F466104

General Info

Members Datasets Scaffolds Average Seq Length
581 246 581 101

Family's Representative Sequence

Representative Sequence 3300047444|Ga0495675_0402791|Ga0495675_0402791_330_638
Length 102
Sequence MNVGLEHYLVVSALLFCLGLMGVIVRRNLLVIYMSLELMLNAANLALVAFSRFSKDSLDGQVFVFFIITVAAAEVSVGLALIVALYRKRQTAHVEDLTSMRL

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
59 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
60 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
118 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
121 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
122 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
123 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
124 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
125 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
126 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
127 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
131 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
137 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
138 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
141 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
142 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
145 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
146 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
152 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
159 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
162 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
169 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
170 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
171 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
172 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
173 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
174 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
175 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
179 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
180 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
181 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
182 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
183 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
184 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
185 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
186 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
187 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
188 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
189 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
190 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
194 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
195 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
196 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
197 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
198 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
199 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
200 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
207 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
208 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
209 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
210 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
216 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
217 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
218 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
219 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
220 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
221 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
222 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
223 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
224 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
225 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
238 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
240 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
241 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
246 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 1.38
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_12717097 2162886012 Unclassified 1062
2 CNXas_1002134 3300000545 Bacteria 1362
3 Ga0065707_10340233 3300005295 Bacteria 935
4 Ga0070658_10802087 3300005327 Bacteria 818
5 Ga0070658_10933391 3300005327 Bacteria 755
6 Ga0070683_100240949 3300005329 Bacteria 1720
7 Ga0070690_100340087 3300005330 Bacteria 1086
8 Ga0070690_100784226 3300005330 Bacteria 738
9 Ga0070670_100787039 3300005331 Bacteria 858
10 Ga0070677_10212551 3300005333 Bacteria 940
11 Ga0070677_10596111 3300005333 Bacteria 611
12 Ga0068869_102072277 3300005334 Bacteria 511
13 Ga0070666_10011337 3300005335 Bacteria 5593
14 Ga0070680_100784055 3300005336 Unclassified 821
15 Ga0070689_100020023 3300005340 Bacteria 4959
16 Ga0070689_100044621 3300005340 Bacteria 3411
17 Ga0070689_100245345 3300005340 Bacteria 1476
18 Ga0070689_100382224 3300005340 Bacteria 1187
19 Ga0070689_100419399 3300005340 Bacteria 1134
20 Ga0070689_100867040 3300005340 Unclassified 797
21 Ga0070689_101066437 3300005340 Bacteria 721
22 Ga0070689_102047811 3300005340 Bacteria 524
23 Ga0070691_10043530 3300005341 Bacteria 2127
24 Ga0070691_10343443 3300005341 Bacteria 827
25 Ga0070691_10492401 3300005341 Bacteria 707
26 Ga0070687_100406706 3300005343 Bacteria 894
27 Ga0070687_100916662 3300005343 Unclassified 629
28 Ga0070674_101741120 3300005356 Bacteria 564
29 Ga0070688_100176123 3300005365 Unclassified 1480
30 Ga0070688_100244884 3300005365 Bacteria 1274
31 Ga0070688_101073858 3300005365 Bacteria 642
32 Ga0070688_101183979 3300005365 Unclassified 613
33 Ga0070688_101251180 3300005365 Bacteria 598
34 Ga0070659_101522694 3300005366 Bacteria 596
35 Ga0070709_10656682 3300005434 Unclassified 812
36 Ga0070714_100300146 3300005435 Bacteria 1497
37 Ga0070713_100489960 3300005436 Bacteria 1159
38 Ga0070713_100914350 3300005436 Bacteria 844
39 Ga0070710_10889577 3300005437 Unclassified 642
40 Ga0070711_100317758 3300005439 Bacteria 1243
41 Ga0070711_101075046 3300005439 Bacteria 692
42 Ga0070711_101946635 3300005439 Bacteria 517
43 Ga0070705_100044317 3300005440 Bacteria 2555
44 Ga0070705_100072025 3300005440 Bacteria 2092
45 Ga0070705_100165050 3300005440 Unclassified 1485
46 Ga0070705_100287343 3300005440 Bacteria 1172
47 Ga0070700_100217341 3300005441 Bacteria 1352
48 Ga0070700_100541924 3300005441 Bacteria 902
49 Ga0070694_100363534 3300005444 Bacteria 1124
50 Ga0070708_101803050 3300005445 Bacteria 568
51 Ga0070708_101987771 3300005445 Unclassified 538
52 Ga0070678_100984803 3300005456 Bacteria 774
53 Ga0070681_11638911 3300005458 Bacteria 569
54 Ga0068867_100658930 3300005459 Bacteria 919
55 Ga0068867_101992778 3300005459 Bacteria 549
56 Ga0070685_10726668 3300005466 Unclassified 726
57 Ga0070685_10927646 3300005466 Bacteria 649
58 Ga0070685_10970877 3300005466 Bacteria 636
59 Ga0070685_11064887 3300005466 Unclassified 609
60 Ga0070707_101517758 3300005468 Bacteria 637
61 Ga0070698_101362798 3300005471 Bacteria 660
62 Ga0070698_101383762 3300005471 Bacteria 654
63 Ga0070679_100122690 3300005530 Bacteria 2582
64 Ga0070679_100143599 3300005530 Bacteria 2365
65 Ga0070679_100194328 3300005530 Bacteria 1997
66 Ga0070684_100442919 3300005535 Bacteria 1200
67 Ga0070684_100583023 3300005535 Bacteria 1039
68 Ga0070684_102092582 3300005535 Bacteria 534
69 Ga0070686_100138195 3300005544 Bacteria 1693
70 Ga0070686_100162157 3300005544 Bacteria 1575
71 Ga0070686_100680752 3300005544 Bacteria 818
72 Ga0070693_101065905 3300005547 Bacteria 615
73 Ga0070704_100297165 3300005549 Bacteria 1344
74 Ga0070704_101292066 3300005549 Bacteria 667
75 Ga0068855_100087596 3300005563 Bacteria 3598
76 Ga0068855_100134319 3300005563 Bacteria 2823
77 Ga0068855_100233000 3300005563 Bacteria 2061
78 Ga0068855_102276872 3300005563 Bacteria 543
79 Ga0068857_100479935 3300005577 Bacteria 1165
80 Ga0068857_101058347 3300005577 Unclassified 782
81 Ga0068856_100001472 3300005614 Bacteria 24668
82 Ga0068856_100156059 3300005614 Bacteria 2292
83 Ga0068856_100188235 3300005614 Bacteria 2078
84 Ga0068856_100195917 3300005614 Bacteria 2034
85 Ga0068856_100273763 3300005614 Bacteria 1704
86 Ga0068856_102064366 3300005614 Bacteria 580
87 Ga0070702_101305404 3300005615 Bacteria 589
88 Ga0068859_100004968 3300005617 Bacteria 13511
89 Ga0068859_100134529 3300005617 Bacteria 2544
90 Ga0068859_100265873 3300005617 Bacteria 1807
91 Ga0068859_102231001 3300005617 Unclassified 604
92 Ga0068859_102832364 3300005617 Bacteria 532
93 Ga0068864_100026221 3300005618 Bacteria 4914
94 Ga0068864_102222992 3300005618 Bacteria 555
