 | Ga0501044_0000125 | 3300049823 | Bacteria | 92969 |
| 571 | Ga0501044_0157216 | 3300049823 | Bacteria | 2252 |
| 572 | Ga0501044_0184778 | 3300049823 | Bacteria | 2050 |
| 573 | Ga0501044_0565036 | 3300049823 | Bacteria | 1033 |
| 574 | nmdc:mga06r32_35566_c1 | 3300050510 | Bacteria | 4699 |
| 575 | nmdc:mga08y16_164891_c1 | 3300050511 | Bacteria | 2302 |
| 576 | nmdc:mga08y16_622386_c1 | 3300050511 | Bacteria | 1086 |
| 577 | nmdc:mga0n895_311913_c1 | 3300050512 | Bacteria | 1594 |
| 578 | nmdc:mga0rr50_167380_c1 | 3300050513 | Bacteria | 1788 |
| 579 | nmdc:mga08x19_264764_c1 | 3300050514 | Bacteria | 1189 |
| 580 | Ga0495601_0118365 | 3300053077 | Bacteria | 1719 |
| 581 | Ga0500650_0007717 | 3300053098 | Bacteria | 4213 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005530 | Ga0070679_100143599 | Ga0070679_1001435994 | 95 |
| 2 | 3300013104 | Ga0157370_10051388 | Ga0157370_100513882 | 95 |
| 3 | 3300006881 | Ga0068865_101651208 | Ga0068865_1016512081 | 99 |
| 4 | 3300025926 | Ga0207659_11598040 | Ga0207659_115980402 | 99 |
| 5 | 3300006844 | Ga0075428_100003239 | Ga0075428_1000032396 | 100 |
| 6 | 3300009094 | Ga0111539_10004958 | Ga0111539_100049583 | 100 |
| 7 | 3300028800 | Ga0265338_10137665 | Ga0265338_101376652 | 100 |
| 8 | 3300031240 | Ga0265320_10182402 | Ga0265320_101824022 | 100 |
| 9 | 3300041458 | Ga0451798_0735027 | Ga0451798_0735027_151_456 | 100 |
| 10 | 3300044712 | Ga0453684_0000382 | Ga0453684_0000382_37191_37493 | 100 |
| 11 | 3300050511 | nmdc:mga08y16_164891_c1 | nmdc:mga08y16_164891_c1_351_659 | 100 |
| 12 | 3300000545 | CNXas_1002134 | CNXas_10021343 | 101 |
| 13 | 3300005295 | Ga0065707_10340233 | Ga0065707_103402331 | 101 |
| 14 | 3300005327 | Ga0070658_10802087 | Ga0070658_108020872 | 101 |
| 15 | 3300005327 | Ga0070658_10933391 | Ga0070658_109333911 | 101 |
| 16 | 3300005329 | Ga0070683_100240949 | Ga0070683_1002409492 | 101 |
| 17 | 3300005330 | Ga0070690_100340087 | Ga0070690_1003400872 | 101 |
| 18 | 3300005330 | Ga0070690_100784226 | Ga0070690_1007842261 | 101 |
| 19 | 3300005331 | Ga0070670_100787039 | Ga0070670_1007870392 | 101 |
| 20 | 3300005333 | Ga0070677_10212551 | Ga0070677_102125512 | 101 |
| 21 | 3300005333 | Ga0070677_10596111 | Ga0070677_105961112 | 101 |
| 22 | 3300005334 | Ga0068869_102072277 | Ga0068869_1020722771 | 101 |
| 23 | 3300005335 | Ga0070666_10011337 | Ga0070666_100113373 | 101 |
| 24 | 3300005336 | Ga0070680_100784055 | Ga0070680_1007840552 | 101 |
| 25 | 3300005340 | Ga0070689_100020023 | Ga0070689_1000200235 | 101 |
| 26 | 3300005340 | Ga0070689_100044621 | Ga0070689_1000446215 | 101 |
| 27 | 3300005340 | Ga0070689_100245345 | Ga0070689_1002453452 | 101 |
| 28 | 3300005340 | Ga0070689_100382224 | Ga0070689_1003822242 | 101 |
| 29 | 3300005340 | Ga0070689_100419399 | Ga0070689_1004193992 | 101 |
| 30 | 3300005340 | Ga0070689_100867040 | Ga0070689_1008670402 | 101 |
| 31 | 3300005340 | Ga0070689_101066437 | Ga0070689_1010664372 | 101 |
| 32 | 3300005340 | Ga0070689_102047811 | Ga0070689_1020478111 | 101 |
| 33 | 3300005341 | Ga0070691_10043530 | Ga0070691_100435302 | 101 |
| 34 | 3300005341 | Ga0070691_10343443 | Ga0070691_103434432 | 101 |
| 35 | 3300005341 | Ga0070691_10492401 | Ga0070691_104924012 | 101 |
| 36 | 3300005343 | Ga0070687_100406706 | Ga0070687_1004067061 | 101 |
| 37 | 3300005343 | Ga0070687_100916662 | Ga0070687_1009166622 | 101 |
| 38 | 3300005356 | Ga0070674_101741120 | Ga0070674_1017411201 | 101 |
| 39 | 3300005365 | Ga0070688_100176123 | Ga0070688_1001761232 | 101 |
| 40 | 3300005365 | Ga0070688_100244884 | Ga0070688_1002448841 | 101 |
| 41 | 3300005365 | Ga0070688_101073858 | Ga0070688_1010738581 | 101 |
| 42 | 3300005365 | Ga0070688_101183979 | Ga0070688_1011839791 | 101 |
| 43 | 3300005365 | Ga0070688_101251180 | Ga0070688_1012511801 | 101 |
| 44 | 3300005366 | Ga0070659_101522694 | Ga0070659_1015226941 | 101 |
| 45 | 3300005434 | Ga0070709_10656682 | Ga0070709_106566822 | 101 |
| 46 | 3300005435 | Ga0070714_100300146 | Ga0070714_1003001462 | 101 |
| 47 | 3300005436 | Ga0070713_100489960 | Ga0070713_1004899602 | 101 |
| 48 | 3300005436 | Ga0070713_100914350 | Ga0070713_1009143501 | 101 |
| 49 | 3300005437 | Ga0070710_10889577 | Ga0070710_108895771 | 101 |
| 50 | 3300005439 | Ga0070711_100317758 | Ga0070711_1003177582 | 101 |
| 51 | 3300005439 | Ga0070711_101075046 | Ga0070711_1010750461 | 101 |
| 52 | 3300005439 | Ga0070711_101946635 | Ga0070711_1019466352 | 101 |
| 53 | 3300005440 | Ga0070705_100044317 | Ga0070705_1000443173 | 101 |
| 54 | 3300005440 | Ga0070705_100072025 | Ga0070705_1000720252 | 101 |
| 55 | 3300005440 | Ga0070705_100165050 | Ga0070705_1001650503 | 101 |
| 56 | 3300005441 | Ga0070700_100217341 | Ga0070700_1002173411 | 101 |
| 57 | 3300005441 | Ga0070700_100541924 | Ga0070700_1005419242 | 101 |
| 58 | 3300005444 | Ga0070694_100363534 | Ga0070694_1003635341 | 101 |
| 59 | 3300005445 | Ga0070708_101803050 | Ga0070708_1018030501 | 101 |
| 60 | 3300005445 | Ga0070708_101987771 | Ga0070708_1019877711 | 101 |
| 61 | 3300005456 | Ga0070678_100984803 | Ga0070678_1009848031 | 101 |
| 62 | 3300005458 | Ga0070681_11638911 | Ga0070681_116389112 | 101 |
| 63 | 3300005459 | Ga0068867_100658930 | Ga0068867_1006589302 | 101 |
| 64 | 3300005459 | Ga0068867_101992778 | Ga0068867_1019927782 | 101 |
| 65 | 3300005466 | Ga0070685_10726668 | Ga0070685_107266682 | 101 |
| 66 | 3300005466 | Ga0070685_10927646 | Ga0070685_109276461 | 101 |
| 67 | 3300005466 | Ga0070685_10970877 | Ga0070685_109708772 | 101 |
| 68 | 3300005466 | Ga0070685_11064887 | Ga0070685_110648872 | 101 |