95 Ga0068861_101431017 3300005719 Bacteria 676
96 Ga0068863_100024694 3300005841 Bacteria 5732
97 Ga0068863_100124594 3300005841 Bacteria 2458
98 Ga0068863_100444383 3300005841 Bacteria 1272
99 Ga0068863_100692705 3300005841 Bacteria 1012
100 Ga0068863_102355954 3300005841 Bacteria 542
101 Ga0068863_102642182 3300005841 Bacteria 511
102 Ga0068860_100844683 3300005843 Bacteria 930
103 Ga0081455_10365903 3300005937 Bacteria 1012
104 Ga0070717_10566718 3300006028 Bacteria 1029
105 Ga0070716_101362899 3300006173 Unclassified 575
106 Ga0070712_101447006 3300006175 Bacteria 600
107 Ga0097621_100327109 3300006237 Bacteria 1359
108 Ga0068871_101756438 3300006358 Bacteria 589
109 Ga0075428_100003239 3300006844 Bacteria 17824
110 Ga0075431_100160575 3300006847 Bacteria 2311
111 Ga0075434_100215256 3300006871 Bacteria 1941
112 Ga0075434_101555871 3300006871 Bacteria 670
113 Ga0068865_101169670 3300006881 Bacteria 680
114 Ga0068865_101651208 3300006881 Bacteria 577
115 Ga0097620_100004968 3300006931 Bacteria 13511
116 Ga0097620_100134526 3300006931 Bacteria 2544
117 Ga0097620_100265877 3300006931 Bacteria 1807
118 Ga0097620_102230650 3300006931 Unclassified 604
119 Ga0097620_102830959 3300006931 Bacteria 532
120 Ga0075435_100189564 3300007076 Bacteria 1740
121 Ga0075435_100387961 3300007076 Bacteria 1200
122 Ga0075435_101122376 3300007076 Unclassified 687
123 Ga0099794_10628155 3300007265 Bacteria 570
124 Ga0099795_10438343 3300007788 Bacteria 599
125 Ga0105240_10002292 3300009093 Bacteria 30998
126 Ga0105240_10075008 3300009093 Bacteria 4173
127 Ga0105240_10275551 3300009093 Bacteria 1935
128 Ga0105240_10327190 3300009093 Bacteria 1745
129 Ga0105240_10355920 3300009093 Bacteria 1660
130 Ga0105240_10549536 3300009093 Bacteria 1278
131 Ga0111539_10004958 3300009094 Bacteria 17316
132 Ga0111539_10553070 3300009094 Bacteria 1340
133 Ga0111539_10851994 3300009094 Bacteria 1060
134 Ga0105245_10384377 3300009098 Bacteria 1399
135 Ga0105245_11112250 3300009098 Unclassified 836
136 Ga0105245_12417309 3300009098 Bacteria 579
137 Ga0114129_11393681 3300009147 Bacteria 865
138 Ga0114129_13381760 3300009147 Bacteria 514
139 Ga0105241_11173988 3300009174 Bacteria 726
140 Ga0105242_10365668 3300009176 Bacteria 1336
141 Ga0105242_10955328 3300009176 Bacteria 861
142 Ga0105242_11608342 3300009176 Unclassified 684
143 Ga0105248_11013986 3300009177 Unclassified 938
144 Ga0105248_11439820 3300009177 Bacteria 780
145 Ga0105248_11506857 3300009177 Bacteria 761
146 Ga0105237_10519599 3300009545 Bacteria 1197
147 Ga0105238_10019653 3300009551 Bacteria 6879
148 Ga0105238_10024440 3300009551 Bacteria 6158
149 Ga0105238_10110124 3300009551 Bacteria 2735
150 Ga0105238_10378912 3300009551 Bacteria 1406
151 Ga0105249_11325990 3300009553 Bacteria 791
152 Ga0105249_11757359 3300009553 Bacteria 693
153 Ga0157370_10051388 3300013104 Bacteria 3937
154 Ga0157369_12547985 3300013105 Bacteria 518
155 Ga0157374_10264923 3300013296 Bacteria 1694
156 Ga0157374_10343348 3300013296 Bacteria 1482
157 Ga0157378_11527480 3300013297 Bacteria 713
158 Ga0157378_12856588 3300013297 Bacteria 535
159 Ga0163162_11284802 3300013306 Bacteria 831
160 Ga0163162_11792829 3300013306 Unclassified 701
161 Ga0157372_10547801 3300013307 Bacteria 1348
162 Ga0157372_10621504 3300013307 Bacteria 1259
163 Ga0157372_10770192 3300013307 Bacteria 1119
164 Ga0157375_10000086 3300013308 Bacteria 93377
165 Ga0157375_10854998 3300013308 Bacteria 1056
166 Ga0157375_12222821 3300013308 Bacteria 654
167 Ga0163163_10019087 3300014325 Bacteria 6433
168 Ga0163163_10437443 3300014325 Bacteria 1367
169 Ga0157380_11060780 3300014326 Bacteria 847
170 Ga0157379_10383658 3300014968 Bacteria 1289
171 Ga0157379_11150987 3300014968 Unclassified 745
172 Ga0207682_10189019 3300025893 Bacteria 943
173 Ga0207692_10666290 3300025898 Unclassified 673
174 Ga0207680_10068302 3300025903 Bacteria 2192
175 Ga0207699_10583542 3300025906 Unclassified 813
176 Ga0207705_10351738 3300025909 Bacteria 1135
177 Ga0207705_10662747 3300025909 Bacteria 811
178 Ga0207695_10025957 3300025913 Bacteria 6547
179 Ga0207695_10028567 3300025913 Bacteria 6180
180 Ga0207695_10253737 3300025913 Bacteria 1658
181 Ga0207695_10255476 3300025913 Bacteria 1651
182 Ga0207695_10371505 3300025913 Bacteria 1316
183 Ga0207695_10379811 3300025913 Bacteria 1299
184 Ga0207663_10001010 3300025916 Bacteria 12879
185 Ga0207663_10316654 3300025916 Bacteria 1171
186 Ga0207663_10837264 3300025916 Bacteria 734
187 Ga0207662_10194547 3300025918 Bacteria 1310
188 Ga0207657_11077041 3300025919 Bacteria 615
189 Ga0207652_10245481 3300025921 Bacteria 1614
190 Ga0207652_10312673 3300025921 Bacteria 1418
191 Ga0207694_10028210 3300025924 Bacteria 4279
192 Ga0207694_10067143 3300025924 Bacteria 2799
193 Ga0207694_10071433 3300025924 Bacteria 2712
194 Ga0207650_10581199 3300025925 Bacteria 941
195 Ga0207659_11598040 3300025926 Bacteria 557
196 Ga0207687_10793602 3300025927 Unclassified 807
197 Ga0207700_11833712 3300025928 Bacteria 533
198 Ga0207686_10638785 3300025934 Bacteria 841
199 Ga0207670_10015941 3300025936 Bacteria 4502
200 Ga0207670_10114746 3300025936 Bacteria 1947
201 Ga0207670_10150449 3300025936 Bacteria 1727
202 Ga0207670_10178956 3300025936 Bacteria 1596
203 Ga0207670_10209307 3300025936 Bacteria 1486
204 Ga0207670_10303432 3300025936 Bacteria 1251
205 Ga0207670_10543860 3300025936 Bacteria 948
206 Ga0207670_10598088 3300025936 Bacteria 905
207 Ga0207670_10926646 3300025936 Unclassified 731
208 Ga0207670_11093391 3300025936 Bacteria 673
209 Ga0207704_10867994 3300025938 Bacteria 757
210 Ga0207711_10785402 3300025941 Bacteria 887
211 Ga0207689_11699845 3300025942 Bacteria 523
212 Ga0207667_10051360 3300025949 Bacteria 4347
213 Ga0207667_10258381 3300025949 Bacteria 1781
214 Ga0207667_10483029 3300025949 Bacteria 1258
215 Ga0207667_11616996 3300025949 Bacteria 616
216 Ga0207651_11309888 3300025960 Unclassified 651
217 Ga0207712_10593548 3300025961 Bacteria 957
218 Ga0207639_10762182 3300026041 Bacteria 900
219 Ga0207708_10999313 3300026075 Bacteria 727
220 Ga0207702_10002049 3300026078 Bacteria 19503
221 Ga0207702_10011792 3300026078 Bacteria 7279
222 Ga0207702_10173900 3300026078 Bacteria 1977
223 Ga0207702_11260282 3300026078 Bacteria 733
224 Ga0207641_10018189 3300026088 Bacteria 5761
225 Ga0207641_11147895 3300026088 Bacteria 776
226 Ga0207648_10200676 3300026089 Bacteria 1769
227 Ga0207676_10970556 3300026095 Bacteria 836
228 Ga0207674_10300018 3300026116 Bacteria 1555
229 Ga0207674_10632239 3300026116 Bacteria 1034
230 Ga0207675_101302608 3300026118 Bacteria 747
231 Ga0207683_10493150 3300026121 Bacteria 1131
232 Ga0207683_11402734 3300026121 Bacteria 646
233 Ga0209588_1263695 3300027671 Bacteria 524
234 Ga0209974_10157399 3300027876 Unclassified 823
235 Ga0268265_11797707 3300028380 Bacteria 619
236 Ga0268265_12039520 3300028380 Bacteria 581
237 Ga0268264_11577944 3300028381 Bacteria 667
238 Ga0265337_1000140 3300028556 Bacteria 36107
239 Ga0265337_1000920 3300028556 Bacteria 15425
240 Ga0265337_1004569 3300028556 Bacteria 5709
241 Ga0265337_1007544 3300028556 Bacteria 4062
242 Ga0265337_1009032 3300028556 Bacteria 3582
243 Ga0265337_1020782 3300028556 Bacteria 2054
244 Ga0265337_1055732 3300028556 Bacteria 1103
245 Ga0265337_1085897 3300028556 Bacteria 859
246 Ga0265337_1105318 3300028556 Bacteria 767
247 Ga0265326_10051322 3300028558 Bacteria 1168
248 Ga0265326_10099858 3300028558 Bacteria 823
249 Ga0265326_10103142 3300028558 Unclassified 809
250 Ga0265326_10124954 3300028558 Bacteria 732
251 Ga0265326_10167869 3300028558 Bacteria 628
252 Ga0265319_1000007 3300028563 Bacteria 217194
253 Ga0265319_1003681 3300028563 Bacteria 7891
254 Ga0265319_1011822 3300028563 Bacteria 3554
255 Ga0265319_1167746 3300028563 Bacteria 677
256 Ga0265319_1169444 3300028563 Bacteria 673
257 Ga0265334_10021782 3300028573 Bacteria 2616
258 Ga0265334_10064430 3300028573 Bacteria 1376
259 Ga0265318_10035245 3300028577 Bacteria 1925
260 Ga0265318_10045073 3300028577 Bacteria 1667
261 Ga0265318_10315353 3300028577 Bacteria 571
262 Ga0265323_10000237 3300028653 Bacteria 32647
263 Ga0265323_10026728 3300028653 Bacteria 2173
264 Ga0265323_10030725 3300028653 Bacteria 1999
265 Ga0265323_10077387 3300028653 Bacteria 1128
266 Ga0265322_10001686 3300028654 Bacteria 7024
267 Ga0265322_10044124 3300028654 Bacteria 1270
268 Ga0265322_10063228 3300028654 Bacteria 1050
269 Ga0265322_10101086 3300028654 Bacteria 820
270 Ga0265336_10006142 3300028666 Bacteria 4352
271 Ga0265336_10016947 3300028666 Bacteria 2375
272 Ga0265336_10036849 3300028666 Bacteria 1505
273 Ga0265336_10073420 3300028666 Bacteria 1022