| 69 | 3300005468 | Ga0070707_101517758 | Ga0070707_1015177581 | 101 |
| 70 | 3300005471 | Ga0070698_101362798 | Ga0070698_1013627981 | 101 |
| 71 | 3300005530 | Ga0070679_100122690 | Ga0070679_1001226902 | 101 |
| 72 | 3300005530 | Ga0070679_100194328 | Ga0070679_1001943282 | 101 |
| 73 | 3300005535 | Ga0070684_100442919 | Ga0070684_1004429193 | 101 |
| 74 | 3300005535 | Ga0070684_100583023 | Ga0070684_1005830232 | 101 |
| 75 | 3300005535 | Ga0070684_102092582 | Ga0070684_1020925822 | 101 |
| 76 | 3300005544 | Ga0070686_100138195 | Ga0070686_1001381953 | 101 |
| 77 | 3300005544 | Ga0070686_100162157 | Ga0070686_1001621572 | 101 |
| 78 | 3300005544 | Ga0070686_100680752 | Ga0070686_1006807521 | 101 |
| 79 | 3300005547 | Ga0070693_101065905 | Ga0070693_1010659052 | 101 |
| 80 | 3300005549 | Ga0070704_100297165 | Ga0070704_1002971652 | 101 |
| 81 | 3300005563 | Ga0068855_100087596 | Ga0068855_1000875962 | 101 |
| 82 | 3300005563 | Ga0068855_100134319 | Ga0068855_1001343192 | 101 |
| 83 | 3300005563 | Ga0068855_100233000 | Ga0068855_1002330002 | 101 |
| 84 | 3300005563 | Ga0068855_102276872 | Ga0068855_1022768722 | 101 |
| 85 | 3300005577 | Ga0068857_100479935 | Ga0068857_1004799352 | 101 |
| 86 | 3300005577 | Ga0068857_101058347 | Ga0068857_1010583472 | 101 |
| 87 | 3300005614 | Ga0068856_100001472 | Ga0068856_1000014727 | 101 |
| 88 | 3300005614 | Ga0068856_100156059 | Ga0068856_1001560592 | 101 |
| 89 | 3300005614 | Ga0068856_100188235 | Ga0068856_1001882353 | 101 |
| 90 | 3300005614 | Ga0068856_100195917 | Ga0068856_1001959171 | 101 |
| 91 | 3300005614 | Ga0068856_100273763 | Ga0068856_1002737633 | 101 |
| 92 | 3300005614 | Ga0068856_102064366 | Ga0068856_1020643662 | 101 |
| 93 | 3300005615 | Ga0070702_101305404 | Ga0070702_1013054041 | 101 |
| 94 | 3300005617 | Ga0068859_100004968 | Ga0068859_1000049686 | 101 |
| 95 | 3300005617 | Ga0068859_100134529 | Ga0068859_1001345292 | 101 |
| 96 | 3300005617 | Ga0068859_100265873 | Ga0068859_1002658733 | 101 |
| 97 | 3300005617 | Ga0068859_102231001 | Ga0068859_1022310012 | 101 |
| 98 | 3300005617 | Ga0068859_102832364 | Ga0068859_1028323641 | 101 |
| 99 | 3300005618 | Ga0068864_100026221 | Ga0068864_1000262214 | 101 |
| 100 | 3300005618 | Ga0068864_102222992 | Ga0068864_1022229922 | 101 |
| 101 | 3300005719 | Ga0068861_101431017 | Ga0068861_1014310172 | 101 |
| 102 | 3300005841 | Ga0068863_100024694 | Ga0068863_1000246945 | 101 |
| 103 | 3300005841 | Ga0068863_100124594 | Ga0068863_1001245941 | 101 |
| 104 | 3300005841 | Ga0068863_100444383 | Ga0068863_1004443831 | 101 |
| 105 | 3300005841 | Ga0068863_100692705 | Ga0068863_1006927052 | 101 |
| 106 | 3300005841 | Ga0068863_102355954 | Ga0068863_1023559542 | 101 |
| 107 | 3300005841 | Ga0068863_102642182 | Ga0068863_1026421821 | 101 |
| 108 | 3300005937 | Ga0081455_10365903 | Ga0081455_103659031 | 101 |
| 109 | 3300006028 | Ga0070717_10566718 | Ga0070717_105667182 | 101 |
| 110 | 3300006173 | Ga0070716_101362899 | Ga0070716_1013628992 | 101 |
| 111 | 3300006175 | Ga0070712_101447006 | Ga0070712_1014470062 | 101 |
| 112 | 3300006237 | Ga0097621_100327109 | Ga0097621_1003271092 | 101 |
| 113 | 3300006358 | Ga0068871_101756438 | Ga0068871_1017564382 | 101 |
| 114 | 3300006847 | Ga0075431_100160575 | Ga0075431_1001605752 | 101 |
| 115 | 3300006871 | Ga0075434_100215256 | Ga0075434_1002152563 | 101 |
| 116 | 3300006871 | Ga0075434_101555871 | Ga0075434_1015558712 | 101 |
| 117 | 3300006881 | Ga0068865_101169670 | Ga0068865_1011696702 | 101 |
| 118 | 3300006931 | Ga0097620_100004968 | Ga0097620_1000049686 | 101 |
| 119 | 3300006931 | Ga0097620_100134526 | Ga0097620_1001345262 | 101 |
| 120 | 3300006931 | Ga0097620_100265877 | Ga0097620_1002658773 | 101 |
| 121 | 3300006931 | Ga0097620_102230650 | Ga0097620_1022306501 | 101 |
| 122 | 3300006931 | Ga0097620_102830959 | Ga0097620_1028309591 | 101 |
| 123 | 3300007076 | Ga0075435_100189564 | Ga0075435_1001895644 | 101 |
| 124 | 3300007076 | Ga0075435_100387961 | Ga0075435_1003879612 | 101 |
| 125 | 3300007076 | Ga0075435_101122376 | Ga0075435_1011223761 | 101 |
| 126 | 3300007265 | Ga0099794_10628155 | Ga0099794_106281552 | 101 |
| 127 | 3300007788 | Ga0099795_10438343 | Ga0099795_104383432 | 101 |
| 128 | 3300009093 | Ga0105240_10002292 | Ga0105240_1000229218 | 101 |
| 129 | 3300009093 | Ga0105240_10075008 | Ga0105240_100750086 | 101 |
| 130 | 3300009093 | Ga0105240_10275551 | Ga0105240_102755513 | 101 |
| 131 | 3300009093 | Ga0105240_10327190 | Ga0105240_103271902 | 101 |
| 132 | 3300009093 | Ga0105240_10355920 | Ga0105240_103559202 | 101 |
| 133 | 3300009093 | Ga0105240_10549536 | Ga0105240_105495362 | 101 |
| 134 | 3300009094 | Ga0111539_10553070 | Ga0111539_105530702 | 101 |
| 135 | 3300009094 | Ga0111539_10851994 | Ga0111539_108519941 | 101 |
| 136 | 3300009098 | Ga0105245_10384377 | Ga0105245_103843773 | 101 |
| 137 | 3300009098 | Ga0105245_11112250 | Ga0105245_111122502 | 101 |
| 138 | 3300009098 | Ga0105245_12417309 | Ga0105245_124173092 | 101 |
| 139 | 3300009147 | Ga0114129_11393681 | Ga0114129_113936812 | 101 |
| 140 | 3300009147 | Ga0114129_13381760 | Ga0114129_133817601 | 101 |
| 141 | 3300009174 | Ga0105241_11173988 | Ga0105241_111739881 | 101 |
| 142 | 3300009176 | Ga0105242_10365668 | Ga0105242_103656682 | 101 |
| 143 | 3300009176 | Ga0105242_10955328 | Ga0105242_109553282 | 101 |
| 144 | 3300009176 | Ga0105242_11608342 | Ga0105242_116083422 | 101 |
| 145 | 3300009177 | Ga0105248_11013986 | Ga0105248_110139862 | 101 |
| 146 | 3300009177 | Ga0105248_11439820 | Ga0105248_114398202 | 101 |
| 147 | 3300009177 | Ga0105248_11506857 | Ga0105248_115068572 | 101 |
| 148 | 3300009545 | Ga0105237_10519599 | Ga0105237_105195992 | 101 |
| 149 | 3300009551 | Ga0105238_10019653 | Ga0105238_100196533 | 101 |
| 150 | 3300009551 | Ga0105238_10024440 | Ga0105238_100244402 | 101 |
| 151 | 3300009551 | Ga0105238_10110124 | Ga0105238_101101243 | 101 |
| 152 | 3300009551 | Ga0105238_10378912 | Ga0105238_103789121 | 101 |
| 153 | 3300009553 | Ga0105249_11325990 | Ga0105249_113259902 | 101 |
| 154 | 3300009553 | Ga0105249_11757359 | Ga0105249_117573592 | 101 |
| 155 | 3300013105 | Ga0157369_12547985 | Ga0157369_125479852 | 101 |
| 156 | 3300013296 | Ga0157374_10264923 | Ga0157374_102649232 | 101 |
| 157 | 3300013296 | Ga0157374_10343348 | Ga0157374_103433482 | 101 |
| 158 | 3300013297 | Ga0157378_11527480 | Ga0157378_115274802 | 101 |
| 159 | 3300013297 | Ga0157378_12856588 | Ga0157378_128565882 | 101 |
| 160 | 3300013306 | Ga0163162_11284802 | Ga0163162_112848021 | 101 |
| 161 | 3300013306 | Ga0163162_11792829 | Ga0163162_117928291 | 101 |
| 162 | 3300013307 | Ga0157372_10547801 | Ga0157372_105478012 | 101 |
| 163 | 3300013307 | Ga0157372_10621504 | Ga0157372_106215042 | 101 |
| 164 | 3300013307 | Ga0157372_10770192 | Ga0157372_107701922 | 101 |
| 165 | 3300013308 | Ga0157375_10000086 | Ga0157375_1000008670 | 101 |
| 166 | 3300013308 | Ga0157375_10854998 | Ga0157375_108549982 | 101 |
| 167 | 3300013308 | Ga0157375_12222821 | Ga0157375_122228211 | 101 |
| 168 | 3300014325 | Ga0163163_10019087 | Ga0163163_100190876 | 101 |
| 169 | 3300014325 | Ga0163163_10437443 | Ga0163163_104374432 | 101 |
| 170 | 3300014326 | Ga0157380_11060780 | Ga0157380_110607802 | 101 |
| 171 | 3300014968 | Ga0157379_10383658 | Ga0157379_103836582 | 101 |
| 172 | 3300014968 | Ga0157379_11150987 | Ga0157379_111509872 | 101 |
| 173 | 3300025893 | Ga0207682_10189019 | Ga0207682_101890192 | 101 |
| 174 | 3300025898 | Ga0207692_10666290 | Ga0207692_106662901 | 101 |
| 175 | 3300025903 | Ga0207680_10068302 | Ga0207680_100683024 | 101 |
| 176 | 3300025906 | Ga0207699_10583542 | Ga0207699_105835422 | 101 |
| 177 | 3300025909 | Ga0207705_10351738 | Ga0207705_103517382 | 101 |
| 178 | 3300025909 | Ga0207705_10662747 | Ga0207705_106627472 | 101 |
| 179 | 3300025913 | Ga0207695_10025957 | Ga0207695_100259572 | 101 |
| 180 | 3300025913 | Ga0207695_10028567 | Ga0207695_100285674 | 101 |
| 181 | 3300025913 | Ga0207695_10253737 | Ga0207695_102537373 | 101 |
| 182 | 3300025913 | Ga0207695_10255476 | Ga0207695_102554762 | 101 |
| 183 | 3300025913 | Ga0207695_10371505 | Ga0207695_103715051 | 101 |
| 184 | 3300025913 | Ga0207695_10379811 | Ga0207695_103798113 | 101 |
| 185 | 3300025916 | Ga0207663_10001010 | Ga0207663_100010103 | 101 |
| 186 | 3300025916 | Ga0207663_10316654 | Ga0207663_103166542 | 101 |
| 187 | 3300025916 | Ga0207663_10837264 | Ga0207663_108372642 | 101 |
| 188 | 3300025918 | Ga0207662_10194547 | Ga0207662_101945472 | 101 |
| 189 | 3300025919 | Ga0207657_11077041 | Ga0207657_110770412 | 101 |
| 190 | 3300025921 | Ga0207652_10245481 | Ga0207652_102454812 | 101 |
| 191 | 3300025921 | Ga0207652_10312673 | Ga0207652_103126733 | 101 |
| 192 | 3300025924 | Ga0207694_10028210 | Ga0207694_100282103 | 101 |
| 193 | 3300025924 | Ga0207694_10067143 | Ga0207694_100671433 | 101 |
| 194 | 3300025924 | Ga0207694_10071433 | Ga0207694_100714333 | 101 |
| 195 | 3300025925 | Ga0207650_10581199 | Ga0207650_105811992 | 101 |
| 196 | 3300025927 | Ga0207687_10793602 | Ga0207687_107936022 | 101 |
| 197 | 3300025928 | Ga0207700_11833712 | Ga0207700_118337122 | 101 |
| 198 | 3300025934 | Ga0207686_10638785 | Ga0207686_106387852 | 101 |
| 199 | 3300025936 | Ga0207670_10015941 | Ga0207670_100159412 | 101 |
| 200 | 3300025936 | Ga0207670_10114746 | Ga0207670_101147462 | 101 |
| 201 | 3300025936 | Ga0207670_10150449 | Ga0207670_101504493 | 101 |
| 202 | 3300025936 | Ga0207670_10178956 | Ga0207670_101789563 | 101 |
| 203 | 3300025936 | Ga0207670_10209307 | Ga0207670_102093071 | 101 |
| 204 | 3300025936 | Ga0207670_10303432 | Ga0207670_103034322 | 101 |
| 205 | 3300025936 | Ga0207670_10543860 | Ga0207670_105438602 | 101 |
| 206 | 3300025936 | Ga0207670_10598088 | Ga0207670_105980882 | 101 |
| 207 | 3300025936 | Ga0207670_10926646 | Ga0207670_109266462 | 101 |
| 208 | 3300025936 | Ga0207670_11093391 | Ga0207670_110933912 | 101 |
| 209 | 3300025938 | Ga0207704_10867994 | Ga0207704_108679942 | 101 |
| 210 | 3300025941 | Ga0207711_10785402 | Ga0207711_107854022 | 101 |
| 211 | 3300025942 | Ga0207689_11699845 | Ga0207689_116998451 | 101 |
| 212 | 3300025949 | Ga0207667_10051360 | Ga0207667_100513605 | 101 |
| 213 | 3300025949 | Ga0207667_10258381 | Ga0207667_102583813 | 101 |
| 214 | 3300025949 | Ga0207667_10483029 | Ga0207667_104830292 | 101 |
| 215 | 3300025949 | Ga0207667_11616996 | Ga0207667_116169962 | 101 |
| 216 | 3300025960 | Ga0207651_11309888 | Ga0207651_113098882 | 101 |
| 217 | 3300025961 | Ga0207712_10593548 | Ga0207712_105935482 | 101 |
| 218 | 3300026041 | Ga0207639_10762182 | Ga0207639_107621822 | 101 |
| 219 | 3300026075 | Ga0207708_10999313 | Ga0207708_109993132 | 101 |
| 220 | 3300026078 | Ga0207702_10002049 | Ga0207702_1000204911 | 101 |
| 221 | 3300026078 | Ga0207702_10011792 | Ga0207702_100117923 | 101 |
| 222 | 3300026078 | Ga0207702_10173900 | Ga0207702_101739002 | 101 |
| 223 | 3300026078 | Ga0207702_11260282 | Ga0207702_112602821 | 101 |
| 224 | 3300026088 | Ga0207641_10018189 | Ga0207641_100181893 | 101 |
| 225 | 3300026088 | Ga0207641_11147895 | Ga0207641_111478952 | 101 |
| 226 | 3300026089 | Ga0207648_10200676 | Ga0207648_102006762 | 101 |