274 Ga0265336_10095956 3300028666 Bacteria 884
275 Ga0265336_10142212 3300028666 Bacteria 714
276 Ga0265336_10213733 3300028666 Bacteria 573
277 Ga0265338_10000431 3300028800 Bacteria 75210
278 Ga0265338_10001555 3300028800 Bacteria 37061
279 Ga0265338_10008592 3300028800 Bacteria 12357
280 Ga0265338_10009353 3300028800 Bacteria 11706
281 Ga0265338_10010919 3300028800 Bacteria 10561
282 Ga0265338_10011481 3300028800 Bacteria 10227
283 Ga0265338_10013859 3300028800 Bacteria 9057
284 Ga0265338_10014147 3300028800 Bacteria 8919
285 Ga0265338_10019255 3300028800 Bacteria 7259
286 Ga0265338_10021384 3300028800 Bacteria 6748
287 Ga0265338_10024132 3300028800 Bacteria 6224
288 Ga0265338_10027437 3300028800 Bacteria 5713
289 Ga0265338_10032402 3300028800 Bacteria 5098
290 Ga0265338_10045342 3300028800 Bacteria 4044
291 Ga0265338_10048780 3300028800 Bacteria 3848
292 Ga0265338_10052571 3300028800 Bacteria 3653
293 Ga0265338_10076720 3300028800 Bacteria 2829
294 Ga0265338_10137665 3300028800 Bacteria 1916
295 Ga0265338_10193904 3300028800 Bacteria 1537
296 Ga0265338_10233317 3300028800 Bacteria 1367
297 Ga0265338_10334064 3300028800 Bacteria 1094
298 Ga0265338_10387676 3300028800 Bacteria 998
299 Ga0265338_10416422 3300028800 Bacteria 956
300 Ga0265338_10437016 3300028800 Bacteria 928
301 Ga0265338_10479050 3300028800 Bacteria 878
302 Ga0265338_10711517 3300028800 Bacteria 693
303 Ga0265338_10758404 3300028800 Bacteria 667
304 Ga0265338_10782530 3300028800 Bacteria 654
305 Ga0265324_10002329 3300029957 Bacteria 9831
306 Ga0265324_10015253 3300029957 Bacteria 2829
307 Ga0265324_10015285 3300029957 Bacteria 2825
308 Ga0265324_10019169 3300029957 Bacteria 2466
309 Ga0265324_10019506 3300029957 Bacteria 2443
310 Ga0265324_10034697 3300029957 Bacteria 1757
311 Ga0265324_10039188 3300029957 Bacteria 1643
312 Ga0265324_10067478 3300029957 Bacteria 1220
313 Ga0265324_10143451 3300029957 Bacteria 811
314 Ga0265324_10170240 3300029957 Bacteria 740
315 Ga0307511_10125600 3300030521 Bacteria 1567
316 Ga0265330_10030858 3300031235 Bacteria 2404
317 Ga0265332_10199062 3300031238 Bacteria 833
318 Ga0265320_10000188 3300031240 Bacteria 51229
319 Ga0265320_10003925 3300031240 Bacteria 9826
320 Ga0265320_10004415 3300031240 Bacteria 9228
321 Ga0265320_10011472 3300031240 Bacteria 5213
322 Ga0265320_10048479 3300031240 Bacteria 2072
323 Ga0265320_10094740 3300031240 Bacteria 1380
324 Ga0265320_10182402 3300031240 Bacteria 940
325 Ga0265320_10256439 3300031240 Bacteria 775
326 Ga0265320_10449597 3300031240 Bacteria 569
327 Ga0265325_10023559 3300031241 Bacteria 3358
328 Ga0265325_10050609 3300031241 Bacteria 2138
329 Ga0265325_10312137 3300031241 Bacteria 700
330 Ga0265329_10109577 3300031242 Bacteria 882
331 Ga0265340_10058985 3300031247 Bacteria 1842
332 Ga0265340_10069957 3300031247 Bacteria 1665
333 Ga0265340_10433150 3300031247 Bacteria 580
334 Ga0265339_10017090 3300031249 Bacteria 4302
335 Ga0265339_10199786 3300031249 Bacteria 987
336 Ga0265331_10077949 3300031250 Bacteria 1543
337 Ga0265331_10182628 3300031250 Unclassified 947
338 Ga0265327_10000752 3300031251 Bacteria 50420
339 Ga0265327_10008595 3300031251 Bacteria 7572
340 Ga0265327_10230600 3300031251 Bacteria 830
341 Ga0265316_10006885 3300031344 Bacteria 10789
342 Ga0265316_10009696 3300031344 Bacteria 8839
343 Ga0265316_10010502 3300031344 Bacteria 8432
344 Ga0265316_10010930 3300031344 Bacteria 8241
345 Ga0265316_10066910 3300031344 Bacteria 2779
346 Ga0265316_10079893 3300031344 Bacteria 2509
347 Ga0265316_10147414 3300031344 Bacteria 1764
348 Ga0265316_10213115 3300031344 Bacteria 1428
349 Ga0265316_10268736 3300031344 Bacteria 1248
350 Ga0265313_10001008 3300031595 Bacteria 27543
351 Ga0265313_10012570 3300031595 Bacteria 5154
352 Ga0265313_10131179 3300031595 Bacteria 1085
353 Ga0265314_10024198 3300031711 Bacteria 4608
354 Ga0265314_10043005 3300031711 Bacteria 3216
355 Ga0265314_10248883 3300031711 Bacteria 1021
356 Ga0265314_10618729 3300031711 Bacteria 556
357 Ga0265314_10687799 3300031711 Bacteria 518
358 Ga0265342_10055412 3300031712 Bacteria 2353
359 Ga0265342_10362426 3300031712 Bacteria 753
360 Ga0265342_10432801 3300031712 Bacteria 676
361 Ga0265342_10459597 3300031712 Bacteria 653
362 Ga0316576_10670239 3300031727 Bacteria 753
363 Ga0316585_10075010 3300032137 Bacteria 1100
364 Ga0373930_0000589 3300034816 Bacteria 5037
365 Ga0373948_0115770 3300034817 Bacteria 644
366 Ga0373950_0009528 3300034818 Bacteria 1553
367 Ga0373958_0143320 3300034819 Bacteria 593
368 Ga0373926_0298641 3300035083 Unclassified 628
369 Ga0373928_0000124 3300035084 Bacteria 14419
370 Ga0373929_0002245 3300035085 Bacteria 3573
371 Ga0373934_0313006 3300035086 Bacteria 652
372 Ga0373940_0002420 3300035088 Bacteria 3627
373 Ga0373944_0005149 3300035089 Bacteria 3435
374 Ga0373949_0002141 3300035090 Bacteria 5191
375 Ga0373949_0286782 3300035090 Bacteria 519
376 Ga0373951_0004091 3300035091 Bacteria 3489
377 Ga0373951_0047262 3300035091 Bacteria 1051
378 Ga0373923_0250547 3300035111 Unclassified 829
379 Ga0373932_0000001 3300035112 Bacteria 1459067
380 Ga0373939_0169406 3300035114 Bacteria 807
381 Ga0373945_0035902 3300035116 Bacteria 1774
382 Ga0373953_0228589 3300035117 Bacteria 807
383 Ga0373954_0239919 3300035118 Unclassified 892
384 Ga0373956_0005667 3300035119 Bacteria 4994
385 Ga0373957_0473886 3300035120 Bacteria 543
386 Ga0373946_0075615 3300035171 Bacteria 1464
387 Ga0373946_0156698 3300035171 Bacteria 1066
388 Ga0373955_0744331 3300035172 Bacteria 602
389 Ga0373942_0185163 3300035207 Bacteria 684
390 Ga0373962_0000018 3300035242 Bacteria 47177
391 Ga0316574_0304294 3300035398 Bacteria 1013
392 Ga0373931_0000002 3300035691 Bacteria 599830
393 Ga0373935_0003342 3300035692 Bacteria 9294
394 Ga0373935_0104655 3300035692 Bacteria 1871
395 Ga0373927_0002183 3300035695 Bacteria 14381
396 Ga0373927_0032231 3300035695 Bacteria 3412
397 Ga0373927_0036781 3300035695 Bacteria 3182
398 Ga0373927_0929953 3300035695 Unclassified 574
399 Ga0373933_0200470 3300035724 Bacteria 1277
400 Ga0373947_0121838 3300035725 Bacteria 1657
401 Ga0373947_0175980 3300035725 Bacteria 1391
402 Ga0373937_0001956 3300036401 Bacteria 17266
403 Ga0373937_0176416 3300036401 Bacteria 2006
404 Ga0373937_0289399 3300036401 Unclassified 1548
405 Ga0373937_1897835 3300036401 Bacteria 542
406 Ga0316582_0411437 3300036647 Bacteria 932
407 Ga0316584_0391748 3300036712 Bacteria 991
408 Ga0373925_0000272 3300037068 Bacteria 54186
409 Ga0373925_0000552 3300037068 Bacteria 36801
410 Ga0373925_0479213 3300037068 Bacteria 1020
411 Ga0373925_0705058 3300037068 Bacteria 832
412 Ga0373925_1262262 3300037068 Unclassified 606
413 Ga0451793_1237591 3300041452 Bacteria 520
414 Ga0451793_1754102 3300041452 Bacteria 1021
415 Ga0451798_0735027 3300041458 Bacteria 637
416 Ga0451804_0855333 3300041463 Bacteria 1100
417 Ga0451807_1698768 3300041486 Bacteria 508
418 Ga0451835_1202569 3300041492 Bacteria 768
419 Ga0451851_0359195 3300041507 Unclassified 711
420 Ga0451577_0022868 3300042876 Bacteria 5706
421 Ga0451577_0454120 3300042876 Bacteria 1164
422 Ga0451577_0519599 3300042876 Bacteria 1081
423 Ga0451577_0528200 3300042876 Bacteria 1071
424 Ga0451577_1006692 3300042876 Bacteria 748
425 Ga0451577_1935628 3300042876 Bacteria 516
426 Ga0453684_0000382 3300044712 Bacteria 181519
427 Ga0453684_0042720 3300044712 Bacteria 6107
428 Ga0453684_0181132 3300044712 Bacteria 2473
429 Ga0453684_0183568 3300044712 Bacteria 2454
430 Ga0453684_0508984 3300044712 Bacteria 1332
431 Ga0453684_0539021 3300044712 Bacteria 1287
432 Ga0453684_1082216 3300044712 Bacteria 848
433 Ga0453684_1483298 3300044712 Bacteria 700
434 Ga0453684_1513850 3300044712 Bacteria 692
435 Ga0451576_0055495 3300045051 Bacteria 4145
436 Ga0451576_0128791 3300045051 Bacteria 2638
437 Ga0451576_0152496 3300045051 Bacteria 2410
438 Ga0451576_0242441 3300045051 Bacteria 1883
439 Ga0451576_0267301 3300045051 Bacteria 1788
440 Ga0451576_0271525 3300045051 Bacteria 1773
441 Ga0451576_0292562 3300045051 Bacteria 1703
442 Ga0451576_0397458 3300045051 Bacteria 1445
443 Ga0451576_0414709 3300045051 Bacteria 1413
444 Ga0451576_0460641 3300045051 Bacteria 1335
445 Ga0451576_1076366 3300045051 Bacteria 842
446 Ga0451576_1123499 3300045051 Bacteria 822
447 Ga0451576_1145526 3300045051 Bacteria 813
448 Ga0451576_1178293 3300045051 Bacteria 800
449 Ga0451576_1288547 3300045051 Bacteria 762
450 Ga0451576_1394800 3300045051 Bacteria 729
451 Ga0451576_1418583 3300045051 Bacteria 722
452 Ga0495592_0257417 3300046454 Bacteria 1151
453 Ga0495592_0941057 3300046454 Bacteria 506
454 Ga0495629_0057947 3300046459 Bacteria 2708