| 227 | 3300026095 | Ga0207676_10970556 | Ga0207676_109705562 | 101 |
| 228 | 3300026116 | Ga0207674_10300018 | Ga0207674_103000182 | 101 |
| 229 | 3300026116 | Ga0207674_10632239 | Ga0207674_106322391 | 101 |
| 230 | 3300026118 | Ga0207675_101302608 | Ga0207675_1013026081 | 101 |
| 231 | 3300026121 | Ga0207683_10493150 | Ga0207683_104931502 | 101 |
| 232 | 3300026121 | Ga0207683_11402734 | Ga0207683_114027342 | 101 |
| 233 | 3300027671 | Ga0209588_1263695 | Ga0209588_12636951 | 101 |
| 234 | 3300028380 | Ga0268265_11797707 | Ga0268265_117977072 | 101 |
| 235 | 3300028380 | Ga0268265_12039520 | Ga0268265_120395202 | 101 |
| 236 | 3300028381 | Ga0268264_11577944 | Ga0268264_115779441 | 101 |
| 237 | 3300028556 | Ga0265337_1000140 | Ga0265337_100014014 | 101 |
| 238 | 3300028556 | Ga0265337_1000920 | Ga0265337_10009205 | 101 |
| 239 | 3300028556 | Ga0265337_1004569 | Ga0265337_10045692 | 101 |
| 240 | 3300028556 | Ga0265337_1007544 | Ga0265337_10075443 | 101 |
| 241 | 3300028556 | Ga0265337_1009032 | Ga0265337_10090323 | 101 |
| 242 | 3300028556 | Ga0265337_1020782 | Ga0265337_10207822 | 101 |
| 243 | 3300028556 | Ga0265337_1055732 | Ga0265337_10557322 | 101 |
| 244 | 3300028556 | Ga0265337_1085897 | Ga0265337_10858972 | 101 |
| 245 | 3300028556 | Ga0265337_1105318 | Ga0265337_11053182 | 101 |
| 246 | 3300028558 | Ga0265326_10051322 | Ga0265326_100513222 | 101 |
| 247 | 3300028558 | Ga0265326_10099858 | Ga0265326_100998581 | 101 |
| 248 | 3300028558 | Ga0265326_10103142 | Ga0265326_101031422 | 101 |
| 249 | 3300028558 | Ga0265326_10124954 | Ga0265326_101249542 | 101 |
| 250 | 3300028558 | Ga0265326_10167869 | Ga0265326_101678691 | 101 |
| 251 | 3300028563 | Ga0265319_1000007 | Ga0265319_1000007103 | 101 |
| 252 | 3300028563 | Ga0265319_1003681 | Ga0265319_10036817 | 101 |
| 253 | 3300028563 | Ga0265319_1011822 | Ga0265319_10118222 | 101 |
| 254 | 3300028563 | Ga0265319_1167746 | Ga0265319_11677462 | 101 |
| 255 | 3300028563 | Ga0265319_1169444 | Ga0265319_11694441 | 101 |
| 256 | 3300028573 | Ga0265334_10021782 | Ga0265334_100217824 | 101 |
| 257 | 3300028573 | Ga0265334_10064430 | Ga0265334_100644302 | 101 |
| 258 | 3300028577 | Ga0265318_10035245 | Ga0265318_100352453 | 101 |
| 259 | 3300028577 | Ga0265318_10045073 | Ga0265318_100450732 | 101 |
| 260 | 3300028577 | Ga0265318_10315353 | Ga0265318_103153531 | 101 |
| 261 | 3300028653 | Ga0265323_10000237 | Ga0265323_1000023721 | 101 |
| 262 | 3300028653 | Ga0265323_10026728 | Ga0265323_100267282 | 101 |
| 263 | 3300028653 | Ga0265323_10030725 | Ga0265323_100307252 | 101 |
| 264 | 3300028653 | Ga0265323_10077387 | Ga0265323_100773872 | 101 |
| 265 | 3300028654 | Ga0265322_10001686 | Ga0265322_100016866 | 101 |
| 266 | 3300028654 | Ga0265322_10044124 | Ga0265322_100441243 | 101 |
| 267 | 3300028654 | Ga0265322_10063228 | Ga0265322_100632282 | 101 |
| 268 | 3300028654 | Ga0265322_10101086 | Ga0265322_101010862 | 101 |
| 269 | 3300028666 | Ga0265336_10006142 | Ga0265336_100061423 | 101 |
| 270 | 3300028666 | Ga0265336_10016947 | Ga0265336_100169474 | 101 |
| 271 | 3300028666 | Ga0265336_10036849 | Ga0265336_100368493 | 101 |
| 272 | 3300028666 | Ga0265336_10073420 | Ga0265336_100734202 | 101 |
| 273 | 3300028666 | Ga0265336_10095956 | Ga0265336_100959562 | 101 |
| 274 | 3300028666 | Ga0265336_10213733 | Ga0265336_102137332 | 101 |
| 275 | 3300028800 | Ga0265338_10000431 | Ga0265338_1000043118 | 101 |
| 276 | 3300028800 | Ga0265338_10001555 | Ga0265338_1000155524 | 101 |
| 277 | 3300028800 | Ga0265338_10008592 | Ga0265338_100085928 | 101 |
| 278 | 3300028800 | Ga0265338_10009353 | Ga0265338_1000935312 | 101 |
| 279 | 3300028800 | Ga0265338_10010919 | Ga0265338_100109198 | 101 |
| 280 | 3300028800 | Ga0265338_10011481 | Ga0265338_100114813 | 101 |
| 281 | 3300028800 | Ga0265338_10013859 | Ga0265338_1001385910 | 101 |
| 282 | 3300028800 | Ga0265338_10014147 | Ga0265338_100141473 | 101 |
| 283 | 3300028800 | Ga0265338_10019255 | Ga0265338_100192554 | 101 |
| 284 | 3300028800 | Ga0265338_10021384 | Ga0265338_100213843 | 101 |
| 285 | 3300028800 | Ga0265338_10024132 | Ga0265338_100241323 | 101 |
| 286 | 3300028800 | Ga0265338_10027437 | Ga0265338_100274374 | 101 |
| 287 | 3300028800 | Ga0265338_10032402 | Ga0265338_100324021 | 101 |
| 288 | 3300028800 | Ga0265338_10045342 | Ga0265338_100453423 | 101 |
| 289 | 3300028800 | Ga0265338_10052571 | Ga0265338_100525713 | 101 |
| 290 | 3300028800 | Ga0265338_10076720 | Ga0265338_100767203 | 101 |
| 291 | 3300028800 | Ga0265338_10193904 | Ga0265338_101939042 | 101 |
| 292 | 3300028800 | Ga0265338_10233317 | Ga0265338_102333173 | 101 |
| 293 | 3300028800 | Ga0265338_10334064 | Ga0265338_103340642 | 101 |
| 294 | 3300028800 | Ga0265338_10387676 | Ga0265338_103876761 | 101 |
| 295 | 3300028800 | Ga0265338_10416422 | Ga0265338_104164222 | 101 |
| 296 | 3300028800 | Ga0265338_10437016 | Ga0265338_104370162 | 101 |
| 297 | 3300028800 | Ga0265338_10479050 | Ga0265338_104790501 | 101 |
| 298 | 3300028800 | Ga0265338_10711517 | Ga0265338_107115172 | 101 |
| 299 | 3300028800 | Ga0265338_10758404 | Ga0265338_107584042 | 101 |
| 300 | 3300028800 | Ga0265338_10782530 | Ga0265338_107825302 | 101 |
| 301 | 3300029957 | Ga0265324_10002329 | Ga0265324_100023295 | 101 |
| 302 | 3300029957 | Ga0265324_10015253 | Ga0265324_100152533 | 101 |
| 303 | 3300029957 | Ga0265324_10015285 | Ga0265324_100152852 | 101 |
| 304 | 3300029957 | Ga0265324_10019169 | Ga0265324_100191691 | 101 |
| 305 | 3300029957 | Ga0265324_10019506 | Ga0265324_100195063 | 101 |
| 306 | 3300029957 | Ga0265324_10034697 | Ga0265324_100346972 | 101 |
| 307 | 3300029957 | Ga0265324_10039188 | Ga0265324_100391883 | 101 |
| 308 | 3300029957 | Ga0265324_10067478 | Ga0265324_100674783 | 101 |
| 309 | 3300029957 | Ga0265324_10143451 | Ga0265324_101434512 | 101 |
| 310 | 3300029957 | Ga0265324_10170240 | Ga0265324_101702402 | 101 |
| 311 | 3300030521 | Ga0307511_10125600 | Ga0307511_101256003 | 101 |
| 312 | 3300031235 | Ga0265330_10030858 | Ga0265330_100308582 | 101 |
| 313 | 3300031238 | Ga0265332_10199062 | Ga0265332_101990622 | 101 |
| 314 | 3300031240 | Ga0265320_10000188 | Ga0265320_1000018819 | 101 |
| 315 | 3300031240 | Ga0265320_10003925 | Ga0265320_100039255 | 101 |
| 316 | 3300031240 | Ga0265320_10004415 | Ga0265320_100044153 | 101 |
| 317 | 3300031240 | Ga0265320_10011472 | Ga0265320_100114724 | 101 |
| 318 | 3300031240 | Ga0265320_10048479 | Ga0265320_100484793 | 101 |
| 319 | 3300031240 | Ga0265320_10094740 | Ga0265320_100947403 | 101 |
| 320 | 3300031240 | Ga0265320_10256439 | Ga0265320_102564392 | 101 |
| 321 | 3300031240 | Ga0265320_10449597 | Ga0265320_104495972 | 101 |
| 322 | 3300031241 | Ga0265325_10023559 | Ga0265325_100235593 | 101 |
| 323 | 3300031241 | Ga0265325_10050609 | Ga0265325_100506092 | 101 |
| 324 | 3300031241 | Ga0265325_10312137 | Ga0265325_103121372 | 101 |
| 325 | 3300031242 | Ga0265329_10109577 | Ga0265329_101095772 | 101 |
| 326 | 3300031247 | Ga0265340_10058985 | Ga0265340_100589854 | 101 |
| 327 | 3300031247 | Ga0265340_10069957 | Ga0265340_100699572 | 101 |
| 328 | 3300031247 | Ga0265340_10433150 | Ga0265340_104331502 | 101 |
| 329 | 3300031249 | Ga0265339_10017090 | Ga0265339_100170904 | 101 |
| 330 | 3300031249 | Ga0265339_10199786 | Ga0265339_101997862 | 101 |
| 331 | 3300031250 | Ga0265331_10077949 | Ga0265331_100779492 | 101 |
| 332 | 3300031250 | Ga0265331_10182628 | Ga0265331_101826282 | 101 |
| 333 | 3300031251 | Ga0265327_10000752 | Ga0265327_1000075223 | 101 |
| 334 | 3300031251 | Ga0265327_10008595 | Ga0265327_100085954 | 101 |
| 335 | 3300031251 | Ga0265327_10230600 | Ga0265327_102306001 | 101 |
| 336 | 3300031344 | Ga0265316_10006885 | Ga0265316_100068852 | 101 |
| 337 | 3300031344 | Ga0265316_10009696 | Ga0265316_100096965 | 101 |
| 338 | 3300031344 | Ga0265316_10010502 | Ga0265316_100105025 | 101 |
| 339 | 3300031344 | Ga0265316_10010930 | Ga0265316_100109302 | 101 |
| 340 | 3300031344 | Ga0265316_10066910 | Ga0265316_100669102 | 101 |
| 341 | 3300031344 | Ga0265316_10079893 | Ga0265316_100798932 | 101 |
| 342 | 3300031344 | Ga0265316_10147414 | Ga0265316_101474142 | 101 |
| 343 | 3300031344 | Ga0265316_10213115 | Ga0265316_102131152 | 101 |
| 344 | 3300031344 | Ga0265316_10268736 | Ga0265316_102687362 | 101 |
| 345 | 3300031595 | Ga0265313_10001008 | Ga0265313_1000100816 | 101 |
| 346 | 3300031595 | Ga0265313_10012570 | Ga0265313_100125703 | 101 |
| 347 | 3300031595 | Ga0265313_10131179 | Ga0265313_101311792 | 101 |
| 348 | 3300031711 | Ga0265314_10024198 | Ga0265314_100241983 | 101 |
| 349 | 3300031711 | Ga0265314_10043005 | Ga0265314_100430054 | 101 |
| 350 | 3300031711 | Ga0265314_10248883 | Ga0265314_102488833 | 101 |
| 351 | 3300031711 | Ga0265314_10618729 | Ga0265314_106187291 | 101 |
| 352 | 3300031711 | Ga0265314_10687799 | Ga0265314_106877991 | 101 |
| 353 | 3300031712 | Ga0265342_10055412 | Ga0265342_100554122 | 101 |
| 354 | 3300031712 | Ga0265342_10362426 | Ga0265342_103624262 | 101 |
| 355 | 3300031712 | Ga0265342_10432801 | Ga0265342_104328012 | 101 |
| 356 | 3300031712 | Ga0265342_10459597 | Ga0265342_104595971 | 101 |
| 357 | 3300031727 | Ga0316576_10670239 | Ga0316576_106702391 | 101 |
| 358 | 3300032137 | Ga0316585_10075010 | Ga0316585_100750102 | 101 |
| 359 | 3300034816 | Ga0373930_0000589 | Ga0373930_0000589_402_707 | 101 |
| 360 | 3300034817 | Ga0373948_0115770 | Ga0373948_0115770_147_452 | 101 |
| 361 | 3300034818 | Ga0373950_0009528 | Ga0373950_0009528_452_757 | 101 |
| 362 | 3300034819 | Ga0373958_0143320 | Ga0373958_0143320_114_419 | 101 |
| 363 | 3300035083 | Ga0373926_0298641 | Ga0373926_0298641_206_511 | 101 |
| 364 | 3300035084 | Ga0373928_0000124 | Ga0373928_0000124_13201_13506 | 101 |
| 365 | 3300035085 | Ga0373929_0002245 | Ga0373929_0002245_2565_2870 | 101 |
| 366 | 3300035086 | Ga0373934_0313006 | Ga0373934_0313006_253_558 | 101 |
| 367 | 3300035088 | Ga0373940_0002420 | Ga0373940_0002420_182_487 | 101 |
| 368 | 3300035089 | Ga0373944_0005149 | Ga0373944_0005149_1027_1332 | 101 |
| 369 | 3300035090 | Ga0373949_0002141 | Ga0373949_0002141_1657_1962 | 101 |
| 370 | 3300035090 | Ga0373949_0286782 | Ga0373949_0286782_58_363 | 101 |
| 371 | 3300035091 | Ga0373951_0004091 | Ga0373951_0004091_543_848 | 101 |
| 372 | 3300035091 | Ga0373951_0047262 | Ga0373951_0047262_589_897 | 101 |
| 373 | 3300035111 | Ga0373923_0250547 | Ga0373923_0250547_319_624 | 101 |
| 374 | 3300035112 | Ga0373932_0000001 | Ga0373932_0000001_1148127_1148432 | 101 |
| 375 | 3300035114 | Ga0373939_0169406 | Ga0373939_0169406_292_597 | 101 |
| 376 | 3300035116 | Ga0373945_0035902 | Ga0373945_0035902_453_758 | 101 |
| 377 | 3300035117 | Ga0373953_0228589 | Ga0373953_0228589_238_543 | 101 |
| 378 | 3300035118 | Ga0373954_0239919 | Ga0373954_0239919_155_460 | 101 |
| 379 | 3300035119 | Ga0373956_0005667 | Ga0373956_0005667_105_410 | 101 |
| 380 | 3300035120 | Ga0373957_0473886 | Ga0373957_0473886_92_397 | 101 |
| 381 | 3300035171 | Ga0373946_0075615 | Ga0373946_0075615_1086_1391 | 101 |
| 382 | 3300035171 | Ga0373946_0156698 | Ga0373946_0156698_394_699 | 101 |
| 383 | 3300035172 | Ga0373955_0744331 | Ga0373955_0744331_145_450 | 101 |
| 384 | 3300035207 | Ga0373942_0185163 | Ga0373942_0185163_258_563 | 101 |