455 Ga0495629_0116292 3300046459 Bacteria 1864
456 Ga0495641_0421790 3300046461 Bacteria 606
457 Ga0495651_0217288 3300046462 Bacteria 1326
458 Ga0495651_0564197 3300046462 Bacteria 722
459 Ga0495653_0578664 3300046463 Bacteria 692
460 Ga0495653_0980169 3300046463 Bacteria 501
461 Ga0495582_0014639 3300046473 Bacteria 4309
462 Ga0495639_0050410 3300046475 Bacteria 1891
463 Ga0495662_0206451 3300046476 Bacteria 968
464 Ga0495664_0722600 3300046477 Unclassified 588
465 Ga0495608_0494945 3300046511 Bacteria 741
466 Ga0495618_0007045 3300046514 Bacteria 6811
467 Ga0495618_0503619 3300046514 Bacteria 730
468 Ga0495618_0532837 3300046514 Bacteria 705
469 Ga0495628_0221748 3300046516 Bacteria 1420
470 Ga0495628_0280391 3300046516 Bacteria 1238
471 Ga0495630_0000191 3300046517 Bacteria 47951
472 Ga0495630_0048171 3300046517 Bacteria 3189
473 Ga0495630_0163882 3300046517 Bacteria 1692
474 Ga0495630_0398941 3300046517 Bacteria 1054
475 Ga0495630_0565100 3300046517 Bacteria 872
476 Ga0495630_0753295 3300046517 Bacteria 744
477 Ga0495630_0875101 3300046517 Unclassified 685
478 Ga0495666_0038069 3300046526 Bacteria 2340
479 Ga0495666_0089250 3300046526 Bacteria 1455
480 Ga0495666_0456908 3300046526 Bacteria 572
481 Ga0495666_0474489 3300046526 Unclassified 560
482 Ga0495652_0104627 3300046529 Bacteria 2289
483 Ga0495652_0416786 3300046529 Bacteria 947
484 Ga0495652_0607032 3300046529 Bacteria 746
485 Ga0495665_0371006 3300046531 Bacteria 728
486 Ga0495640_0039591 3300046533 Bacteria 3306
487 Ga0495640_0400436 3300046533 Bacteria 843
488 Ga0495640_0656898 3300046533 Bacteria 631
489 Ga0495586_0000113 3300046535 Bacteria 48115
490 Ga0495586_0000762 3300046535 Bacteria 18510
491 Ga0495586_0132552 3300046535 Bacteria 1395
492 Ga0495586_0359376 3300046535 Bacteria 837
493 Ga0495586_0429961 3300046535 Bacteria 761
494 Ga0495586_0505149 3300046535 Bacteria 698
495 Ga0495586_0567179 3300046535 Bacteria 656
496 Ga0495586_0603991 3300046535 Bacteria 634
497 Ga0495586_0719579 3300046535 Bacteria 576
498 Ga0495587_0094429 3300046536 Bacteria 1727
499 Ga0495587_0329809 3300046536 Bacteria 852
500 Ga0495587_0720489 3300046536 Bacteria 546
501 Ga0495587_0822743 3300046536 Bacteria 507
502 Ga0495598_0456914 3300046537 Unclassified 506
503 Ga0495645_0346487 3300046543 Bacteria 958
504 Ga0495645_0792406 3300046543 Bacteria 569
505 Ga0495645_0854282 3300046543 Bacteria 543
506 Ga0495622_0071719 3300046557 Bacteria 1598
507 Ga0495667_0188726 3300046559 Bacteria 1321
508 Ga0495667_0643235 3300046559 Bacteria 659
509 Ga0495634_0003404 3300046642 Bacteria 12775
510 Ga0495634_0035539 3300046642 Bacteria 3411
511 Ga0495634_0325725 3300046642 Bacteria 924
512 Ga0495635_0137607 3300046663 Bacteria 1664
513 Ga0495635_0746684 3300046663 Bacteria 633
514 Ga0495635_0751319 3300046663 Bacteria 630
515 Ga0495635_0758668 3300046663 Bacteria 627
516 Ga0495588_0260492 3300046674 Archaea 914
517 Ga0495599_0176526 3300046678 Bacteria 1317
518 Ga0495647_0007529 3300046681 Bacteria 3654
519 Ga0495647_0416399 3300046681 Unclassified 619
520 Ga0495658_0050999 3300046683 Bacteria 2343
521 Ga0495658_1106817 3300046683 Bacteria 505
522 Ga0495613_0015524 3300046689 Bacteria 5663
523 Ga0495613_0046614 3300046689 Bacteria 3205
524 Ga0495613_0073050 3300046689 Bacteria 2500
525 Ga0495613_0144254 3300046689 Bacteria 1700
526 Ga0495613_0190604 3300046689 Bacteria 1449
527 Ga0495624_0058784 3300046690 Bacteria 2414
528 Ga0495600_0294514 3300046809 Bacteria 1025
529 Ga0495600_0458257 3300046809 Unclassified 788
530 Ga0495600_0632823 3300046809 Bacteria 648
531 Ga0495581_0300341 3300047315 Bacteria 938
532 Ga0495581_0492685 3300047315 Bacteria 713
533 Ga0495581_0769378 3300047315 Bacteria 553
534 Ga0495604_0174104 3300047317 Bacteria 1511
535 Ga0495604_0601547 3300047317 Bacteria 705
536 Ga0495636_0621457 3300047318 Bacteria 529
537 Ga0495674_0000804 3300047319 Bacteria 29853
538 Ga0495674_0047043 3300047319 Bacteria 3827
539 Ga0495674_0476349 3300047319 Unclassified 1001
540 Ga0495676_0027244 3300047321 Bacteria 4903
541 Ga0495680_0025241 3300047322 Bacteria 4921
542 Ga0495680_0147541 3300047322 Bacteria 1717
543 Ga0495675_0084151 3300047444 Bacteria 2002
544 Ga0495675_0288194 3300047444 Bacteria 978
545 Ga0495675_0402791 3300047444 Bacteria 797
546 Ga0495684_0306500 3300047471 Bacteria 1139
547 Ga0495684_0446400 3300047471 Bacteria 900
548 Ga0495602_0656030 3300048088 Bacteria 716
549 Ga0496107_0463069 3300048910 Bacteria 941
550 Ga0496115_0047285 3300048918 Bacteria 3440
551 Ga0496115_0863250 3300048918 Bacteria 700
552 Ga0501031_0002393 3300049568 Bacteria 11921
553 Ga0501031_0015398 3300049568 Bacteria 4966
554 Ga0501032_0036615 3300049569 Bacteria 3349
555 Ga0501032_0054217 3300049569 Bacteria 2699
556 Ga0501033_0003744 3300049570 Bacteria 12364
557 Ga0501033_0151947 3300049570 Bacteria 1670
558 Ga0501033_0270137 3300049570 Bacteria 1202
559 Ga0501037_0690164 3300049573 Bacteria 680
560 Ga0501043_0097979 3300049579 Bacteria 2305
561 Ga0501043_1304500 3300049579 Bacteria 507
562 Ga0501046_0576848 3300049580 Bacteria 800
563 Ga0501047_0357830 3300049581 Bacteria 1296
564 Ga0501047_0443573 3300049581 Bacteria 1128
565 Ga0501080_0023318 3300049742 Bacteria 5738
566 Ga0501080_1006692 3300049742 Bacteria 723
567 Ga0501083_0190839 3300049744 Bacteria 1337
568 Ga0501035_0331669 3300049822 Bacteria 1276
569 Ga0501035_0438925 3300049822 Bacteria 1081
570 Ga0501044_0000125 3300049823 Bacteria 92969
571 Ga0501044_0157216 3300049823 Bacteria 2252
572 Ga0501044_0184778 3300049823 Bacteria 2050
573 Ga0501044_0565036 3300049823 Bacteria 1033
574 nmdc:mga06r32_35566_c1 3300050510 Bacteria 4699
575 nmdc:mga08y16_164891_c1 3300050511 Bacteria 2302
576 nmdc:mga08y16_622386_c1 3300050511 Bacteria 1086
577 nmdc:mga0n895_311913_c1 3300050512 Bacteria 1594
578 nmdc:mga0rr50_167380_c1 3300050513 Bacteria 1788
579 nmdc:mga08x19_264764_c1 3300050514 Bacteria 1189
580 Ga0495601_0118365 3300053077 Bacteria 1719
581 Ga0500650_0007717 3300053098 Bacteria 4213

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005530 Ga0070679_100143599 Ga0070679_1001435994 95
2 3300013104 Ga0157370_10051388 Ga0157370_100513882 95
3 3300006881 Ga0068865_101651208 Ga0068865_1016512081 99
4 3300025926 Ga0207659_11598040 Ga0207659_115980402 99
5 3300006844 Ga0075428_100003239 Ga0075428_1000032396 100
6 3300009094 Ga0111539_10004958 Ga0111539_100049583 100
7 3300028800 Ga0265338_10137665 Ga0265338_101376652 100
8 3300031240 Ga0265320_10182402 Ga0265320_101824022 100
9 3300041458 Ga0451798_0735027 Ga0451798_0735027_151_456 100
10 3300044712 Ga0453684_0000382 Ga0453684_0000382_37191_37493 100
11 3300050511 nmdc:mga08y16_164891_c1 nmdc:mga08y16_164891_c1_351_659 100
12 3300000545 CNXas_1002134 CNXas_10021343 101
13 3300005295 Ga0065707_10340233 Ga0065707_103402331 101
14 3300005327 Ga0070658_10802087 Ga0070658_108020872 101
15 3300005327 Ga0070658_10933391 Ga0070658_109333911 101
16 3300005329 Ga0070683_100240949 Ga0070683_1002409492 101
17 3300005330 Ga0070690_100340087 Ga0070690_1003400872 101
18 3300005330 Ga0070690_100784226 Ga0070690_1007842261 101
19 3300005331 Ga0070670_100787039 Ga0070670_1007870392 101
20 3300005333 Ga0070677_10212551 Ga0070677_102125512 101
21 3300005333 Ga0070677_10596111 Ga0070677_105961112 101
22 3300005334 Ga0068869_102072277 Ga0068869_1020722771 101
23 3300005335 Ga0070666_10011337 Ga0070666_100113373 101
24 3300005336 Ga0070680_100784055 Ga0070680_1007840552 101
25 3300005340 Ga0070689_100020023 Ga0070689_1000200235 101
26 3300005340 Ga0070689_100044621 Ga0070689_1000446215 101
27 3300005340 Ga0070689_100245345 Ga0070689_1002453452 101
28 3300005340 Ga0070689_100382224 Ga0070689_1003822242 101
29 3300005340 Ga0070689_100419399 Ga0070689_1004193992 101
30 3300005340 Ga0070689_100867040 Ga0070689_1008670402 101
31 3300005340 Ga0070689_101066437 Ga0070689_1010664372 101
32 3300005340 Ga0070689_102047811 Ga0070689_1020478111 101
33 3300005341 Ga0070691_10043530 Ga0070691_100435302 101
34 3300005341 Ga0070691_10343443 Ga0070691_103434432 101
35 3300005341 Ga0070691_10492401 Ga0070691_104924012 101
36 3300005343 Ga0070687_100406706 Ga0070687_1004067061 101
37 3300005343 Ga0070687_100916662 Ga0070687_1009166622 101
38 3300005356 Ga0070674_101741120 Ga0070674_1017411201 101
39 3300005365 Ga0070688_100176123 Ga0070688_1001761232 101
40 3300005365 Ga0070688_100244884 Ga0070688_1002448841 101
41 3300005365 Ga0070688_101073858 Ga0070688_1010738581 101
42 3300005365 Ga0070688_101183979 Ga0070688_1011839791 101
43 3300005365 Ga0070688_101251180 Ga0070688_1012511801 101
44 3300005366 Ga0070659_101522694 Ga0070659_1015226941 101
45 3300005434 Ga0070709_10656682 Ga0070709_106566822 101
46 3300005435 Ga0070714_100300146 Ga0070714_1003001462 101
47 3300005436 Ga0070713_100489960 Ga0070713_1004899602 101
48 3300005436 Ga0070713_100914350 Ga0070713_1009143501 101
49 3300005437 Ga0070710_10889577 Ga0070710_108895771 101
50 3300005439 Ga0070711_100317758 Ga0070711_1003177582 101
51 3300005439 Ga0070711_101075046 Ga0070711_1010750461 101
52 3300005439 Ga0070711_101946635 Ga0070711_1019466352 101
53 3300005440 Ga0070705_100044317 Ga0070705_1000443173 101
54 3300005440 Ga0070705_100072025 Ga0070705_1000720252 101
55 3300005440 Ga0070705_100165050 Ga0070705_1001650503 101
56 3300005441 Ga0070700_100217341 Ga0070700_1002173411 101
57 3300005441 Ga0070700_100541924 Ga0070700_1005419242 101
58 3300005444 Ga0070694_100363534 Ga0070694_1003635341 101
59 3300005445 Ga0070708_101803050 Ga0070708_1018030501 101
60 3300005445 Ga0070708_101987771 Ga0070708_1019877711 101
61 3300005456 Ga0070678_100984803 Ga0070678_1009848031 101
62 3300005458 Ga0070681_11638911 Ga0070681_116389112 101
63 3300005459 Ga0068867_100658930 Ga0068867_1006589302 101
64 3300005459 Ga0068867_101992778 Ga0068867_1019927782 101
65 3300005466 Ga0070685_10726668 Ga0070685_107266682 101
66 3300005466 Ga0070685_10927646 Ga0070685_109276461 101
67 3300005466 Ga0070685_10970877 Ga0070685_109708772 101
68 3300005466 Ga0070685_11064887 Ga0070685_110648872 101
69 3300005468 Ga0070707_101517758 Ga0070707_1015177581 101
70 3300005471 Ga0070698_101362798 Ga0070698_1013627981 101
71 3300005530 Ga0070679_100122690 Ga0070679_1001226902 101
72 3300005530 Ga0070679_100194328 Ga0070679_1001943282 101
73 3300005535 Ga0070684_100442919 Ga0070684_1004429193 101
74 3300005535 Ga0070684_100583023 Ga0070684_1005830232 101
75 3300005535 Ga0070684_102092582 Ga0070684_1020925822 101
76 3300005544 Ga0070686_100138195 Ga0070686_1001381953 101
77 3300005544 Ga0070686_100162157 Ga0070686_1001621572 101
78 3300005544 Ga0070686_100680752 Ga0070686_1006807521 101
79 3300005547 Ga0070693_101065905 Ga0070693_1010659052 101
80 3300005549 Ga0070704_100297165 Ga0070704_1002971652 101
81 3300005563 Ga0068855_100087596 Ga0068855_1000875962 101
82 3300005563 Ga0068855_100134319 Ga0068855_1001343192 101
83 3300005563 Ga0068855_100233000 Ga0068855_1002330002 101
84 3300005563 Ga0068855_102276872 Ga0068855_1022768722 101
85 3300005577 Ga0068857_100479935 Ga0068857_1004799352 101
86 3300005577 Ga0068857_101058347 Ga0068857_1010583472 101
87 3300005614 Ga0068856_100001472 Ga0068856_1000014727 101
88 3300005614 Ga0068856_100156059 Ga0068856_1001560592 101
89 3300005614 Ga0068856_100188235 Ga0068856_1001882353 101
90 3300005614 Ga0068856_100195917 Ga0068856_1001959171 101
91 3300005614 Ga0068856_100273763 Ga0068856_1002737633 101
92 3300005614 Ga0068856_102064366 Ga0068856_1020643662 101
93 3300005615 Ga0070702_101305404 Ga0070702_1013054041 101
94 3300005617 Ga0068859_100004968 Ga0068859_1000049686 101
95 3300005617 Ga0068859_100134529 Ga0068859_1001345292 101
96 3300005617 Ga0068859_100265873 Ga0068859_1002658733 101
97 3300005617 Ga0068859_102231001 Ga0068859_1022310012 101
98 3300005617 Ga0068859_102832364 Ga0068859_1028323641 101
99 3300005618 Ga0068864_100026221 Ga0068864_1000262214 101
100 3300005618 Ga0068864_102222992 Ga0068864_1022229922 101
101 3300005719 Ga0068861_101431017 Ga0068861_1014310172 101
102 3300005841 Ga0068863_100024694 Ga0068863_1000246945 101
103 3300005841 Ga0068863_100124594 Ga0068863_1001245941 101
104 3300005841 Ga0068863_100444383 Ga0068863_1004443831 101
105 3300005841 Ga0068863_100692705 Ga0068863_1006927052 101
106 3300005841 Ga0068863_102355954 Ga0068863_1023559542 101
107 3300005841 Ga0068863_102642182 Ga0068863_1026421821 101
108 3300005937 Ga0081455_10365903 Ga0081455_103659031 101
109 3300006028 Ga0070717_10566718 Ga0070717_105667182 101
110 3300006173 Ga0070716_101362899 Ga0070716_1013628992 101
111 3300006175 Ga0070712_101447006 Ga0070712_1014470062 101
112 3300006237 Ga0097621_100327109 Ga0097621_1003271092 101
113 3300006358 Ga0068871_101756438 Ga0068871_1017564382 101
114 3300006847 Ga0075431_100160575 Ga0075431_1001605752 101
115 3300006871 Ga0075434_100215256 Ga0075434_1002152563 101
116 3300006871 Ga0075434_101555871 Ga0075434_1015558712 101
117 3300006881 Ga0068865_101169670 Ga0068865_1011696702 101
118 3300006931 Ga0097620_100004968 Ga0097620_1000049686 101
119 3300006931 Ga0097620_100134526 Ga0097620_1001345262 101
120 3300006931 Ga0097620_100265877 Ga0097620_1002658773 101
121 3300006931 Ga0097620_102230650 Ga0097620_1022306501 101
122 3300006931 Ga0097620_102830959 Ga0097620_1028309591 101
123 3300007076 Ga0075435_100189564 Ga0075435_1001895644 101
124 3300007076 Ga0075435_100387961 Ga0075435_1003879612 101
125 3300007076 Ga0075435_101122376 Ga0075435_1011223761 101
126 3300007265 Ga0099794_10628155 Ga0099794_106281552 101
127 3300007788 Ga0099795_10438343 Ga0099795_104383432 101
128 3300009093 Ga0105240_10002292 Ga0105240_1000229218 101
129 3300009093 Ga0105240_10075008 Ga0105240_100750086 101
130 3300009093 Ga0105240_10275551 Ga0105240_102755513 101
131 3300009093 Ga0105240_10327190 Ga0105240_103271902 101
132 3300009093 Ga0105240_10355920 Ga0105240_103559202 101
133 3300009093 Ga0105240_10549536 Ga0105240_105495362 101
134 3300009094 Ga0111539_10553070 Ga0111539_105530702 101
135 3300009094 Ga0111539_10851994 Ga0111539_108519941 101
136 3300009098 Ga0105245_10384377 Ga0105245_103843773 101
137 3300009098 Ga0105245_11112250 Ga0105245_111122502 101
138 3300009098 Ga0105245_12417309 Ga0105245_124173092 101
139 3300009147 Ga0114129_11393681 Ga0114129_113936812 101
140 3300009147 Ga0114129_13381760 Ga0114129_133817601 101
141 3300009174 Ga0105241_11173988 Ga0105241_111739881 101
142 3300009176 Ga0105242_10365668 Ga0105242_103656682 101
143 3300009176 Ga0105242_10955328 Ga0105242_109553282 101
144 3300009176 Ga0105242_11608342 Ga0105242_116083422 101
145 3300009177 Ga0105248_11013986 Ga0105248_110139862 101
146 3300009177 Ga0105248_11439820 Ga0105248_114398202 101
147 3300009177 Ga0105248_11506857 Ga0105248_115068572 101
148 3300009545 Ga0105237_10519599 Ga0105237_105195992 101
149 3300009551 Ga0105238_10019653 Ga0105238_100196533 101
150 3300009551 Ga0105238_10024440 Ga0105238_100244402 101
151 3300009551 Ga0105238_10110124 Ga0105238_101101243 101
152 3300009551 Ga0105238_10378912 Ga0105238_103789121 101
153 3300009553 Ga0105249_11325990 Ga0105249_113259902 101
154 3300009553 Ga0105249_11757359 Ga0105249_117573592 101
155 3300013105 Ga0157369_12547985 Ga0157369_125479852 101
156 3300013296 Ga0157374_10264923 Ga0157374_102649232 101
157 3300013296 Ga0157374_10343348 Ga0157374_103433482 101
158 3300013297 Ga0157378_11527480 Ga0157378_115274802 101
159 3300013297 Ga0157378_12856588 Ga0157378_128565882 101
160 3300013306 Ga0163162_11284802 Ga0163162_112848021 101
161 3300013306 Ga0163162_11792829 Ga0163162_117928291 101
162 3300013307 Ga0157372_10547801 Ga0157372_105478012 101
163 3300013307 Ga0157372_10621504 Ga0157372_106215042 101
164 3300013307 Ga0157372_10770192 Ga0157372_107701922 101
165 3300013308 Ga0157375_10000086 Ga0157375_1000008670 101
166 3300013308 Ga0157375_10854998 Ga0157375_108549982 101
167 3300013308 Ga0157375_12222821 Ga0157375_122228211 101
168 3300014325 Ga0163163_10019087 Ga0163163_100190876 101
169 3300014325 Ga0163163_10437443 Ga0163163_104374432 101
170 3300014326 Ga0157380_11060780 Ga0157380_110607802 101
171 3300014968 Ga0157379_10383658 Ga0157379_103836582 101
172 3300014968 Ga0157379_11150987 Ga0157379_111509872 101
173 3300025893 Ga0207682_10189019 Ga0207682_101890192 101
174 3300025898 Ga0207692_10666290 Ga0207692_106662901 101
175 3300025903 Ga0207680_10068302 Ga0207680_100683024 101
176 3300025906 Ga0207699_10583542 Ga0207699_105835422 101
177 3300025909 Ga0207705_10351738 Ga0207705_103517382 101
178 3300025909 Ga0207705_10662747 Ga0207705_106627472 101
179 3300025913 Ga0207695_10025957 Ga0207695_100259572 101
180 3300025913 Ga0207695_10028567 Ga0207695_100285674 101
181 3300025913 Ga0207695_10253737 Ga0207695_102537373 101
182 3300025913 Ga0207695_10255476 Ga0207695_102554762 101
183 3300025913 Ga0207695_10371505 Ga0207695_103715051 101
184 3300025913 Ga0207695_10379811 Ga0207695_103798113 101
185 3300025916 Ga0207663_10001010 Ga0207663_100010103 101
186 3300025916 Ga0207663_10316654 Ga0207663_103166542 101
187 3300025916 Ga0207663_10837264 Ga0207663_108372642 101
188 3300025918 Ga0207662_10194547 Ga0207662_101945472 101
189 3300025919 Ga0207657_11077041 Ga0207657_110770412 101
190 3300025921 Ga0207652_10245481 Ga0207652_102454812 101
191 3300025921 Ga0207652_10312673 Ga0207652_103126733 101
192 3300025924 Ga0207694_10028210 Ga0207694_100282103 101
193 3300025924 Ga0207694_10067143 Ga0207694_100671433 101
194 3300025924 Ga0207694_10071433 Ga0207694_100714333 101
195 3300025925 Ga0207650_10581199 Ga0207650_105811992 101
196 3300025927 Ga0207687_10793602 Ga0207687_107936022 101
197 3300025928 Ga0207700_11833712 Ga0207700_118337122 101
198 3300025934 Ga0207686_10638785 Ga0207686_106387852 101
199 3300025936 Ga0207670_10015941 Ga0207670_100159412 101
200 3300025936 Ga0207670_10114746 Ga0207670_101147462 101
201 3300025936 Ga0207670_10150449 Ga0207670_101504493 101
202 3300025936 Ga0207670_10178956 Ga0207670_101789563 101
203 3300025936 Ga0207670_10209307 Ga0207670_102093071 101
204 3300025936 Ga0207670_10303432 Ga0207670_103034322 101
205 3300025936 Ga0207670_10543860 Ga0207670_105438602 101
206 3300025936 Ga0207670_10598088 Ga0207670_105980882 101
207 3300025936 Ga0207670_10926646 Ga0207670_109266462 101
208 3300025936 Ga0207670_11093391 Ga0207670_110933912 101
209 3300025938 Ga0207704_10867994 Ga0207704_108679942 101
210 3300025941 Ga0207711_10785402 Ga0207711_107854022 101
211 3300025942 Ga0207689_11699845 Ga0207689_116998451 101
212 3300025949 Ga0207667_10051360 Ga0207667_100513605 101
213 3300025949 Ga0207667_10258381 Ga0207667_102583813 101
214 3300025949 Ga0207667_10483029 Ga0207667_104830292 101
215 3300025949 Ga0207667_11616996 Ga0207667_116169962 101
216 3300025960 Ga0207651_11309888 Ga0207651_113098882 101
217 3300025961 Ga0207712_10593548 Ga0207712_105935482 101
218 3300026041 Ga0207639_10762182 Ga0207639_107621822 101
219 3300026075 Ga0207708_10999313 Ga0207708_109993132 101
220 3300026078 Ga0207702_10002049 Ga0207702_1000204911 101
221 3300026078 Ga0207702_10011792 Ga0207702_100117923 101
222 3300026078 Ga0207702_10173900 Ga0207702_101739002 101
223 3300026078 Ga0207702_11260282 Ga0207702_112602821 101
224 3300026088 Ga0207641_10018189 Ga0207641_100181893 101
225 3300026088 Ga0207641_11147895 Ga0207641_111478952 101
226 3300026089 Ga0207648_10200676 Ga0207648_102006762 101
227 3300026095 Ga0207676_10970556 Ga0207676_109705562 101
228 3300026116 Ga0207674_10300018 Ga0207674_103000182 101
229 3300026116 Ga0207674_10632239 Ga0207674_106322391 101
230 3300026118 Ga0207675_101302608 Ga0207675_1013026081 101
231 3300026121 Ga0207683_10493150 Ga0207683_104931502 101
232 3300026121 Ga0207683_11402734 Ga0207683_114027342 101
233 3300027671 Ga0209588_1263695 Ga0209588_12636951 101
234 3300028380 Ga0268265_11797707 Ga0268265_117977072 101
235 3300028380 Ga0268265_12039520 Ga0268265_120395202 101
236 3300028381 Ga0268264_11577944 Ga0268264_115779441 101
237 3300028556 Ga0265337_1000140 Ga0265337_100014014 101
238 3300028556 Ga0265337_1000920 Ga0265337_10009205 101
239 3300028556 Ga0265337_1004569 Ga0265337_10045692 101
240 3300028556 Ga0265337_1007544 Ga0265337_10075443 101
241 3300028556 Ga0265337_1009032 Ga0265337_10090323 101
242 3300028556 Ga0265337_1020782 Ga0265337_10207822 101
243 3300028556 Ga0265337_1055732 Ga0265337_10557322 101
244 3300028556 Ga0265337_1085897 Ga0265337_10858972 101
245 3300028556 Ga0265337_1105318 Ga0265337_11053182 101
246 3300028558 Ga0265326_10051322 Ga0265326_100513222 101
247 3300028558 Ga0265326_10099858 Ga0265326_100998581 101
248 3300028558 Ga0265326_10103142 Ga0265326_101031422 101
249 3300028558 Ga0265326_10124954 Ga0265326_101249542 101
250 3300028558 Ga0265326_10167869 Ga0265326_101678691 101
251 3300028563 Ga0265319_1000007 Ga0265319_1000007103 101
252 3300028563 Ga0265319_1003681 Ga0265319_10036817 101
253 3300028563 Ga0265319_1011822 Ga0265319_10118222 101
254 3300028563 Ga0265319_1167746 Ga0265319_11677462 101
255 3300028563 Ga0265319_1169444 Ga0265319_11694441 101
256 3300028573 Ga0265334_10021782 Ga0265334_100217824 101
257 3300028573 Ga0265334_10064430 Ga0265334_100644302 101
258 3300028577 Ga0265318_10035245 Ga0265318_100352453 101
259 3300028577 Ga0265318_10045073 Ga0265318_100450732 101
260 3300028577 Ga0265318_10315353 Ga0265318_103153531 101
261 3300028653 Ga0265323_10000237 Ga0265323_1000023721 101
262 3300028653 Ga0265323_10026728 Ga0265323_100267282 101
263 3300028653 Ga0265323_10030725 Ga0265323_100307252 101
264 3300028653 Ga0265323_10077387 Ga0265323_100773872 101
265 3300028654 Ga0265322_10001686 Ga0265322_100016866 101
266 3300028654 Ga0265322_10044124 Ga0265322_100441243 101
267 3300028654 Ga0265322_10063228 Ga0265322_100632282 101
268 3300028654 Ga0265322_10101086 Ga0265322_101010862 101
269 3300028666 Ga0265336_10006142 Ga0265336_100061423 101
270 3300028666 Ga0265336_10016947 Ga0265336_100169474 101
271 3300028666 Ga0265336_10036849 Ga0265336_100368493 101
272 3300028666 Ga0265336_10073420 Ga0265336_100734202 101
273 3300028666 Ga0265336_10095956 Ga0265336_100959562 101
274 3300028666 Ga0265336_10213733 Ga0265336_102137332 101
275 3300028800 Ga0265338_10000431 Ga0265338_1000043118 101
276 3300028800 Ga0265338_10001555 Ga0265338_1000155524 101
277 3300028800 Ga0265338_10008592 Ga0265338_100085928 101
278 3300028800 Ga0265338_10009353 Ga0265338_1000935312 101
279 3300028800 Ga0265338_10010919 Ga0265338_100109198 101
280 3300028800 Ga0265338_10011481 Ga0265338_100114813 101
281 3300028800 Ga0265338_10013859 Ga0265338_1001385910 101
282 3300028800 Ga0265338_10014147 Ga0265338_100141473 101
283 3300028800 Ga0265338_10019255 Ga0265338_100192554 101
284 3300028800 Ga0265338_10021384 Ga0265338_100213843 101
285 3300028800 Ga0265338_10024132 Ga0265338_100241323 101
286 3300028800 Ga0265338_10027437 Ga0265338_100274374 101
287 3300028800 Ga0265338_10032402 Ga0265338_100324021 101
288 3300028800 Ga0265338_10045342 Ga0265338_100453423 101
289 3300028800 Ga0265338_10052571 Ga0265338_100525713 101
290 3300028800 Ga0265338_10076720 Ga0265338_100767203 101
291 3300028800 Ga0265338_10193904 Ga0265338_101939042 101
292 3300028800 Ga0265338_10233317 Ga0265338_102333173 101
293 3300028800 Ga0265338_10334064 Ga0265338_103340642 101
294 3300028800 Ga0265338_10387676 Ga0265338_103876761 101
295 3300028800 Ga0265338_10416422 Ga0265338_104164222 101
296 3300028800 Ga0265338_10437016 Ga0265338_104370162 101
297 3300028800 Ga0265338_10479050 Ga0265338_104790501 101
298 3300028800 Ga0265338_10711517 Ga0265338_107115172 101
299 3300028800 Ga0265338_10758404 Ga0265338_107584042 101
300 3300028800 Ga0265338_10782530 Ga0265338_107825302 101
301 3300029957 Ga0265324_10002329 Ga0265324_100023295 101
302 3300029957 Ga0265324_10015253 Ga0265324_100152533 101
303 3300029957 Ga0265324_10015285 Ga0265324_100152852 101
304 3300029957 Ga0265324_10019169 Ga0265324_100191691 101
305 3300029957 Ga0265324_10019506 Ga0265324_100195063 101
306 3300029957 Ga0265324_10034697 Ga0265324_100346972 101
307 3300029957 Ga0265324_10039188 Ga0265324_100391883 101
308 3300029957 Ga0265324_10067478 Ga0265324_100674783 101
309 3300029957 Ga0265324_10143451 Ga0265324_101434512 101
310 3300029957 Ga0265324_10170240 Ga0265324_101702402 101
311 3300030521 Ga0307511_10125600 Ga0307511_101256003 101
312 3300031235 Ga0265330_10030858 Ga0265330_100308582 101
313 3300031238 Ga0265332_10199062 Ga0265332_101990622 101
314 3300031240 Ga0265320_10000188 Ga0265320_1000018819 101
315 3300031240 Ga0265320_10003925 Ga0265320_100039255 101
316 3300031240 Ga0265320_10004415 Ga0265320_100044153 101
317 3300031240 Ga0265320_10011472 Ga0265320_100114724 101
318 3300031240 Ga0265320_10048479 Ga0265320_100484793 101
319 3300031240 Ga0265320_10094740 Ga0265320_100947403 101
320 3300031240 Ga0265320_10256439 Ga0265320_102564392 101
321 3300031240 Ga0265320_10449597 Ga0265320_104495972 101
322 3300031241 Ga0265325_10023559 Ga0265325_100235593 101
323 3300031241 Ga0265325_10050609 Ga0265325_100506092 101
324 3300031241 Ga0265325_10312137 Ga0265325_103121372 101
325 3300031242 Ga0265329_10109577 Ga0265329_101095772 101
326 3300031247 Ga0265340_10058985 Ga0265340_100589854 101
327 3300031247 Ga0265340_10069957 Ga0265340_100699572 101
328 3300031247 Ga0265340_10433150 Ga0265340_104331502 101
329 3300031249 Ga0265339_10017090 Ga0265339_100170904 101
330 3300031249 Ga0265339_10199786 Ga0265339_101997862 101
331 3300031250 Ga0265331_10077949 Ga0265331_100779492 101
332 3300031250 Ga0265331_10182628 Ga0265331_101826282 101
333 3300031251 Ga0265327_10000752 Ga0265327_1000075223 101
334 3300031251 Ga0265327_10008595 Ga0265327_100085954 101
335 3300031251 Ga0265327_10230600 Ga0265327_102306001 101
336 3300031344 Ga0265316_10006885 Ga0265316_100068852 101
337 3300031344 Ga0265316_10009696 Ga0265316_100096965 101
338 3300031344 Ga0265316_10010502 Ga0265316_100105025 101
339 3300031344 Ga0265316_10010930 Ga0265316_100109302 101
340 3300031344 Ga0265316_10066910 Ga0265316_100669102 101
341 3300031344 Ga0265316_10079893 Ga0265316_100798932 101
342 3300031344 Ga0265316_10147414 Ga0265316_101474142 101
343 3300031344 Ga0265316_10213115 Ga0265316_102131152 101
344 3300031344 Ga0265316_10268736 Ga0265316_102687362 101
345 3300031595 Ga0265313_10001008 Ga0265313_1000100816 101
346 3300031595 Ga0265313_10012570 Ga0265313_100125703 101
347 3300031595 Ga0265313_10131179 Ga0265313_101311792 101
348 3300031711 Ga0265314_10024198 Ga0265314_100241983 101
349 3300031711 Ga0265314_10043005 Ga0265314_100430054 101
350 3300031711 Ga0265314_10248883 Ga0265314_102488833 101
351 3300031711 Ga0265314_10618729 Ga0265314_106187291 101
352 3300031711 Ga0265314_10687799 Ga0265314_106877991 101
353 3300031712 Ga0265342_10055412 Ga0265342_100554122 101
354 3300031712 Ga0265342_10362426 Ga0265342_103624262 101
355 3300031712 Ga0265342_10432801 Ga0265342_104328012 101
356 3300031712 Ga0265342_10459597 Ga0265342_104595971 101
357 3300031727 Ga0316576_10670239 Ga0316576_106702391 101
358 3300032137 Ga0316585_10075010 Ga0316585_100750102 101
359 3300034816 Ga0373930_0000589 Ga0373930_0000589_402_707 101
360 3300034817 Ga0373948_0115770 Ga0373948_0115770_147_452 101
361 3300034818 Ga0373950_0009528 Ga0373950_0009528_452_757 101
362 3300034819 Ga0373958_0143320 Ga0373958_0143320_114_419 101
363 3300035083 Ga0373926_0298641 Ga0373926_0298641_206_511 101
364 3300035084 Ga0373928_0000124 Ga0373928_0000124_13201_13506 101
365 3300035085 Ga0373929_0002245 Ga0373929_0002245_2565_2870 101
366 3300035086 Ga0373934_0313006 Ga0373934_0313006_253_558 101
367 3300035088 Ga0373940_0002420 Ga0373940_0002420_182_487 101
368 3300035089 Ga0373944_0005149 Ga0373944_0005149_1027_1332 101
369 3300035090 Ga0373949_0002141 Ga0373949_0002141_1657_1962 101
370 3300035090 Ga0373949_0286782 Ga0373949_0286782_58_363 101
371 3300035091 Ga0373951_0004091 Ga0373951_0004091_543_848 101
372 3300035091 Ga0373951_0047262 Ga0373951_0047262_589_897 101
373 3300035111 Ga0373923_0250547 Ga0373923_0250547_319_624 101
374 3300035112 Ga0373932_0000001 Ga0373932_0000001_1148127_1148432 101
375 3300035114 Ga0373939_0169406 Ga0373939_0169406_292_597 101
376 3300035116 Ga0373945_0035902 Ga0373945_0035902_453_758 101
377 3300035117 Ga0373953_0228589 Ga0373953_0228589_238_543 101
378 3300035118 Ga0373954_0239919 Ga0373954_0239919_155_460 101
379 3300035119 Ga0373956_0005667 Ga0373956_0005667_105_410 101
380 3300035120 Ga0373957_0473886 Ga0373957_0473886_92_397 101
381 3300035171 Ga0373946_0075615 Ga0373946_0075615_1086_1391 101
382 3300035171 Ga0373946_0156698 Ga0373946_0156698_394_699 101
383 3300035172 Ga0373955_0744331 Ga0373955_0744331_145_450 101
384 3300035207 Ga0373942_0185163 Ga0373942_0185163_258_563 101
385 3300035242 Ga0373962_0000018 Ga0373962_0000018_36336_36641 101
386 3300035398 Ga0316574_0304294 Ga0316574_0304294_182_487 101
387 3300035691 Ga0373931_0000002 Ga0373931_0000002_346966_347271 101
388 3300035692 Ga0373935_0003342 Ga0373935_0003342_6538_6843 101
389 3300035692 Ga0373935_0104655 Ga0373935_0104655_264_569 101
390 3300035695 Ga0373927_0002183 Ga0373927_0002183_2219_2524 101
391 3300035695 Ga0373927_0032231 Ga0373927_0032231_49_354 101
392 3300035695 Ga0373927_0036781 Ga0373927_0036781_769_1074 101
393 3300035695 Ga0373927_0929953 Ga0373927_0929953_155_460 101
394 3300035724 Ga0373933_0200470 Ga0373933_0200470_823_1128 101
395 3300035725 Ga0373947_0121838 Ga0373947_0121838_1228_1533 101
396 3300035725 Ga0373947_0175980 Ga0373947_0175980_794_1099 101
397 3300036401 Ga0373937_0001956 Ga0373937_0001956_14455_14760 101
398 3300036401 Ga0373937_0176416 Ga0373937_0176416_1545_1850 101
399 3300036401 Ga0373937_0289399 Ga0373937_0289399_1024_1329 101
400 3300036401 Ga0373937_1897835 Ga0373937_1897835_174_482 101
401 3300036647 Ga0316582_0411437 Ga0316582_0411437_168_473 101
402 3300036712 Ga0316584_0391748 Ga0316584_0391748_128_433 101
403 3300037068 Ga0373925_0000272 Ga0373925_0000272_12960_13265 101
404 3300037068 Ga0373925_0000552 Ga0373925_0000552_14605_14910 101
405 3300037068 Ga0373925_0479213 Ga0373925_0479213_82_387 101
406 3300037068 Ga0373925_0705058 Ga0373925_0705058_37_342 101
407 3300037068 Ga0373925_1262262 Ga0373925_1262262_158_463 101
408 3300041452 Ga0451793_1237591 Ga0451793_1237591_57_362 101
409 3300041452 Ga0451793_1754102 Ga0451793_1754102_637_945 101
410 3300041463 Ga0451804_0855333 Ga0451804_0855333_511_816 101
411 3300041486 Ga0451807_1698768 Ga0451807_1698768_136_441 101
412 3300041492 Ga0451835_1202569 Ga0451835_1202569_368_676 101
413 3300041507 Ga0451851_0359195 Ga0451851_0359195_274_582 101
414 3300042876 Ga0451577_0022868 Ga0451577_0022868_4994_5299 101
415 3300042876 Ga0451577_0454120 Ga0451577_0454120_160_465 101
416 3300042876 Ga0451577_0519599 Ga0451577_0519599_16_321 101
417 3300042876 Ga0451577_0528200 Ga0451577_0528200_645_950 101
418 3300042876 Ga0451577_1006692 Ga0451577_1006692_297_602 101
419 3300042876 Ga0451577_1935628 Ga0451577_1935628_57_362 101
420 3300044712 Ga0453684_0042720 Ga0453684_0042720_2927_3232 101
421 3300044712 Ga0453684_0181132 Ga0453684_0181132_797_1102 101
422 3300044712 Ga0453684_0183568 Ga0453684_0183568_400_705 101
423 3300044712 Ga0453684_0508984 Ga0453684_0508984_561_866 101
424 3300044712 Ga0453684_0539021 Ga0453684_0539021_738_1043 101
425 3300044712 Ga0453684_1082216 Ga0453684_1082216_374_679 101
426 3300044712 Ga0453684_1483298 Ga0453684_1483298_100_405 101
427 3300044712 Ga0453684_1513850 Ga0453684_1513850_229_537 101
428 3300045051 Ga0451576_0055495 Ga0451576_0055495_2314_2619 101
429 3300045051 Ga0451576_0128791 Ga0451576_0128791_2273_2578 101
430 3300045051 Ga0451576_0152496 Ga0451576_0152496_211_516 101
431 3300045051 Ga0451576_0242441 Ga0451576_0242441_517_822 101
432 3300045051 Ga0451576_0267301 Ga0451576_0267301_1378_1683 101
433 3300045051 Ga0451576_0271525 Ga0451576_0271525_1436_1741 101
434 3300045051 Ga0451576_0292562 Ga0451576_0292562_912_1217 101
435 3300045051 Ga0451576_0397458 Ga0451576_0397458_246_551 101
436 3300045051 Ga0451576_0414709 Ga0451576_0414709_1033_1338 101
437 3300045051 Ga0451576_0460641 Ga0451576_0460641_61_366 101
438 3300045051 Ga0451576_1076366 Ga0451576_1076366_368_673 101
439 3300045051 Ga0451576_1123499 Ga0451576_1123499_357_662 101
440 3300045051 Ga0451576_1145526 Ga0451576_1145526_204_509 101
441 3300045051 Ga0451576_1178293 Ga0451576_1178293_364_669 101
442 3300045051 Ga0451576_1288547 Ga0451576_1288547_103_408 101
443 3300045051 Ga0451576_1394800 Ga0451576_1394800_243_548 101
444 3300045051 Ga0451576_1418583 Ga0451576_1418583_54_359 101
445 3300046454 Ga0495592_0257417 Ga0495592_0257417_190_495 101
446 3300046454 Ga0495592_0941057 Ga0495592_0941057_172_477 101
447 3300046459 Ga0495629_0057947 Ga0495629_0057947_531_836 101
448 3300046459 Ga0495629_0116292 Ga0495629_0116292_1212_1517 101
449 3300046461 Ga0495641_0421790 Ga0495641_0421790_87_392 101
450 3300046462 Ga0495651_0217288 Ga0495651_0217288_754_1059 101
451 3300046462 Ga0495651_0564197 Ga0495651_0564197_137_442 101
452 3300046463 Ga0495653_0578664 Ga0495653_0578664_48_353 101
453 3300046463 Ga0495653_0980169 Ga0495653_0980169_73_378 101
454 3300046473 Ga0495582_0014639 Ga0495582_0014639_960_1265 101
455 3300046475 Ga0495639_0050410 Ga0495639_0050410_219_524 101
456 3300046476 Ga0495662_0206451 Ga0495662_0206451_358_663 101
457 3300046477 Ga0495664_0722600 Ga0495664_0722600_252_557 101
458 3300046511 Ga0495608_0494945 Ga0495608_0494945_184_489 101
459 3300046514 Ga0495618_0007045 Ga0495618_0007045_1807_2112 101
460 3300046514 Ga0495618_0503619 Ga0495618_0503619_233_538 101
461 3300046514 Ga0495618_0532837 Ga0495618_0532837_281_586 101
462 3300046516 Ga0495628_0221748 Ga0495628_0221748_341_646 101
463 3300046516 Ga0495628_0280391 Ga0495628_0280391_234_539 101
464 3300046517 Ga0495630_0000191 Ga0495630_0000191_35453_35758 101
465 3300046517 Ga0495630_0048171 Ga0495630_0048171_479_784 101
466 3300046517 Ga0495630_0163882 Ga0495630_0163882_1099_1407 101
467 3300046517 Ga0495630_0398941 Ga0495630_0398941_643_951 101
468 3300046517 Ga0495630_0565100 Ga0495630_0565100_509_814 101
469 3300046517 Ga0495630_0875101 Ga0495630_0875101_321_626 101
470 3300046526 Ga0495666_0038069 Ga0495666_0038069_1787_2092 101
471 3300046526 Ga0495666_0089250 Ga0495666_0089250_267_572 101
472 3300046526 Ga0495666_0456908 Ga0495666_0456908_27_332 101
473 3300046526 Ga0495666_0474489 Ga0495666_0474489_207_512 101
474 3300046529 Ga0495652_0104627 Ga0495652_0104627_990_1295 101
475 3300046529 Ga0495652_0416786 Ga0495652_0416786_617_922 101
476 3300046529 Ga0495652_0607032 Ga0495652_0607032_315_623 101
477 3300046531 Ga0495665_0371006 Ga0495665_0371006_45_350 101
478 3300046533 Ga0495640_0039591 Ga0495640_0039591_861_1166 101
479 3300046533 Ga0495640_0400436 Ga0495640_0400436_180_485 101
480 3300046533 Ga0495640_0656898 Ga0495640_0656898_286_591 101
481 3300046535 Ga0495586_0000113 Ga0495586_0000113_12693_12998 101
482 3300046535 Ga0495586_0000762 Ga0495586_0000762_5009_5314 101
483 3300046535 Ga0495586_0132552 Ga0495586_0132552_76_381 101
484 3300046535 Ga0495586_0429961 Ga0495586_0429961_130_438 101
485 3300046535 Ga0495586_0505149 Ga0495586_0505149_343_648 101
486 3300046535 Ga0495586_0603991 Ga0495586_0603991_177_482 101
487 3300046535 Ga0495586_0719579 Ga0495586_0719579_13_318 101
488 3300046536 Ga0495587_0094429 Ga0495587_0094429_1282_1590 101
489 3300046536 Ga0495587_0329809 Ga0495587_0329809_474_779 101
490 3300046536 Ga0495587_0720489 Ga0495587_0720489_138_443 101
491 3300046536 Ga0495587_0822743 Ga0495587_0822743_37_342 101
492 3300046537 Ga0495598_0456914 Ga0495598_0456914_44_349 101
493 3300046543 Ga0495645_0346487 Ga0495645_0346487_474_779 101
494 3300046543 Ga0495645_0792406 Ga0495645_0792406_63_368 101
495 3300046543 Ga0495645_0854282 Ga0495645_0854282_98_403 101
496 3300046557 Ga0495622_0071719 Ga0495622_0071719_985_1290 101
497 3300046559 Ga0495667_0188726 Ga0495667_0188726_237_542 101
498 3300046559 Ga0495667_0643235 Ga0495667_0643235_115_420 101
499 3300046642 Ga0495634_0003404 Ga0495634_0003404_407_712 101
500 3300046642 Ga0495634_0035539 Ga0495634_0035539_255_560 101
501 3300046642 Ga0495634_0325725 Ga0495634_0325725_373_678 101
502 3300046663 Ga0495635_0137607 Ga0495635_0137607_499_807 101
503 3300046663 Ga0495635_0746684 Ga0495635_0746684_245_553 101
504 3300046663 Ga0495635_0751319 Ga0495635_0751319_280_585 101
505 3300046663 Ga0495635_0758668 Ga0495635_0758668_208_513 101
506 3300046674 Ga0495588_0260492 Ga0495588_0260492_400_708 101
507 3300046678 Ga0495599_0176526 Ga0495599_0176526_476_781 101
508 3300046681 Ga0495647_0007529 Ga0495647_0007529_1770_2075 101
509 3300046681 Ga0495647_0416399 Ga0495647_0416399_292_600 101
510 3300046683 Ga0495658_0050999 Ga0495658_0050999_1392_1697 101
511 3300046683 Ga0495658_1106817 Ga0495658_1106817_118_423 101
512 3300046689 Ga0495613_0015524 Ga0495613_0015524_2979_3284 101
513 3300046689 Ga0495613_0046614 Ga0495613_0046614_1589_1894 101
514 3300046689 Ga0495613_0073050 Ga0495613_0073050_118_423 101
515 3300046689 Ga0495613_0144254 Ga0495613_0144254_113_418 101
516 3300046689 Ga0495613_0190604 Ga0495613_0190604_629_934 101
517 3300046690 Ga0495624_0058784 Ga0495624_0058784_1109_1414 101
518 3300046809 Ga0495600_0294514 Ga0495600_0294514_540_845 101
519 3300046809 Ga0495600_0458257 Ga0495600_0458257_88_393 101
520 3300046809 Ga0495600_0632823 Ga0495600_0632823_212_517 101
521 3300047315 Ga0495581_0300341 Ga0495581_0300341_280_585 101
522 3300047315 Ga0495581_0492685 Ga0495581_0492685_373_678 101
523 3300047315 Ga0495581_0769378 Ga0495581_0769378_15_320 101
524 3300047317 Ga0495604_0174104 Ga0495604_0174104_427_732 101
525 3300047317 Ga0495604_0601547 Ga0495604_0601547_303_608 101
526 3300047318 Ga0495636_0621457 Ga0495636_0621457_132_440 101
527 3300047319 Ga0495674_0000804 Ga0495674_0000804_29074_29379 101
528 3300047319 Ga0495674_0047043 Ga0495674_0047043_2740_3045 101
529 3300047319 Ga0495674_0476349 Ga0495674_0476349_503_808 101
530 3300047321 Ga0495676_0027244 Ga0495676_0027244_4359_4664 101
531 3300047322 Ga0495680_0025241 Ga0495680_0025241_4377_4682 101
532 3300047322 Ga0495680_0147541 Ga0495680_0147541_1027_1332 101
533 3300047444 Ga0495675_0084151 Ga0495675_0084151_407_715 101
534 3300047444 Ga0495675_0288194 Ga0495675_0288194_410_715 101
535 3300047471 Ga0495684_0306500 Ga0495684_0306500_486_791 101
536 3300047471 Ga0495684_0446400 Ga0495684_0446400_379_684 101
537 3300048088 Ga0495602_0656030 Ga0495602_0656030_187_495 101
538 3300048910 Ga0496107_0463069 Ga0496107_0463069_253_561 101
539 3300048918 Ga0496115_0047285 Ga0496115_0047285_1092_1400 101
540 3300048918 Ga0496115_0863250 Ga0496115_0863250_52_357 101
541 3300049568 Ga0501031_0002393 Ga0501031_0002393_1172_1477 101
542 3300049568 Ga0501031_0015398 Ga0501031_0015398_463_768 101
543 3300049569 Ga0501032_0036615 Ga0501032_0036615_1649_1954 101
544 3300049569 Ga0501032_0054217 Ga0501032_0054217_92_397 101
545 3300049570 Ga0501033_0003744 Ga0501033_0003744_961_1266 101
546 3300049570 Ga0501033_0151947 Ga0501033_0151947_1108_1413 101
547 3300049570 Ga0501033_0270137 Ga0501033_0270137_45_350 101
548 3300049573 Ga0501037_0690164 Ga0501037_0690164_269_574 101
549 3300049579 Ga0501043_0097979 Ga0501043_0097979_1101_1406 101
550 3300049579 Ga0501043_1304500 Ga0501043_1304500_102_407 101
551 3300049580 Ga0501046_0576848 Ga0501046_0576848_439_744 101
552 3300049581 Ga0501047_0357830 Ga0501047_0357830_922_1227 101
553 3300049581 Ga0501047_0443573 Ga0501047_0443573_128_433 101
554 3300049742 Ga0501080_0023318 Ga0501080_0023318_75_380 101
555 3300049742 Ga0501080_1006692 Ga0501080_1006692_192_497 101
556 3300049744 Ga0501083_0190839 Ga0501083_0190839_834_1139 101
557 3300049822 Ga0501035_0331669 Ga0501035_0331669_757_1062 101
558 3300049822 Ga0501035_0438925 Ga0501035_0438925_664_969 101
559 3300049823 Ga0501044_0000125 Ga0501044_0000125_66191_66496 101
560 3300049823 Ga0501044_0157216 Ga0501044_0157216_1909_2214 101
561 3300049823 Ga0501044_0184778 Ga0501044_0184778_1261_1566 101
562 3300049823 Ga0501044_0565036 Ga0501044_0565036_286_591 101
563 3300050510 nmdc:mga06r32_35566_c1 nmdc:mga06r32_35566_c1_2740_3045 101
564 3300050511 nmdc:mga08y16_622386_c1 nmdc:mga08y16_622386_c1_396_701 101
565 3300050512 nmdc:mga0n895_311913_c1 nmdc:mga0n895_311913_c1_600_905 101
566 3300050513 nmdc:mga0rr50_167380_c1 nmdc:mga0rr50_167380_c1_228_536 101
567 3300050514 nmdc:mga08x19_264764_c1 nmdc:mga08x19_264764_c1_533_838 101
568 3300053077 Ga0495601_0118365 Ga0495601_0118365_238_543 101
569 3300053098 Ga0500650_0007717 Ga0500650_0007717_3784_4089 101
570 3300028666 Ga0265336_10142212 Ga0265336_101422122 102
571 3300028800 Ga0265338_10048780 Ga0265338_100487803 102
572 3300047444 Ga0495675_0402791 Ga0495675_0402791_330_638 102
573 3300046517 Ga0495630_0753295 Ga0495630_0753295_130_477 103
574 3300046535 Ga0495586_0359376 Ga0495586_0359376_221_574 103
575 3300046535 Ga0495586_0567179 Ga0495586_0567179_205_552 103
576 2162886012 MBSR1b_contig_12717097 MBSR1b_0196.00004550 104
577 3300005440 Ga0070705_100287343 Ga0070705_1002873432 104
578 3300005471 Ga0070698_101383762 Ga0070698_1013837621 104
579 3300005549 Ga0070704_101292066 Ga0070704_1012920661 104
580 3300005843 Ga0068860_100844683 Ga0068860_1008446832 104
581 3300027876 Ga0209974_10157399 Ga0209974_101573991 104

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00420

Oxidored_q2

NADH-ubiquinone/plastoquinone oxidoreductase chain 4L

7

102

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rai-assembly1.cif.gz_B the px-bar membrane remodeling unit of sorting nexin 9 0.8182 7 53
7d3u-assembly1.cif.gz_F structure of mrp complex from dietzia sp. dq12-45-1b 0.7841 7 86
3d36-assembly1.cif.gz_A how to switch off a histidine kinase: crystal structure of geobacillus stearothermophilus kinb with the inhibitor sda 0.7769 2 59
6cfw-assembly1.cif.gz_B cryoem structure of a respiratory membrane-bound hydrogenase 0.7695 7 88
7wff-assembly1.cif.gz_E subcomplexes b,m and l in the cylic electron transfer supercomplex ndh-psi from arabidopsis 0.7619 7 90
ID Description Score Start End Superfamily
af_A0A0R4IM47_32_299_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.8968 7 53 1.20.1270.60
af_Q80Z70_171_425_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8472 7 54 1.25.40.10
af_Q9Z2G6_165_328_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8465 7 54 1.25.40.10
af_A0A1D6K988_42_215_1.20.140.40 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3;Invertase/pectin methylesterase inhibitor family protein 0.8262 7 53 1.20.140.40
af_Q2FZV1_630_695_1.10.287.3510 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.8172 17 98 1.10.287.3510
ID Description Score Start End GO Terms
AF-A0A497IER7-F1-model_v4 NADH-quinone oxidoreductase subunit NuoK 0.9667 7 90 GO:0016020
AF-A0A2G6II65-F1-model_v4 K+/H+ antiporter subunit F 0.8862 7 90 GO:0005886
GO:0015385
AF-A0A495T4H7-F1-model_v4 Multicomponent Na+:H+ antiporter subunit F 0.8807 7 90 GO:0005886
GO:0015385
AF-A0A662IJE1-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.8775 7 89
AF-X0ZAH8-F1-model_v4 NADH-quinone oxidoreductase subunit K 0.8694 6 96 GO:0016020

Feature Viewer

pLDDT pTM Quality
77.48 0.62 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map