| 385 | 3300035242 | Ga0373962_0000018 | Ga0373962_0000018_36336_36641 | 101 |
| 386 | 3300035398 | Ga0316574_0304294 | Ga0316574_0304294_182_487 | 101 |
| 387 | 3300035691 | Ga0373931_0000002 | Ga0373931_0000002_346966_347271 | 101 |
| 388 | 3300035692 | Ga0373935_0003342 | Ga0373935_0003342_6538_6843 | 101 |
| 389 | 3300035692 | Ga0373935_0104655 | Ga0373935_0104655_264_569 | 101 |
| 390 | 3300035695 | Ga0373927_0002183 | Ga0373927_0002183_2219_2524 | 101 |
| 391 | 3300035695 | Ga0373927_0032231 | Ga0373927_0032231_49_354 | 101 |
| 392 | 3300035695 | Ga0373927_0036781 | Ga0373927_0036781_769_1074 | 101 |
| 393 | 3300035695 | Ga0373927_0929953 | Ga0373927_0929953_155_460 | 101 |
| 394 | 3300035724 | Ga0373933_0200470 | Ga0373933_0200470_823_1128 | 101 |
| 395 | 3300035725 | Ga0373947_0121838 | Ga0373947_0121838_1228_1533 | 101 |
| 396 | 3300035725 | Ga0373947_0175980 | Ga0373947_0175980_794_1099 | 101 |
| 397 | 3300036401 | Ga0373937_0001956 | Ga0373937_0001956_14455_14760 | 101 |
| 398 | 3300036401 | Ga0373937_0176416 | Ga0373937_0176416_1545_1850 | 101 |
| 399 | 3300036401 | Ga0373937_0289399 | Ga0373937_0289399_1024_1329 | 101 |
| 400 | 3300036401 | Ga0373937_1897835 | Ga0373937_1897835_174_482 | 101 |
| 401 | 3300036647 | Ga0316582_0411437 | Ga0316582_0411437_168_473 | 101 |
| 402 | 3300036712 | Ga0316584_0391748 | Ga0316584_0391748_128_433 | 101 |
| 403 | 3300037068 | Ga0373925_0000272 | Ga0373925_0000272_12960_13265 | 101 |
| 404 | 3300037068 | Ga0373925_0000552 | Ga0373925_0000552_14605_14910 | 101 |
| 405 | 3300037068 | Ga0373925_0479213 | Ga0373925_0479213_82_387 | 101 |
| 406 | 3300037068 | Ga0373925_0705058 | Ga0373925_0705058_37_342 | 101 |
| 407 | 3300037068 | Ga0373925_1262262 | Ga0373925_1262262_158_463 | 101 |
| 408 | 3300041452 | Ga0451793_1237591 | Ga0451793_1237591_57_362 | 101 |
| 409 | 3300041452 | Ga0451793_1754102 | Ga0451793_1754102_637_945 | 101 |
| 410 | 3300041463 | Ga0451804_0855333 | Ga0451804_0855333_511_816 | 101 |
| 411 | 3300041486 | Ga0451807_1698768 | Ga0451807_1698768_136_441 | 101 |
| 412 | 3300041492 | Ga0451835_1202569 | Ga0451835_1202569_368_676 | 101 |
| 413 | 3300041507 | Ga0451851_0359195 | Ga0451851_0359195_274_582 | 101 |
| 414 | 3300042876 | Ga0451577_0022868 | Ga0451577_0022868_4994_5299 | 101 |
| 415 | 3300042876 | Ga0451577_0454120 | Ga0451577_0454120_160_465 | 101 |
| 416 | 3300042876 | Ga0451577_0519599 | Ga0451577_0519599_16_321 | 101 |
| 417 | 3300042876 | Ga0451577_0528200 | Ga0451577_0528200_645_950 | 101 |
| 418 | 3300042876 | Ga0451577_1006692 | Ga0451577_1006692_297_602 | 101 |
| 419 | 3300042876 | Ga0451577_1935628 | Ga0451577_1935628_57_362 | 101 |
| 420 | 3300044712 | Ga0453684_0042720 | Ga0453684_0042720_2927_3232 | 101 |
| 421 | 3300044712 | Ga0453684_0181132 | Ga0453684_0181132_797_1102 | 101 |
| 422 | 3300044712 | Ga0453684_0183568 | Ga0453684_0183568_400_705 | 101 |
| 423 | 3300044712 | Ga0453684_0508984 | Ga0453684_0508984_561_866 | 101 |
| 424 | 3300044712 | Ga0453684_0539021 | Ga0453684_0539021_738_1043 | 101 |
| 425 | 3300044712 | Ga0453684_1082216 | Ga0453684_1082216_374_679 | 101 |
| 426 | 3300044712 | Ga0453684_1483298 | Ga0453684_1483298_100_405 | 101 |
| 427 | 3300044712 | Ga0453684_1513850 | Ga0453684_1513850_229_537 | 101 |
| 428 | 3300045051 | Ga0451576_0055495 | Ga0451576_0055495_2314_2619 | 101 |
| 429 | 3300045051 | Ga0451576_0128791 | Ga0451576_0128791_2273_2578 | 101 |
| 430 | 3300045051 | Ga0451576_0152496 | Ga0451576_0152496_211_516 | 101 |
| 431 | 3300045051 | Ga0451576_0242441 | Ga0451576_0242441_517_822 | 101 |
| 432 | 3300045051 | Ga0451576_0267301 | Ga0451576_0267301_1378_1683 | 101 |
| 433 | 3300045051 | Ga0451576_0271525 | Ga0451576_0271525_1436_1741 | 101 |
| 434 | 3300045051 | Ga0451576_0292562 | Ga0451576_0292562_912_1217 | 101 |
| 435 | 3300045051 | Ga0451576_0397458 | Ga0451576_0397458_246_551 | 101 |
| 436 | 3300045051 | Ga0451576_0414709 | Ga0451576_0414709_1033_1338 | 101 |
| 437 | 3300045051 | Ga0451576_0460641 | Ga0451576_0460641_61_366 | 101 |
| 438 | 3300045051 | Ga0451576_1076366 | Ga0451576_1076366_368_673 | 101 |
| 439 | 3300045051 | Ga0451576_1123499 | Ga0451576_1123499_357_662 | 101 |
| 440 | 3300045051 | Ga0451576_1145526 | Ga0451576_1145526_204_509 | 101 |
| 441 | 3300045051 | Ga0451576_1178293 | Ga0451576_1178293_364_669 | 101 |
| 442 | 3300045051 | Ga0451576_1288547 | Ga0451576_1288547_103_408 | 101 |
| 443 | 3300045051 | Ga0451576_1394800 | Ga0451576_1394800_243_548 | 101 |
| 444 | 3300045051 | Ga0451576_1418583 | Ga0451576_1418583_54_359 | 101 |
| 445 | 3300046454 | Ga0495592_0257417 | Ga0495592_0257417_190_495 | 101 |
| 446 | 3300046454 | Ga0495592_0941057 | Ga0495592_0941057_172_477 | 101 |
| 447 | 3300046459 | Ga0495629_0057947 | Ga0495629_0057947_531_836 | 101 |
| 448 | 3300046459 | Ga0495629_0116292 | Ga0495629_0116292_1212_1517 | 101 |
| 449 | 3300046461 | Ga0495641_0421790 | Ga0495641_0421790_87_392 | 101 |
| 450 | 3300046462 | Ga0495651_0217288 | Ga0495651_0217288_754_1059 | 101 |
| 451 | 3300046462 | Ga0495651_0564197 | Ga0495651_0564197_137_442 | 101 |
| 452 | 3300046463 | Ga0495653_0578664 | Ga0495653_0578664_48_353 | 101 |
| 453 | 3300046463 | Ga0495653_0980169 | Ga0495653_0980169_73_378 | 101 |
| 454 | 3300046473 | Ga0495582_0014639 | Ga0495582_0014639_960_1265 | 101 |
| 455 | 3300046475 | Ga0495639_0050410 | Ga0495639_0050410_219_524 | 101 |
| 456 | 3300046476 | Ga0495662_0206451 | Ga0495662_0206451_358_663 | 101 |
| 457 | 3300046477 | Ga0495664_0722600 | Ga0495664_0722600_252_557 | 101 |
| 458 | 3300046511 | Ga0495608_0494945 | Ga0495608_0494945_184_489 | 101 |
| 459 | 3300046514 | Ga0495618_0007045 | Ga0495618_0007045_1807_2112 | 101 |
| 460 | 3300046514 | Ga0495618_0503619 | Ga0495618_0503619_233_538 | 101 |
| 461 | 3300046514 | Ga0495618_0532837 | Ga0495618_0532837_281_586 | 101 |
| 462 | 3300046516 | Ga0495628_0221748 | Ga0495628_0221748_341_646 | 101 |
| 463 | 3300046516 | Ga0495628_0280391 | Ga0495628_0280391_234_539 | 101 |
| 464 | 3300046517 | Ga0495630_0000191 | Ga0495630_0000191_35453_35758 | 101 |
| 465 | 3300046517 | Ga0495630_0048171 | Ga0495630_0048171_479_784 | 101 |
| 466 | 3300046517 | Ga0495630_0163882 | Ga0495630_0163882_1099_1407 | 101 |
| 467 | 3300046517 | Ga0495630_0398941 | Ga0495630_0398941_643_951 | 101 |
| 468 | 3300046517 | Ga0495630_0565100 | Ga0495630_0565100_509_814 | 101 |
| 469 | 3300046517 | Ga0495630_0875101 | Ga0495630_0875101_321_626 | 101 |
| 470 | 3300046526 | Ga0495666_0038069 | Ga0495666_0038069_1787_2092 | 101 |
| 471 | 3300046526 | Ga0495666_0089250 | Ga0495666_0089250_267_572 | 101 |
| 472 | 3300046526 | Ga0495666_0456908 | Ga0495666_0456908_27_332 | 101 |
| 473 | 3300046526 | Ga0495666_0474489 | Ga0495666_0474489_207_512 | 101 |
| 474 | 3300046529 | Ga0495652_0104627 | Ga0495652_0104627_990_1295 | 101 |
| 475 | 3300046529 | Ga0495652_0416786 | Ga0495652_0416786_617_922 | 101 |
| 476 | 3300046529 | Ga0495652_0607032 | Ga0495652_0607032_315_623 | 101 |
| 477 | 3300046531 | Ga0495665_0371006 | Ga0495665_0371006_45_350 | 101 |
| 478 | 3300046533 | Ga0495640_0039591 | Ga0495640_0039591_861_1166 | 101 |
| 479 | 3300046533 | Ga0495640_0400436 | Ga0495640_0400436_180_485 | 101 |
| 480 | 3300046533 | Ga0495640_0656898 | Ga0495640_0656898_286_591 | 101 |
| 481 | 3300046535 | Ga0495586_0000113 | Ga0495586_0000113_12693_12998 | 101 |
| 482 | 3300046535 | Ga0495586_0000762 | Ga0495586_0000762_5009_5314 | 101 |
| 483 | 3300046535 | Ga0495586_0132552 | Ga0495586_0132552_76_381 | 101 |
| 484 | 3300046535 | Ga0495586_0429961 | Ga0495586_0429961_130_438 | 101 |
| 485 | 3300046535 | Ga0495586_0505149 | Ga0495586_0505149_343_648 | 101 |
| 486 | 3300046535 | Ga0495586_0603991 | Ga0495586_0603991_177_482 | 101 |
| 487 | 3300046535 | Ga0495586_0719579 | Ga0495586_0719579_13_318 | 101 |
| 488 | 3300046536 | Ga0495587_0094429 | Ga0495587_0094429_1282_1590 | 101 |
| 489 | 3300046536 | Ga0495587_0329809 | Ga0495587_0329809_474_779 | 101 |
| 490 | 3300046536 | Ga0495587_0720489 | Ga0495587_0720489_138_443 | 101 |
| 491 | 3300046536 | Ga0495587_0822743 | Ga0495587_0822743_37_342 | 101 |
| 492 | 3300046537 | Ga0495598_0456914 | Ga0495598_0456914_44_349 | 101 |
| 493 | 3300046543 | Ga0495645_0346487 | Ga0495645_0346487_474_779 | 101 |
| 494 | 3300046543 | Ga0495645_0792406 | Ga0495645_0792406_63_368 | 101 |
| 495 | 3300046543 | Ga0495645_0854282 | Ga0495645_0854282_98_403 | 101 |
| 496 | 3300046557 | Ga0495622_0071719 | Ga0495622_0071719_985_1290 | 101 |
| 497 | 3300046559 | Ga0495667_0188726 | Ga0495667_0188726_237_542 | 101 |
| 498 | 3300046559 | Ga0495667_0643235 | Ga0495667_0643235_115_420 | 101 |
| 499 | 3300046642 | Ga0495634_0003404 | Ga0495634_0003404_407_712 | 101 |
| 500 | 3300046642 | Ga0495634_0035539 | Ga0495634_0035539_255_560 | 101 |
| 501 | 3300046642 | Ga0495634_0325725 | Ga0495634_0325725_373_678 | 101 |
| 502 | 3300046663 | Ga0495635_0137607 | Ga0495635_0137607_499_807 | 101 |
| 503 | 3300046663 | Ga0495635_0746684 | Ga0495635_0746684_245_553 | 101 |
| 504 | 3300046663 | Ga0495635_0751319 | Ga0495635_0751319_280_585 | 101 |
| 505 | 3300046663 | Ga0495635_0758668 | Ga0495635_0758668_208_513 | 101 |
| 506 | 3300046674 | Ga0495588_0260492 | Ga0495588_0260492_400_708 | 101 |
| 507 | 3300046678 | Ga0495599_0176526 | Ga0495599_0176526_476_781 | 101 |
| 508 | 3300046681 | Ga0495647_0007529 | Ga0495647_0007529_1770_2075 | 101 |
| 509 | 3300046681 | Ga0495647_0416399 | Ga0495647_0416399_292_600 | 101 |
| 510 | 3300046683 | Ga0495658_0050999 | Ga0495658_0050999_1392_1697 | 101 |
| 511 | 3300046683 | Ga0495658_1106817 | Ga0495658_1106817_118_423 | 101 |
| 512 | 3300046689 | Ga0495613_0015524 | Ga0495613_0015524_2979_3284 | 101 |
| 513 | 3300046689 | Ga0495613_0046614 | Ga0495613_0046614_1589_1894 | 101 |
| 514 | 3300046689 | Ga0495613_0073050 | Ga0495613_0073050_118_423 | 101 |
| 515 | 3300046689 | Ga0495613_0144254 | Ga0495613_0144254_113_418 | 101 |
| 516 | 3300046689 | Ga0495613_0190604 | Ga0495613_0190604_629_934 | 101 |
| 517 | 3300046690 | Ga0495624_0058784 | Ga0495624_0058784_1109_1414 | 101 |
| 518 | 3300046809 | Ga0495600_0294514 | Ga0495600_0294514_540_845 | 101 |
| 519 | 3300046809 | Ga0495600_0458257 | Ga0495600_0458257_88_393 | 101 |
| 520 | 3300046809 | Ga0495600_0632823 | Ga0495600_0632823_212_517 | 101 |
| 521 | 3300047315 | Ga0495581_0300341 | Ga0495581_0300341_280_585 | 101 |
| 522 | 3300047315 | Ga0495581_0492685 | Ga0495581_0492685_373_678 | 101 |
| 523 | 3300047315 | Ga0495581_0769378 | Ga0495581_0769378_15_320 | 101 |
| 524 | 3300047317 | Ga0495604_0174104 | Ga0495604_0174104_427_732 | 101 |
| 525 | 3300047317 | Ga0495604_0601547 | Ga0495604_0601547_303_608 | 101 |
| 526 | 3300047318 | Ga0495636_0621457 | Ga0495636_0621457_132_440 | 101 |
| 527 | 3300047319 | Ga0495674_0000804 | Ga0495674_0000804_29074_29379 | 101 |
| 528 | 3300047319 | Ga0495674_0047043 | Ga0495674_0047043_2740_3045 | 101 |
| 529 | 3300047319 | Ga0495674_0476349 | Ga0495674_0476349_503_808 | 101 |
| 530 | 3300047321 | Ga0495676_0027244 | Ga0495676_0027244_4359_4664 | 101 |
| 531 | 3300047322 | Ga0495680_0025241 | Ga0495680_0025241_4377_4682 | 101 |
| 532 | 3300047322 | Ga0495680_0147541 | Ga0495680_0147541_1027_1332 | 101 |
| 533 | 3300047444 | Ga0495675_0084151 | Ga0495675_0084151_407_715 | 101 |
| 534 | 3300047444 | Ga0495675_0288194 | Ga0495675_0288194_410_715 | 101 |
| 535 | 3300047471 | Ga0495684_0306500 | Ga0495684_0306500_486_791 | 101 |
| 536 | 3300047471 | Ga0495684_0446400 | Ga0495684_0446400_379_684 | 101 |
| 537 | 3300048088 | Ga0495602_0656030 | Ga0495602_0656030_187_495 | 101 |
| 538 | 3300048910 | Ga0496107_0463069 | Ga0496107_0463069_253_561 | 101 |
| 539 | 3300048918 | Ga0496115_0047285 | Ga0496115_0047285_1092_1400 | 101 |
| 540 | 3300048918 | Ga0496115_0863250 | Ga0496115_0863250_52_357 | 101 |
| 541 | 3300049568 | Ga0501031_0002393 | Ga0501031_0002393_1172_1477 | 101 |
| 542 | 3300049568 | Ga0501031_0015398 | Ga0501031_0015398_463_768 | 101 |
| 543 | 3300049569 | Ga0501032_0036615 | Ga0501032_0036615_1649_1954 | 101 |
| 544 | 3300049569 | Ga0501032_0054217 | Ga0501032_0054217_92_397 | 101 |
| 545 | 3300049570 | Ga0501033_0003744 | Ga0501033_0003744_961_1266 | 101 |
| 546 | 3300049570 | Ga0501033_0151947 | Ga0501033_0151947_1108_1413 | 101 |
| 547 | 3300049570 | Ga0501033_0270137 | Ga0501033_0270137_45_350 | 101 |
| 548 | 3300049573 | Ga0501037_0690164 | Ga0501037_0690164_269_574 | 101 |
| 549 | 3300049579 | Ga0501043_0097979 | Ga0501043_0097979_1101_1406 | 101 |
| 550 | 3300049579 | Ga0501043_1304500 | Ga0501043_1304500_102_407 | 101 |
| 551 | 3300049580 | Ga0501046_0576848 | Ga0501046_0576848_439_744 | 101 |
| 552 | 3300049581 | Ga0501047_0357830 | Ga0501047_0357830_922_1227 | 101 |
| 553 | 3300049581 | Ga0501047_0443573 | Ga0501047_0443573_128_433 | 101 |
| 554 | 3300049742 | Ga0501080_0023318 | Ga0501080_0023318_75_380 | 101 |
| 555 | 3300049742 | Ga0501080_1006692 | Ga0501080_1006692_192_497 | 101 |
| 556 | 3300049744 | Ga0501083_0190839 | Ga0501083_0190839_834_1139 | 101 |
| 557 | 3300049822 | Ga0501035_0331669 | Ga0501035_0331669_757_1062 | 101 |
| 558 | 3300049822 | Ga0501035_0438925 | Ga0501035_0438925_664_969 | 101 |
| 559 | 3300049823 | Ga0501044_0000125 | Ga0501044_0000125_66191_66496 | 101 |
| 560 | 3300049823 | Ga0501044_0157216 | Ga0501044_0157216_1909_2214 | 101 |
| 561 | 3300049823 | Ga0501044_0184778 | Ga0501044_0184778_1261_1566 | 101 |
| 562 | 3300049823 | Ga0501044_0565036 | Ga0501044_0565036_286_591 | 101 |
| 563 | 3300050510 | nmdc:mga06r32_35566_c1 | nmdc:mga06r32_35566_c1_2740_3045 | 101 |
| 564 | 3300050511 | nmdc:mga08y16_622386_c1 | nmdc:mga08y16_622386_c1_396_701 | 101 |
| 565 | 3300050512 | nmdc:mga0n895_311913_c1 | nmdc:mga0n895_311913_c1_600_905 | 101 |
| 566 | 3300050513 | nmdc:mga0rr50_167380_c1 | nmdc:mga0rr50_167380_c1_228_536 | 101 |
| 567 | 3300050514 | nmdc:mga08x19_264764_c1 | nmdc:mga08x19_264764_c1_533_838 | 101 |
| 568 | 3300053077 | Ga0495601_0118365 | Ga0495601_0118365_238_543 | 101 |
| 569 | 3300053098 | Ga0500650_0007717 | Ga0500650_0007717_3784_4089 | 101 |
| 570 | 3300028666 | Ga0265336_10142212 | Ga0265336_101422122 | 102 |
| 571 | 3300028800 | Ga0265338_10048780 | Ga0265338_100487803 | 102 |
| 572 | 3300047444 | Ga0495675_0402791 | Ga0495675_0402791_330_638 | 102 |
| 573 | 3300046517 | Ga0495630_0753295 | Ga0495630_0753295_130_477 | 103 |
| 574 | 3300046535 | Ga0495586_0359376 | Ga0495586_0359376_221_574 | 103 |
| 575 | 3300046535 | Ga0495586_0567179 | Ga0495586_0567179_205_552 | 103 |
| 576 | 2162886012 | MBSR1b_contig_12717097 | MBSR1b_0196.00004550 | 104 |
| 577 | 3300005440 | Ga0070705_100287343 | Ga0070705_1002873432 | 104 |
| 578 | 3300005471 | Ga0070698_101383762 | Ga0070698_1013837621 | 104 |
| 579 | 3300005549 | Ga0070704_101292066 | Ga0070704_1012920661 | 104 |
| 580 | 3300005843 | Ga0068860_100844683 | Ga0068860_1008446832 | 104 |
| 581 | 3300027876 | Ga0209974_10157399 | Ga0209974_101573991 | 104 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rai-assembly1.cif.gz_B | the px-bar membrane remodeling unit of sorting nexin 9 | 0.8182 | 7 | 53 |
| 7d3u-assembly1.cif.gz_F | structure of mrp complex from dietzia sp. dq12-45-1b | 0.7841 | 7 | 86 |
| 3d36-assembly1.cif.gz_A | how to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda | 0.7769 | 2 | 59 |
| 6cfw-assembly1.cif.gz_B | cryoem structure of a respiratory membrane-bound hydrogenase | 0.7695 | 7 | 88 |
| 7wff-assembly1.cif.gz_E | subcomplexes b,m and l in the cylic electron transfer supercomplex ndh-psi from arabidopsis | 0.7619 | 7 | 90 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A0A0R4IM47_32_299_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.8968 | 7 | 53 | 1.20.1270.60 |
| af_Q80Z70_171_425_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8472 | 7 | 54 | 1.25.40.10 |
| af_Q9Z2G6_165_328_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.8465 | 7 | 54 | 1.25.40.10 |
| af_A0A1D6K988_42_215_1.20.140.40 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein | 0.8262 | 7 | 53 | 1.20.140.40 |
| af_Q2FZV1_630_695_1.10.287.3510 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins; | 0.8172 | 17 | 98 | 1.10.287.3510 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A497IER7-F1-model_v4 | NADH-quinone oxidoreductase subunit NuoK | 0.9667 | 7 | 90 |
GO:0016020
|
| AF-A0A2G6II65-F1-model_v4 | K+/H+ antiporter subunit F | 0.8862 | 7 | 90 |
GO:0005886
GO:0015385 |
| AF-A0A495T4H7-F1-model_v4 | Multicomponent Na+:H+ antiporter subunit F | 0.8807 | 7 | 90 |
GO:0005886
GO:0015385 |
| AF-A0A662IJE1-F1-model_v4 | NADH-quinone oxidoreductase subunit K | 0.8775 | 7 | 89 |
|
| AF-X0ZAH8-F1-model_v4 | NADH-quinone oxidoreductase subunit K | 0.8694 | 6 | 96 |
GO:0016020
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar