F466051

General Info

Members Datasets Scaffolds Average Seq Length
581 261 1162 269

Family's Representative Sequence

Representative Sequence 3300005535|Ga0070684_100166934|Ga0070684_1001669342
Length 303
Sequence MSEHGEVAPYVLSSRKGGVVTLTLNRGERFNPLSLAMIGAIEAELDAIAADQEARVVVLAGSGRGFCAGHDLKEMRAHAGDRVWQRGLFDACARMMLKLTQLPQPVIARVHGIATAAGCQLVSMCDLAVAAEEAKFAMPGVNIGVFCTTPAVGVVRNIGRKRAMEMLLTAELVDAAEALAWGLVNRVVGAAELDAEIARFADGIVARSAAVVALGKRGFYGQVDLGLEGAYRAASEEWCGTSTSTTPRKAWMPFSPSERPRGAGNRSVVLDGDEVELAVGLIHRRQRLRAVDEEEEPVAAVLR

Samples

Sample ID Description Type Environment
1 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
37 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
90 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
112 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
117 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
183 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
192 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
193 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
194 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
195 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
196 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
197 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
198 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
199 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
210 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
211 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
212 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
213 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
214 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
217 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
218 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
227 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
230 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
233 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
234 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
248 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
249 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
254 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
255 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
256 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
257 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
258 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
259 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
260 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
261 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 1.2
Isolates 0.52

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 7.4
Rhizosphere 91.74
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070684_100166934 3300005535 Bacteria 1998
2 JGI25151J46595_10003253 3300003187 Bacteria 9037
3 Ga0065715_10179339 3300005293 Bacteria 1488
4 Ga0070658_10045168 3300005327 Bacteria 3561
5 Ga0070676_10087312 3300005328 Bacteria 1903
6 Ga0070690_100063743 3300005330 Unclassified 2379
7 Ga0070690_100255455 3300005330 Bacteria 1241
8 Ga0070670_100002965 3300005331 Bacteria 14057
9 Ga0070670_100033767 3300005331 Bacteria 4405
10 Ga0070670_100077198 3300005331 Bacteria 2862
11 Ga0070677_10007080 3300005333 Bacteria 3735
12 Ga0070677_10161291 3300005333 Bacteria 1052
13 Ga0068869_100001630 3300005334 Bacteria 13374
14 Ga0070666_10001743 3300005335 Bacteria 13267
15 Ga0070666_10002355 3300005335 Bacteria 11415
16 Ga0070666_10009692 3300005335 Bacteria 6016
17 Ga0070680_100007360 3300005336 Bacteria 8401
18 Ga0070680_100330852 3300005336 Bacteria 1294
19 Ga0070682_100002558 3300005337 Bacteria 10047
20 Ga0068868_100002888 3300005338 Bacteria 11927
21 Ga0068868_100011286 3300005338 Bacteria 6505
22 Ga0068868_100025647 3300005338 Bacteria 4486
23 Ga0068868_100080854 3300005338 Bacteria 2604
24 Ga0068868_100270231 3300005338 Bacteria 1436
25 Ga0070660_100017996 3300005339 Bacteria 5156
26 Ga0070660_100060345 3300005339 Bacteria 2943
27 Ga0070689_100143591 3300005340 Bacteria 1921
28 Ga0070691_10024502 3300005341 Bacteria 2804
29 Ga0070691_10068993 3300005341 Bacteria 1712
30 Ga0070687_100161204 3300005343 Bacteria 1326
31 Ga0070661_100001924 3300005344 Bacteria 14384
32 Ga0070661_100005900 3300005344 Bacteria 8428
33 Ga0070661_100013119 3300005344 Bacteria 5814
34 Ga0070661_100182892 3300005344 Bacteria 1595
35 Ga0070692_10062671 3300005345 Bacteria 1962
36 Ga0070692_10135907 3300005345 Bacteria 1387
37 Ga0070668_100329301 3300005347 Bacteria 1288
38 Ga0070668_100438393 3300005347 Bacteria 1121
39 Ga0070669_100009005 3300005353 Bacteria 7122
40 Ga0070675_100005978 3300005354 Bacteria 9328
41 Ga0070675_100011207 3300005354 Bacteria 7016
42 Ga0070675_100039612 3300005354 Bacteria 3846
43 Ga0070675_100134142 3300005354 Bacteria 2112
44 Ga0070671_100005680 3300005355 Bacteria 9930
45 Ga0070671_100131064 3300005355 Bacteria 2112
46 Ga0070674_100006863 3300005356 Bacteria 6672
47 Ga0070673_100075949 3300005364 Bacteria 2711
48 Ga0070673_100108106 3300005364 Bacteria 2302
49 Ga0070673_100254614 3300005364 Bacteria 1531
50 Ga0070688_100071847 3300005365 Bacteria 2216
51 Ga0070688_100408988 3300005365 Bacteria 1006
52 Ga0070659_100046349 3300005366 Bacteria 3408
53 Ga0070667_100000282 3300005367 Bacteria 57538
54 Ga0070667_100030073 3300005367 Bacteria 4529
55 Ga0070667_100587270 3300005367 Bacteria 1026
56 Ga0070709_10004094 3300005434 Bacteria 7861
57 Ga0070713_100041447 3300005436 Bacteria 3751
58 Ga0070701_10093611 3300005438 Bacteria 1651
59 Ga0070711_100001477 3300005439 Bacteria 12920
60 Ga0070711_100005118 3300005439 Bacteria 7811
61 Ga0070705_100017703 3300005440 Bacteria 3723
62 Ga0070705_100022302 3300005440 Bacteria 3382
63 Ga0070705_100158282 3300005440 Bacteria 1511
64 Ga0070700_100099698 3300005441 Bacteria 1911
65 Ga0070694_100024495 3300005444 Bacteria 3895
66 Ga0070694_100454601 3300005444 Bacteria 1012
67 Ga0070694_100637881 3300005444 Bacteria 861
68 Ga0070708_100018983 3300005445 Bacteria 5765
69 Ga0070708_100089914 3300005445 Bacteria 2795
70 Ga0070708_100294800 3300005445 Bacteria 1527
71 Ga0070708_100466589 3300005445 Bacteria 1191
72 Ga0070663_100002231 3300005455 Bacteria 10840
73 Ga0070663_100017923 3300005455 Bacteria 4630
74 Ga0070678_100049170 3300005456 Bacteria 3042
75 Ga0070678_100051772 3300005456 Bacteria 2978
76 Ga0070662_100043288 3300005457 Bacteria 3220
77 Ga0070662_100089665 3300005457 Bacteria 2307
78 Ga0070662_100307875 3300005457 Bacteria 1289
79 Ga0070681_10004430 3300005458 Bacteria 13378
80 Ga0070681_10007124 3300005458 Bacteria 10892
81 Ga0070681_10559198 3300005458 Bacteria 1058
82 Ga0068867_100020027 3300005459 Bacteria 4768
83 Ga0068867_100047825 3300005459 Bacteria 3146
84 Ga0070685_10168247 3300005466 Bacteria 1403
85 Ga0070685_10282371 3300005466 Bacteria 1112
86 Ga0070706_100000129 3300005467 Bacteria 92941
87 Ga0070706_100014302 3300005467 Bacteria 7332
88 Ga0070707_100008640 3300005468 Bacteria 9451
89 Ga0070707_100042201 3300005468 Bacteria 4367
90 Ga0070707_100630605 3300005468 Bacteria 1034
91 Ga0070698_100608123 3300005471 Bacteria 1033
92 Ga0070699_100001909 3300005518 Bacteria 18820
93 Ga0070699_100006245 3300005518 Bacteria 10394
94 Ga0070699_100055516 3300005518 Bacteria 3429
95 Ga0070699_100197744 3300005518 Bacteria 1787
96 Ga0070679_100066314 3300005530 Bacteria 3598
97 Ga0070679_100193197 3300005530 Bacteria 2004
98 Ga0070679_100284223 3300005530 Bacteria 1606
99 Ga0070684_100128697 3300005535 Bacteria 2283
100 Ga0070697_100009407 3300005536 Bacteria 7641
101 Ga0070697_100072392 3300005536 Bacteria 2828
102 Ga0070697_100116453 3300005536 Bacteria 2232
103 Ga0068853_100131136 3300005539 Bacteria 2244
104 Ga0068853_100305054 3300005539 Bacteria 1473
105 Ga0070672_100003522 3300005543 Bacteria 10146
106 Ga0070672_100058900 3300005543 Bacteria 3020
107 Ga0070672_100320939 3300005543 Bacteria 1316
108 Ga0070686_100054277 3300005544 Bacteria 2562
109 Ga0070695_100011055 3300005545 Bacteria 5396
110 Ga0070695_100169583 3300005545 Bacteria 1539
111 Ga0070695_100482431 3300005545 Bacteria 956
112 Ga0070693_100001609 3300005547 Bacteria 10194
113 Ga0070693_100081412 3300005547 Bacteria 1931
114 Ga0070665_100001759 3300005548 Bacteria 24763
115 Ga0070665_100002534 3300005548 Bacteria 20074
116 Ga0070665_100017719 3300005548 Bacteria 7152
117 Ga0070665_100062144 3300005548 Bacteria 3745
118 Ga0070665_100146644 3300005548 Bacteria 2363
119 Ga0070665_100567936 3300005548 Bacteria 1147
120 Ga0070704_100031053 3300005549 Bacteria 3588
121 Ga0070704_100033578 3300005549 Bacteria 3471
122 Ga0070704_100037973 3300005549 Bacteria 3295
123 Ga0070704_100150351 3300005549 Bacteria 1830
124 Ga0068855_100333367 3300005563 Bacteria 1674
125 Ga0068855_100409845 3300005563 Bacteria 1484
126 Ga0070664_100000473 3300005564 Bacteria 30352
127 Ga0070664_100014725 3300005564 Bacteria 6387
128 Ga0070664_100031439 3300005564 Bacteria 4436
129 Ga0068857_100030638 3300005577 Bacteria 4751
130 Ga0068857_100057359 3300005577 Bacteria 3456
131 Ga0068854_100451348 3300005578 Bacteria 1074
132 Ga0068856_100001651 3300005614 Bacteria 23387
133 Ga0068856_100045881 3300005614 Bacteria 4303
134 Ga0068856_100054375 3300005614 Bacteria 3948
135 Ga0070702_100052334 3300005615 Bacteria 2341
136 Ga0068852_100001765 3300005616 Bacteria 14713
137 Ga0068859_100002112 3300005617 Bacteria 20238
138 Ga0068859_100194786 3300005617 Bacteria 2111
139 Ga0068864_100018341 3300005618 Bacteria 5845
140 Ga0068864_100020235 3300005618 Bacteria 5567
141 Ga0068864_100126615 3300005618 Bacteria 2290
142 Ga0068864_100172968 3300005618 Bacteria 1970
143 Ga0068864_100348682 3300005618 Bacteria 1396
144 Ga0068864_100355452 3300005618 Bacteria 1383
145 Ga0068866_10005931 3300005718 Bacteria 5079
146 Ga0068861_100065639 3300005719 Bacteria 2796
147 Ga0068870_10000931 3300005840 Bacteria 11482
148 Ga0068863_100009572 3300005841 Bacteria 9449
149 Ga0068863_100015180 3300005841 Bacteria 7400
150 Ga0068863_100025027 3300005841 Bacteria 5693
151 Ga0068858_100000871 3300005842 Bacteria 31216
152 Ga0068858_100046982 3300005842 Bacteria 4003
153 Ga0068858_100440440 3300005842 Bacteria 1255
154 Ga0068858_100560976 3300005842 Bacteria 1106
155 Ga0068860_100000830 3300005843 Bacteria 34607
156 Ga0068860_100171920 3300005843 Bacteria 2093
157 Ga0068862_100212401 3300005844 Bacteria 1749
158 Ga0068862_100824637 3300005844 Bacteria 907
159 Ga0081455_10356843 3300005937 Bacteria 1029
160 Ga0070717_10002518 3300006028 Bacteria 12897
161 Ga0070717_10011922 3300006028 Bacteria 6615
162 Ga0070717_10181797 3300006028 Bacteria 1833
163 Ga0075432_10007087 3300006058 Bacteria 3817
164 Ga0070712_100018996 3300006175 Bacteria 4473
165 Ga0070712_100348966 3300006175 Bacteria 1211
166 Ga0097621_100002963 3300006237 Bacteria 11650
167 Ga0097621_100092556 3300006237 Bacteria 2532
168 Ga0097621_100226835 3300006237 Bacteria 1630
169 Ga0068871_100000876 3300006358 Bacteria 20065
170 Ga0068871_100024492 3300006358 Bacteria 4682
171 Ga0068871_100033726 3300006358 Bacteria 4056
172 Ga0068871_100509120 3300006358 Bacteria 1086
173 Ga0068871_100575734 3300006358 Bacteria 1022
174 Ga0075433_10006727 3300006852 Bacteria 9105
175 Ga0075433_10012718 3300006852 Bacteria 6811
176 Ga0075433_10051734 3300006852 Bacteria 3578
177 Ga0075433_10082768 3300006852 Bacteria 2831
178 Ga0075434_100000048 3300006871 Bacteria 57433
179 Ga0075434_100004075 3300006871 Bacteria 13095
180 Ga0075434_100004482 3300006871 Bacteria 12607
181 Ga0075434_100005367 3300006871 Bacteria 11662
182 Ga0075434_100008758 3300006871 Bacteria 9415
183 Ga0075434_100095953 3300006871 Bacteria 2970
184 Ga0075429_100053031 3300006880 Bacteria 3529
185 Ga0075436_100001015 3300006914 Bacteria 18903
186 Ga0075436_100003774 3300006914 Bacteria 10389
187 Ga0075436_100007460 3300006914 Bacteria 7480
188 Ga0075436_100027261 3300006914 Bacteria 3933
189 Ga0075436_100046147 3300006914 Bacteria 3005
190 Ga0075436_100139334 3300006914 Bacteria 1704
191 Ga0075436_100152851 3300006914 Bacteria 1625
192 Ga0075436_100249961 3300006914 Bacteria 1262
193 Ga0097620_100002112 3300006931 Bacteria 20238
194 Ga0097620_100194787 3300006931 Bacteria 2111
195 Ga0097620_100612421 3300006931 Bacteria 1182
196 Ga0075435_100000094 3300007076 Bacteria 47995
197 Ga0075435_100000175 3300007076 Bacteria 37770
198 Ga0075435_100006871 3300007076 Bacteria 8077
199 Ga0075435_100007498 3300007076 Bacteria 7782
200 Ga0075435_100007635 3300007076 Bacteria 7723
201 Ga0075435_100017639 3300007076 Bacteria 5408
202 Ga0075435_100019321 3300007076 Bacteria 5201
203 Ga0075435_100031120 3300007076 Bacteria 4202
204 Ga0075435_100066375 3300007076 Bacteria 2935
205 Ga0075435_100108984 3300007076 Bacteria 2301
206 Ga0075435_100121759 3300007076 Bacteria 2177
207 Ga0075435_100146145 3300007076 Bacteria 1986
208 Ga0075435_100320673 3300007076 Bacteria 1326
209 Ga0099794_10043356 3300007265 Bacteria 2147
210 Ga0099795_10023722 3300007788 Bacteria 2038
211 Ga0105251_10040360 3300009011 Bacteria 2275
212 Ga0105240_10161163 3300009093 Bacteria 2664
213 Ga0105240_10552032 3300009093 Bacteria 1274
214 Ga0111539_10027424 3300009094 Bacteria 6957
215 Ga0111539_10142276 3300009094 Bacteria 2808
216 Ga0111539_11005239 3300009094 Bacteria 969
217 Ga0105245_10001777 3300009098 Bacteria 19632
218 Ga0105245_10029856 3300009098 Bacteria 4820
219 Ga0105245_10183466 3300009098 Bacteria 2001
220 Ga0105247_10018101 3300009101 Bacteria 4226
221 Ga0105247_10084557 3300009101 Bacteria 2005
222 Ga0114129_10075336 3300009147 Bacteria 4699
223 Ga0114129_10120334 3300009147 Bacteria 3615
224 Ga0105243_10011492 3300009148 Bacteria 6699
225 Ga0105241_10019935 3300009174 Bacteria 4950
226 Ga0105241_10082612 3300009174 Bacteria 2518
227 Ga0105241_10258828 3300009174 Bacteria 1478
228 Ga0105242_10002084 3300009176 Bacteria 15747
229 Ga0105242_10034184 3300009176 Bacteria 4075
230 Ga0105242_10747710 3300009176 Bacteria 962
231 Ga0105248_10001890 3300009177 Bacteria 23227
232 Ga0105248_10003894 3300009177 Bacteria 16498
233 Ga0105248_10022516 3300009177 Bacteria 6989
234 Ga0105248_10025407 3300009177 Bacteria 6585
235 Ga0105248_10038370 3300009177 Bacteria 5361
236 Ga0105248_10069100 3300009177 Bacteria 3966
237 Ga0105248_10151688 3300009177 Bacteria 2615
238 Ga0105248_10170338 3300009177 Bacteria 2454
239 Ga0105248_10501138 3300009177 Bacteria 1369
240 Ga0105237_10658941 3300009545 Bacteria 1053
241 Ga0105238_10510278 3300009551 Bacteria 1204
242 Ga0105239_10034702 3300010375 Bacteria 5541
243 Ga0105239_10226635 3300010375 Bacteria 2097
244 Ga0157373_10163122 3300013100 Bacteria 1568
245 Ga0157370_10004142 3300013104 Bacteria 16786
246 Ga0157369_10041902 3300013105 Bacteria 4997
247 Ga0157369_10138569 3300013105 Bacteria 2575
248 Ga0157369_10159903 3300013105 Bacteria 2378
249 Ga0157374_10002201 3300013296 Bacteria 16439
250 Ga0157374_10008989 3300013296 Bacteria 8566
251 Ga0157374_10039513 3300013296 Bacteria 4342
252 Ga0157374_10085987 3300013296 Bacteria 2991
253 Ga0157378_10005853 3300013297 Bacteria 10777
254 Ga0157378_10061905 3300013297 Bacteria 3341
255 Ga0157378_10093637 3300013297 Bacteria 2735
256 Ga0157372_10065347 3300013307 Bacteria 4084
257 Ga0157372_10107024 3300013307 Bacteria 3199
258 Ga0157372_10116591 3300013307 Bacteria 3062
259 Ga0157372_10567251 3300013307 Bacteria 1323
260 Ga0163163_10020598 3300014325 Bacteria 6214
261 Ga0163163_10035891 3300014325 Bacteria 4813
262 Ga0163163_10076741 3300014325 Bacteria 3337
263 Ga0163163_10078824 3300014325 Bacteria 3291
264 Ga0163163_10391817 3300014325 Bacteria 1447
265 Ga0163163_10495065 3300014325 Bacteria 1284
266 Ga0157380_10002554 3300014326 Bacteria 12295
267 Ga0157380_10021711 3300014326 Bacteria 4819
268 Ga0157380_10142360 3300014326 Bacteria 2062
269 Ga0157380_10270695 3300014326 Bacteria 1548
270 Ga0157380_10471375 3300014326 Bacteria 1212
271 Ga0182008_10008884 3300014497 Bacteria 5451
272 Ga0157377_10043277 3300014745 Bacteria 2506
273 Ga0157379_10004276 3300014968 Bacteria 12196
274 Ga0157379_10642849 3300014968 Bacteria 993
275 Ga0157376_10012390 3300014969 Bacteria 6328
276 Ga0157376_10063910 3300014969 Bacteria 3102
277 Ga0157376_10106790 3300014969 Bacteria 2457
278 Ga0157376_10252999 3300014969 Bacteria 1646
279 Ga0182007_10006064 3300015262 Bacteria 5226
280 Ga0206356_11673499 3300020070 Bacteria 1899
281 Ga0206354_10891497 3300020081 Bacteria 3189
282 Ga0206354_10950097 3300020081 Bacteria 3416
283 Ga0206353_11102665 3300020082 Bacteria 2080
284 Ga0224712_10008254 3300022467 Bacteria 3076
285 Ga0224712_10029111 3300022467 Bacteria 1981
286 Ga0209025_1000272 3300025294 Bacteria 120328
287 Ga0207713_1069244 3300025735 Bacteria 1308
288 Ga0207682_10018489 3300025893 Bacteria 2725
289 Ga0207682_10081337 3300025893 Bacteria 1389
290 Ga0207692_10008878 3300025898 Bacteria 4177
291 Ga0207710_10011056 3300025900 Bacteria 3802
292 Ga0207688_10003088 3300025901 Bacteria 9090
293 Ga0207680_10000344 3300025903 Bacteria 22220
294 Ga0207680_10014758 3300025903 Bacteria 4056
295 Ga0207680_10090510 3300025903 Bacteria 1945
296 Ga0207685_10021052 3300025905 Bacteria 2178
297 Ga0207699_10069276 3300025906 Bacteria 2150
298 Ga0207645_10063999 3300025907 Bacteria 2350
299 Ga0207643_10000238 3300025908 Bacteria 38484
300 Ga0207643_10121701 3300025908 Bacteria 1547
301 Ga0207705_10206249 3300025909 Bacteria 1490
302 Ga0207705_10275987 3300025909 Bacteria 1286
303 Ga0207684_10000057 3300025910 Bacteria 211445
304 Ga0207684_10004622 3300025910 Bacteria 12927
305 Ga0207654_10132309 3300025911 Bacteria 1580
306 Ga0207654_10201570 3300025911 Bacteria 1310
307 Ga0207707_10118548 3300025912 Bacteria 2313
308 Ga0207695_10153322 3300025913 Bacteria 2241
309 Ga0207695_10225314 3300025913 Bacteria 1781
310 Ga0207693_10020920 3300025915 Bacteria 5202
311 Ga0207693_10024272 3300025915 Bacteria 4813
312 Ga0207693_10025602 3300025915 Bacteria 4677
313 Ga0207663_10002145 3300025916 Bacteria 9415
314 Ga0207663_10017912 3300025916 Bacteria 3956
315 Ga0207660_10011496 3300025917 Bacteria 5766
316 Ga0207660_10470772 3300025917 Bacteria 1017
317 Ga0207657_10002755 3300025919 Bacteria 18918
318 Ga0207657_10003218 3300025919 Bacteria 17487
319 Ga0207649_10002388 3300025920 Bacteria 10533
320 Ga0207649_10114760 3300025920 Bacteria 1806
321 Ga0207652_10066917 3300025921 Bacteria 3115
322 Ga0207652_10136031 3300025921 Bacteria 2194
323 Ga0207646_10008451 3300025922 Bacteria 10318
324 Ga0207646_10038024 3300025922 Bacteria 4337
325 Ga0207646_10199645 3300025922 Bacteria 1806
326 Ga0207681_10053002 3300025923 Bacteria 2753
327 Ga0207681_10475980 3300025923 Bacteria 1019
328 Ga0207694_10170922 3300025924 Bacteria 1760
329 Ga0207650_10009208 3300025925 Bacteria 6748
330 Ga0207650_10041726 3300025925 Bacteria 3364
331 Ga0207659_10053620 3300025926 Bacteria 2877
332 Ga0207659_10061959 3300025926 Bacteria 2698
333 Ga0207659_10094362 3300025926 Bacteria 2242
334 Ga0207659_10203052 3300025926 Bacteria 1584
335 Ga0207659_10210702 3300025926 Bacteria 1557
336 Ga0207687_10012181 3300025927 Bacteria 5626
337 Ga0207687_10239547 3300025927 Bacteria 1437
338 Ga0207687_10435578 3300025927 Bacteria 1085
339 Ga0207700_10021040 3300025928 Bacteria 4446
340 Ga0207664_10030954 3300025929 Bacteria 4090
341 Ga0207664_10343368 3300025929 Bacteria 1320
342 Ga0207644_10031342 3300025931 Bacteria 3703
343 Ga0207644_10050194 3300025931 Bacteria 2990
344 Ga0207644_10059830 3300025931 Bacteria 2756
345 Ga0207690_10054809 3300025932 Bacteria 2682
346 Ga0207690_10452612 3300025932 Bacteria 1032
347 Ga0207706_10006080 3300025933 Bacteria 11219
348 Ga0207706_10074065 3300025933 Bacteria 2994
349 Ga0207706_10098084 3300025933 Bacteria 2578
350 Ga0207706_10189345 3300025933 Bacteria 1806
351 Ga0207706_10332885 3300025933 Bacteria 1321
352 Ga0207686_10022476 3300025934 Bacteria 3633
353 Ga0207709_10135552 3300025935 Bacteria 1685
354 Ga0207669_10074078 3300025937 Bacteria 2151
355 Ga0207669_10187110 3300025937 Bacteria 1490
356 Ga0207704_10000992 3300025938 Bacteria 12590
357 Ga0207665_10006761 3300025939 Bacteria 7596
358 Ga0207665_10021876 3300025939 Bacteria 4205
359 Ga0207665_10134089 3300025939 Bacteria 1760
360 Ga0207665_10364939 3300025939 Bacteria 1093
361 Ga0207691_10014715 3300025940 Bacteria 7457
362 Ga0207691_10095105 3300025940 Bacteria 2665
363 Ga0207691_10125336 3300025940 Bacteria 2273
364 Ga0207711_10000705 3300025941 Bacteria 32901
365 Ga0207711_10024592 3300025941 Bacteria 5049
366 Ga0207711_10107835 3300025941 Bacteria 2473
367 Ga0207711_10112855 3300025941 Bacteria 2419
368 Ga0207711_10212718 3300025941 Bacteria 1766
369 Ga0207711_10593596 3300025941 Bacteria 1033
370 Ga0207689_10002625 3300025942 Bacteria 16644
371 Ga0207689_10404775 3300025942 Bacteria 1138
372 Ga0207661_10001297 3300025944 Bacteria 16724
373 Ga0207661_10363439 3300025944 Bacteria 1308
374 Ga0207679_10000072 3300025945 Bacteria 89960
375 Ga0207679_10000854 3300025945 Bacteria 19571
376 Ga0207679_10563512 3300025945 Bacteria 1023
377 Ga0207651_10362211 3300025960 Bacteria 1224
378 Ga0207668_10119426 3300025972 Bacteria 1993
379 Ga0207640_10027560 3300025981 Bacteria 3463
380 Ga0207640_10313292 3300025981 Bacteria 1246
381 Ga0207658_10007461 3300025986 Bacteria 7451
382 Ga0207677_10015032 3300026023 Bacteria 4539
383 Ga0207677_10109736 3300026023 Bacteria 2052
384 Ga0207677_10130617 3300026023 Bacteria 1906
385 Ga0207677_10240545 3300026023 Bacteria 1464
386 Ga0207703_10000673 3300026035 Bacteria 34088
387 Ga0207703_10011061 3300026035 Bacteria 7031
388 Ga0207703_10091342 3300026035 Bacteria 2561
389 Ga0207703_10192442 3300026035 Bacteria 1807
390 Ga0207703_10566130 3300026035 Bacteria 1072
391 Ga0207678_10000571 3300026067 Bacteria 33712
392 Ga0207678_10046569 3300026067 Bacteria 3750
393 Ga0207678_10170808 3300026067 Bacteria 1856
394 Ga0207678_10424844 3300026067 Bacteria 1153
395 Ga0207678_10621306 3300026067 Bacteria 948
396 Ga0207708_10146704 3300026075 Bacteria 1855
397 Ga0207702_10004049 3300026078 Bacteria 13157
398 Ga0207702_10007863 3300026078 Bacteria 9043
399 Ga0207702_10104044 3300026078 Bacteria 2512
400 Ga0207641_10020268 3300026088 Bacteria 5461
401 Ga0207641_10029258 3300026088 Bacteria 4554
402 Ga0207641_10756524 3300026088 Bacteria 959
403 Ga0207648_10048879 3300026089 Bacteria 3703
404 Ga0207648_10051128 3300026089 Bacteria 3612
405 Ga0207648_10439503 3300026089 Bacteria 1186
406 Ga0207676_10025240 3300026095 Bacteria 4409
407 Ga0207676_10074918 3300026095 Bacteria 2729
408 Ga0207676_10080236 3300026095 Bacteria 2648
409 Ga0207676_10242315 3300026095 Bacteria 1618
410 Ga0207676_10363207 3300026095 Bacteria 1342
411 Ga0207676_10890318 3300026095 Bacteria 872
412 Ga0207674_10041664 3300026116 Bacteria 4747
413 Ga0207674_10044135 3300026116 Bacteria 4593
414 Ga0207674_10135929 3300026116 Bacteria 2420
415 Ga0207674_10169680 3300026116 Bacteria 2136
416 Ga0207674_10270684 3300026116 Bacteria 1646
417 Ga0207675_100020278 3300026118 Bacteria 6199
418 Ga0207675_100163318 3300026118 Bacteria 2126
419 Ga0207683_10002787 3300026121 Bacteria 15262
420 Ga0207683_10075846 3300026121 Bacteria 2977
421 Ga0207698_10004499 3300026142 Bacteria 8507
422 Ga0209588_1014577 3300027671 Bacteria 2408
423 Ga0209588_1063769 3300027671 Bacteria 1191
424 Ga0207428_10012418 3300027907 Bacteria 7484
425 Ga0268266_10014538 3300028379 Bacteria 6765
426 Ga0268266_10015405 3300028379 Bacteria 6561
427 Ga0268266_10047097 3300028379 Bacteria 3692
428 Ga0268266_10196789 3300028379 Bacteria 1843
429 Ga0268266_10395655 3300028379 Bacteria 1305
430 Ga0268265_10516634 3300028380 Bacteria 1128
431 Ga0268265_10527679 3300028380 Bacteria 1117
432 Ga0268264_10001110 3300028381 Bacteria 26593
433 Ga0268264_10694103 3300028381 Bacteria 1010
434 Ga0268264_10837877 3300028381 Bacteria 920
435 Ga0265338_10092071 3300028800 Bacteria 2502
436 Ga0265760_10035474 3300031090 Bacteria 1477
437 Ga0265330_10005865 3300031235 Bacteria 6088
438 Ga0265329_10055910 3300031242 Bacteria 1252
439 Ga0265331_10032292 3300031250 Bacteria 2595
440 Ga0265314_10010832 3300031711 Bacteria 7581
441 Ga0265342_10071050 3300031712 Bacteria 2029
442 Ga0307516_10000060 3300031730 Bacteria 118638
443 Ga0307410_10024369 3300031852 Bacteria 3779
444 Ga0307416_100796379 3300032002 Bacteria 1040
445 Ga0307416_100832421 3300032002 Bacteria 1020
446 Ga0307414_10128652 3300032004 Bacteria 1962
447 Ga0307414_10259290 3300032004 Bacteria 1450
448 Ga0373938_0063012 3300034957 Bacteria 871
449 Ga0373928_0027153 3300035084 Bacteria 1244
450 Ga0373940_0003654 3300035088 Bacteria 3164
451 Ga0373949_0017153 3300035090 Bacteria 1629
452 Ga0373951_0001627 3300035091 Bacteria 5890
453 Ga0373952_0023187 3300035092 Bacteria 1324
454 Ga0373932_0002871 3300035112 Bacteria 4255
455 Ga0373941_0081162 3300035115 Bacteria 1095
456 Ga0373945_0061191 3300035116 Bacteria 1406
457 Ga0373942_0000936 3300035207 Bacteria 7981
458 Ga0373962_0001648 3300035242 Bacteria 5309
459 Ga0373931_0004956 3300035691 Bacteria 6122
460 Ga0373927_0256479 3300035695 Bacteria 1150
461 Ga0373947_0120557 3300035725 Bacteria 1666
462 Ga0373937_0598214 3300036401 Bacteria 1047
463 Ga0373925_0373066 3300037068 Bacteria 1161
464 Ga0436364_0874730 3300037853 Bacteria 1662
465 Ga0395901_0770392 3300038443 Bacteria 954
466 Ga0436360_0692350 3300039438 Bacteria 1750
467 Ga0439448_0002363 3300042005 Bacteria 5120
468 Ga0439462_0012450 3300042015 Bacteria 2174
469 Ga0439435_0115091 3300042436 Bacteria 838
470 Ga0439459_0002735 3300042438 Bacteria 2745
471 Ga0450916_017672 3300042530 Bacteria 955
472 Ga0451577_0122414 3300042876 Bacteria 2330
473 Ga0453683_0010546 3300044673 Bacteria 6121
474 Ga0453683_0244295 3300044673 Bacteria 1143
475 Ga0466966_0124082 3300044684 Bacteria 1585
476 Ga0453684_0000422 3300044712 Bacteria 172695
477 Ga0453684_0003812 3300044712 Bacteria 33257
478 Ga0453684_0007404 3300044712 Bacteria 20214
479 Ga0453684_0025411 3300044712 Bacteria 8600
480 Ga0453684_0042111 3300044712 Bacteria 6161
481 Ga0453684_0339329 3300044712 Bacteria 1697
482 Ga0466959_0225613 3300045049 Bacteria 1298
483 Ga0451576_0007668 3300045051 Bacteria 12830
484 Ga0451576_0059671 3300045051 Bacteria 3982
485 Ga0451576_0155746 3300045051 Bacteria 2383
486 Ga0451576_0510115 3300045051 Bacteria 1263
487 Ga0495629_0475634 3300046459 Bacteria 844
488 Ga0495580_0001703 3300046472 Bacteria 19315
489 Ga0495580_0027342 3300046472 Bacteria 4151
490 Ga0495645_0084951 3300046543 Bacteria 2266
491 Ga0495645_0096995 3300046543 Bacteria 2100
492 Ga0495668_0228409 3300046616 Bacteria 1019
493 Ga0495635_0203412 3300046663 Bacteria 1343
494 Ga0495623_0015700 3300046679 Bacteria 4894
495 Ga0495647_0041845 3300046681 Bacteria 1747
496 Ga0495647_0078657 3300046681 Bacteria 1334
497 Ga0495604_0031883 3300047317 Bacteria 4178
498 Ga0496100_0065529 3300048903 Bacteria 2407
499 Ga0496100_0078753 3300048903 Bacteria 2219
500 Ga0496100_0560381 3300048903 Bacteria 885
501 Ga0496101_0218135 3300048904 Bacteria 1480
502 Ga0496102_0007981 3300048905 Bacteria 9045
503 Ga0496102_0028045 3300048905 Bacteria 5031
504 Ga0496103_0015722 3300048906 Bacteria 4511
505 Ga0496103_0038506 3300048906 Bacteria 2934
506 Ga0496103_0231335 3300048906 Bacteria 1189
507 Ga0496104_0006323 3300048907 Bacteria 10419
508 Ga0496104_0028037 3300048907 Bacteria 5216
509 Ga0496104_0425044 3300048907 Bacteria 1240
510 Ga0496105_0008423 3300048908 Bacteria 8015
511 Ga0496105_0021043 3300048908 Bacteria 5275
512 Ga0496105_0448289 3300048908 Bacteria 1019
513 Ga0496106_0000937 3300048909 Bacteria 21256
514 Ga0496106_0012598 3300048909 Bacteria 6245
515 Ga0496106_0015913 3300048909 Bacteria 5564
516 Ga0496106_0190884 3300048909 Bacteria 1629
517 Ga0496107_0002505 3300048910 Bacteria 11942
518 Ga0496107_0010331 3300048910 Bacteria 6485
519 Ga0496108_0041635 3300048911 Bacteria 3835
520 Ga0496108_0159315 3300048911 Bacteria 1950
521 Ga0496108_0440784 3300048911 Bacteria 1138
522 Ga0496108_0684399 3300048911 Bacteria 890
523 Ga0496109_0114056 3300048912 Bacteria 2514
524 Ga0496109_0595856 3300048912 Bacteria 1041
525 Ga0496110_0001394 3300048913 Bacteria 17455
526 Ga0496110_0046631 3300048913 Bacteria 3792
527 Ga0496110_0132275 3300048913 Bacteria 2253
528 Ga0496111_0001106 3300048914 Bacteria 14931
529 Ga0496112_0016915 3300048915 Bacteria 6843
530 Ga0496112_0101896 3300048915 Bacteria 2841
531 Ga0496112_0160866 3300048915 Bacteria 2212
532 Ga0496112_0405403 3300048915 Bacteria 1303
533 Ga0496113_0041565 3300048916 Bacteria 3393
534 Ga0496113_0078573 3300048916 Bacteria 2525
535 Ga0496113_0398107 3300048916 Bacteria 1105
536 Ga0496114_0011002 3300048917 Bacteria 7214
537 Ga0496114_0066266 3300048917 Bacteria 3027
538 Ga0496114_0432063 3300048917 Bacteria 1166
539 Ga0496115_0021616 3300048918 Bacteria 4972
540 Ga0496115_0315854 3300048918 Bacteria 1278
541 Ga0501075_0605342 3300049591 Bacteria 836
542 Ga0501079_0561383 3300049741 Bacteria 898
543 Ga0501080_0493369 3300049742 Bacteria 1095
544 Ga0501081_0242444 3300049743 Bacteria 1315
545 Ga0501045_0455940 3300049824 Bacteria 950
546 nmdc:mga05p37_152330_c1 3300050507 Bacteria 2827
547 nmdc:mga05p37_189306_c1 3300050507 Bacteria 2499
548 nmdc:mga05p37_208720_c1 3300050507 Bacteria 2362
549 nmdc:mga09592_687532_c1 3300050508 Bacteria 871
550 nmdc:mga09592_96195_c1 3300050508 Bacteria 2533
551 nmdc:mga06r32_595690_c1 3300050510 Bacteria 1076
552 nmdc:mga08y16_20990_c1 3300050511 Bacteria 6895
553 nmdc:mga0n895_214_c1 3300050512 Bacteria 36336
554 nmdc:mga0n895_2395_c1 3300050512 Bacteria 14614
555 nmdc:mga0n895_261304_c1 3300050512 Bacteria 1757
556 nmdc:mga0n895_2973_c1 3300050512 Bacteria 13452
557 nmdc:mga0n895_34781_c1 3300050512 Bacteria 4853
558 nmdc:mga0n895_49601_c1 3300050512 Bacteria 4114
559 nmdc:mga0n895_99741_c1 3300050512 Bacteria 2913
560 nmdc:mga0rr50_14_c1 3300050513 Bacteria 196574
561 nmdc:mga0rr50_163804_c1 3300050513 Bacteria 1807
562 nmdc:mga0rr50_16671_c1 3300050513 Bacteria 4886
563 nmdc:mga0rr50_19219_c1 3300050513 Bacteria 4606
564 nmdc:mga0rr50_212823_c1 3300050513 Bacteria 1593
565 nmdc:mga0rr50_21432_c1 3300050513 Bacteria 4412
566 nmdc:mga0rr50_328677_c1 3300050513 Bacteria 1283
567 nmdc:mga0rr50_60131_c1 3300050513 Bacteria 2857
568 nmdc:mga0rr50_95304_c1 3300050513 Bacteria 2326
569 nmdc:mga08x19_114291_c1 3300050514 Bacteria 1803
570 nmdc:mga08x19_145_c1 3300050514 Bacteria 60490
571 nmdc:mga08x19_15726_c1 3300050514 Bacteria 4604
572 nmdc:mga08x19_423145_c1 3300050514 Bacteria 936
573 nmdc:mga08x19_47298_c1 3300050514 Bacteria 2754
574 nmdc:mga0a205_32402_c1 3300050515 Bacteria 5010
575 nmdc:mga0a205_3291_c1 3300050515 Bacteria 14370
576 nmdc:mga0a205_44992_c1 3300050515 Bacteria 4257
577 nmdc:mga0a205_9885_c1 3300050515 Bacteria 8750
578 Ga0495601_0069145 3300053077 Bacteria 2252
579 2904549806 2904541872 Bacteria 8915136
580 2928120792 2928115317 Bacteria 6477646
581 2929161773 2929160207 Bacteria 9075316
582 Ga0070684_100166934
583 JGI25151J46595_10003253
584 Ga0065715_10179339
585 Ga0070658_10045168
586 Ga0070676_10087312
587 Ga0070690_100063743
588 Ga0070690_100255455
589 Ga0070670_100002965
590 Ga0070670_100033767
591 Ga0070670_100077198
592 Ga0070677_10007080
593 Ga0070677_10161291
594 Ga0068869_100001630
595 Ga0070666_10001743
596 Ga0070666_10002355
597 Ga0070666_10009692
598 Ga0070680_100007360
599 Ga0070680_100330852
600 Ga0070682_100002558
601 Ga0068868_100002888
602 Ga0068868_100011286
603 Ga0068868_100025647
604 Ga0068868_100080854
605 Ga0068868_100270231
606 Ga0070660_100017996
607 Ga0070660_100060345
608 Ga0070689_100143591
609 Ga0070691_10024502
610 Ga0070691_10068993
611 Ga0070687_100161204
612 Ga0070661_100001924
613 Ga0070661_100005900
614 Ga0070661_100013119
615 Ga0070661_100182892
616 Ga0070692_10062671
617 Ga0070692_10135907
618 Ga0070668_100329301
619 Ga0070668_100438393
620 Ga0070669_100009005
621 Ga0070675_100005978
622 Ga0070675_100011207
623 Ga0070675_100039612
624 Ga0070675_100134142
625 Ga0070671_100005680
626 Ga0070671_100131064
627 Ga0070674_100006863
628 Ga0070673_100075949
629 Ga0070673_100108106
630 Ga0070673_100254614
631 Ga0070688_100071847
632 Ga0070688_100408988
633 Ga0070659_100046349
634 Ga0070667_100000282
635 Ga0070667_100030073
636 Ga0070667_100587270
637 Ga0070709_10004094
638 Ga0070713_100041447
639 Ga0070701_10093611
640 Ga0070711_100001477
641 Ga0070711_100005118
642 Ga0070705_100017703
643 Ga0070705_100022302
644 Ga0070705_100158282
645 Ga0070700_100099698
646 Ga0070694_100024495
647 Ga0070694_100454601
648 Ga0070694_100637881
649 Ga0070708_100018983
650 Ga0070708_100089914
651 Ga0070708_100294800
652 Ga0070708_100466589
653 Ga0070663_100002231
654 Ga0070663_100017923
655 Ga0070678_100049170
656 Ga0070678_100051772
657 Ga0070662_100043288
658 Ga0070662_100089665
659 Ga0070662_100307875
660 Ga0070681_10004430
661 Ga0070681_10007124
662 Ga0070681_10559198
663 Ga0068867_100020027
664 Ga0068867_100047825
665 Ga0070685_10168247
666 Ga0070685_10282371
667 Ga0070706_100000129
668 Ga0070706_100014302
669 Ga0070707_100008640
670 Ga0070707_100042201
671 Ga0070707_100630605
672 Ga0070698_100608123
673 Ga0070699_100001909
674 Ga0070699_100006245
675 Ga0070699_100055516
676 Ga0070699_100197744
677 Ga0070679_100066314
678 Ga0070679_100193197
679 Ga0070679_100284223
680 Ga0070684_100128697
681 Ga0070697_100009407
682 Ga0070697_100072392
683 Ga0070697_100116453
684 Ga0068853_100131136
685 Ga0068853_100305054
686 Ga0070672_100003522
687 Ga0070672_100058900
688 Ga0070672_100320939
689 Ga0070686_100054277
690 Ga0070695_100011055
691 Ga0070695_100169583
692 Ga0070695_100482431
693 Ga0070693_100001609
694 Ga0070693_100081412
695 Ga0070665_100001759
696 Ga0070665_100002534
697 Ga0070665_100017719
698 Ga0070665_100062144
699 Ga0070665_100146644
700 Ga0070665_100567936
701 Ga0070704_100031053
702 Ga0070704_100033578
703 Ga0070704_100037973
704 Ga0070704_100150351
705 Ga0068855_100333367
706 Ga0068855_100409845
707 Ga0070664_100000473
708 Ga0070664_100014725
709 Ga0070664_100031439
710 Ga0068857_100030638
711 Ga0068857_100057359
712 Ga0068854_100451348
713 Ga0068856_100001651
714 Ga0068856_100045881
715 Ga0068856_100054375
716 Ga0070702_100052334
717 Ga0068852_100001765
718 Ga0068859_100002112
719 Ga0068859_100194786
720 Ga0068864_100018341
721 Ga0068864_100020235
722 Ga0068864_100126615
723 Ga0068864_100172968
724 Ga0068864_100348682
725 Ga0068864_100355452
726 Ga0068866_10005931
727 Ga0068861_100065639
728 Ga0068870_10000931
729 Ga0068863_100009572
730 Ga0068863_100015180
731 Ga0068863_100025027
732 Ga0068858_100000871
733 Ga0068858_100046982
734 Ga0068858_100440440
735 Ga0068858_100560976
736 Ga0068860_100000830
737 Ga0068860_100171920
738 Ga0068862_100212401
739 Ga0068862_100824637
740 Ga0081455_10356843
741 Ga0070717_10002518
742 Ga0070717_10011922
743 Ga0070717_10181797
744 Ga0075432_10007087
745 Ga0070712_100018996
746 Ga0070712_100348966
747 Ga0097621_100002963
748 Ga0097621_100092556
749 Ga0097621_100226835
750 Ga0068871_100000876
751 Ga0068871_100024492
752 Ga0068871_100033726
753 Ga0068871_100509120
754 Ga0068871_100575734
755 Ga0075433_10006727
756 Ga0075433_10012718
757 Ga0075433_10051734
758 Ga0075433_10082768
759 Ga0075434_100000048
760 Ga0075434_100004075
761 Ga0075434_100004482
762 Ga0075434_100005367
763 Ga0075434_100008758
764 Ga0075434_100095953
765 Ga0075429_100053031
766 Ga0075436_100001015
767 Ga0075436_100003774
768 Ga0075436_100007460
769 Ga0075436_100027261
770 Ga0075436_100046147
771 Ga0075436_100139334
772 Ga0075436_100152851
773 Ga0075436_100249961
774 Ga0097620_100002112
775 Ga0097620_100194787
776 Ga0097620_100612421
777 Ga0075435_100000094
778 Ga0075435_100000175
779 Ga0075435_100006871
780 Ga0075435_100007498
781 Ga0075435_100007635
782 Ga0075435_100017639
783 Ga0075435_100019321
784 Ga0075435_100031120
785 Ga0075435_100066375
786 Ga0075435_100108984
787 Ga0075435_100121759
788 Ga0075435_100146145
789 Ga0075435_100320673
790 Ga0099794_10043356
791 Ga0099795_10023722
792 Ga0105251_10040360
793 Ga0105240_10161163
794 Ga0105240_10552032
795 Ga0111539_10027424
796 Ga0111539_10142276
797 Ga0111539_11005239
798 Ga0105245_10001777
799 Ga0105245_10029856
800 Ga0105245_10183466
801 Ga0105247_10018101
802 Ga0105247_10084557
803 Ga0114129_10075336
804 Ga0114129_10120334
805 Ga0105243_10011492
806 Ga0105241_10019935
807 Ga0105241_10082612
808 Ga0105241_10258828
809 Ga0105242_10002084
810 Ga0105242_10034184
811 Ga0105242_10747710
812 Ga0105248_10001890
813 Ga0105248_10003894
814 Ga0105248_10022516
815 Ga0105248_10025407
816 Ga0105248_10038370
817 Ga0105248_10069100
818 Ga0105248_10151688
819 Ga0105248_10170338
820 Ga0105248_10501138
821 Ga0105237_10658941
822 Ga0105238_10510278
823 Ga0105239_10034702
824 Ga0105239_10226635
825 Ga0157373_10163122
826 Ga0157370_10004142
827 Ga0157369_10041902
828 Ga0157369_10138569
829 Ga0157369_10159903
830 Ga0157374_10002201
831 Ga0157374_10008989
832 Ga0157374_10039513
833 Ga0157374_10085987
834 Ga0157378_10005853
835 Ga0157378_10061905
836 Ga0157378_10093637
837 Ga0157372_10065347
838 Ga0157372_10107024
839 Ga0157372_10116591
840 Ga0157372_10567251
841 Ga0163163_10020598
842 Ga0163163_10035891
843 Ga0163163_10076741
844 Ga0163163_10078824
845 Ga0163163_10391817
846 Ga0163163_10495065
847 Ga0157380_10002554
848 Ga0157380_10021711
849 Ga0157380_10142360
850 Ga0157380_10270695
851 Ga0157380_10471375
852 Ga0182008_10008884
853 Ga0157377_10043277
854 Ga0157379_10004276
855 Ga0157379_10642849
856 Ga0157376_10012390
857 Ga0157376_10063910
858 Ga0157376_10106790
859 Ga0157376_10252999
860 Ga0182007_10006064
861 Ga0206356_11673499
862 Ga0206354_10891497
863 Ga0206354_10950097
864 Ga0206353_11102665
865 Ga0224712_10008254
866 Ga0224712_10029111
867 Ga0209025_1000272
868 Ga0207713_1069244
869 Ga0207682_10018489
870 Ga0207682_10081337
871 Ga0207692_10008878
872 Ga0207710_10011056
873 Ga0207688_10003088
874 Ga0207680_10000344
875 Ga0207680_10014758
876 Ga0207680_10090510
877 Ga0207685_10021052
878 Ga0207699_10069276
879 Ga0207645_10063999
880 Ga0207643_10000238
881 Ga0207643_10121701
882 Ga0207705_10206249
883 Ga0207705_10275987
884 Ga0207684_10000057
885 Ga0207684_10004622
886 Ga0207654_10132309
887 Ga0207654_10201570
888 Ga0207707_10118548
889 Ga0207695_10153322
890 Ga0207695_10225314
891 Ga0207693_10020920
892 Ga0207693_10024272
893 Ga0207693_10025602
894 Ga0207663_10002145
895 Ga0207663_10017912
896 Ga0207660_10011496
897 Ga0207660_10470772
898 Ga0207657_10002755
899 Ga0207657_10003218
900 Ga0207649_10002388
901 Ga0207649_10114760
902 Ga0207652_10066917
903 Ga0207652_10136031
904 Ga0207646_10008451
905 Ga0207646_10038024
906 Ga0207646_10199645
907 Ga0207681_10053002
908 Ga0207681_10475980
909 Ga0207694_10170922
910 Ga0207650_10009208
911 Ga0207650_10041726
912 Ga0207659_10053620
913 Ga0207659_10061959
914 Ga0207659_10094362
915 Ga0207659_10203052
916 Ga0207659_10210702
917 Ga0207687_10012181
918 Ga0207687_10239547
919 Ga0207687_10435578
920 Ga0207700_10021040
921 Ga0207664_10030954
922 Ga0207664_10343368
923 Ga0207644_10031342
924 Ga0207644_10050194
925 Ga0207644_10059830
926 Ga0207690_10054809
927 Ga0207690_10452612
928 Ga0207706_10006080
929 Ga0207706_10074065
930 Ga0207706_10098084
931 Ga0207706_10189345
932 Ga0207706_10332885
933 Ga0207686_10022476
934 Ga0207709_10135552
935 Ga0207669_10074078
936 Ga0207669_10187110
937 Ga0207704_10000992
938 Ga0207665_10006761
939 Ga0207665_10021876
940 Ga0207665_10134089
941 Ga0207665_10364939
942 Ga0207691_10014715
943 Ga0207691_10095105
944 Ga0207691_10125336
945 Ga0207711_10000705
946 Ga0207711_10024592
947 Ga0207711_10107835
948 Ga0207711_10112855
949 Ga0207711_10212718
950 Ga0207711_10593596
951 Ga0207689_10002625
952 Ga0207689_10404775
953 Ga0207661_10001297
954 Ga0207661_10363439
955 Ga0207679_10000072
956 Ga0207679_10000854
957 Ga0207679_10563512
958 Ga0207651_10362211
959 Ga0207668_10119426
960 Ga0207640_10027560
961 Ga0207640_10313292
962 Ga0207658_10007461
963 Ga0207677_10015032
964 Ga0207677_10109736
965 Ga0207677_10130617
966 Ga0207677_10240545
967 Ga0207703_10000673
968 Ga0207703_10011061
969 Ga0207703_10091342
970 Ga0207703_10192442
971 Ga0207703_10566130
972 Ga0207678_10000571
973 Ga0207678_10046569
974 Ga0207678_10170808
975 Ga0207678_10424844
976 Ga0207678_10621306
977 Ga0207708_10146704
978 Ga0207702_10004049
979 Ga0207702_10007863
980 Ga0207702_10104044
981 Ga0207641_10020268
982 Ga0207641_10029258
983 Ga0207641_10756524
984 Ga0207648_10048879
985 Ga0207648_10051128
986 Ga0207648_10439503
987 Ga0207676_10025240
988 Ga0207676_10074918
989 Ga0207676_10080236
990 Ga0207676_10242315
991 Ga0207676_10363207
992 Ga0207676_10890318
993 Ga0207674_10041664
994 Ga0207674_10044135
995 Ga0207674_10135929
996 Ga0207674_10169680
997 Ga0207674_10270684
998 Ga0207675_100020278
999 Ga0207675_100163318
1000 Ga0207683_10002787
1001 Ga0207683_10075846
1002 Ga0207698_10004499
1003 Ga0209588_1014577
1004 Ga0209588_1063769
1005 Ga0207428_10012418
1006 Ga0268266_10014538
1007 Ga0268266_10015405
1008 Ga0268266_10047097
1009 Ga0268266_10196789
1010 Ga0268266_10395655
1011 Ga0268265_10516634
1012 Ga0268265_10527679
1013 Ga0268264_10001110
1014 Ga0268264_10694103
1015 Ga0268264_10837877
1016 Ga0265338_10092071
1017 Ga0265760_10035474
1018 Ga0265330_10005865
1019 Ga0265329_10055910
1020 Ga0265331_10032292
1021 Ga0265314_10010832
1022 Ga0265342_10071050
1023 Ga0307516_10000060
1024 Ga0307410_10024369
1025 Ga0307416_100796379
1026 Ga0307416_100832421
1027 Ga0307414_10128652
1028 Ga0307414_10259290
1029 Ga0373938_0063012
1030 Ga0373928_0027153
1031 Ga0373940_0003654
1032 Ga0373949_0017153
1033 Ga0373951_0001627
1034 Ga0373952_0023187
1035 Ga0373932_0002871
1036 Ga0373941_0081162
1037 Ga0373945_0061191
1038 Ga0373942_0000936
1039 Ga0373962_0001648
1040 Ga0373931_0004956
1041 Ga0373927_0256479
1042 Ga0373947_0120557
1043 Ga0373937_0598214
1044 Ga0373925_0373066
1045 Ga0436364_0874730
1046 Ga0395901_0770392
1047 Ga0436360_0692350
1048 Ga0439448_0002363
1049 Ga0439462_0012450
1050 Ga0439435_0115091
1051 Ga0439459_0002735
1052 Ga0450916_017672
1053 Ga0451577_0122414
1054 Ga0453683_0010546
1055 Ga0453683_0244295
1056 Ga0466966_0124082
1057 Ga0453684_0000422
1058 Ga0453684_0003812
1059 Ga0453684_0007404
1060 Ga0453684_0025411
1061 Ga0453684_0042111
1062 Ga0453684_0339329
1063 Ga0466959_0225613
1064 Ga0451576_0007668
1065 Ga0451576_0059671
1066 Ga0451576_0155746
1067 Ga0451576_0510115
1068 Ga0495629_0475634
1069 Ga0495580_0001703
1070 Ga0495580_0027342
1071 Ga0495645_0084951
1072 Ga0495645_0096995
1073 Ga0495668_0228409
1074 Ga0495635_0203412
1075 Ga0495623_0015700
1076 Ga0495647_0041845
1077 Ga0495647_0078657
1078 Ga0495604_0031883
1079 Ga0496100_0065529
1080 Ga0496100_0078753
1081 Ga0496100_0560381
1082 Ga0496101_0218135
1083 Ga0496102_0007981
1084 Ga0496102_0028045
1085 Ga0496103_0015722
1086 Ga0496103_0038506
1087 Ga0496103_0231335
1088 Ga0496104_0006323
1089 Ga0496104_0028037
1090 Ga0496104_0425044
1091 Ga0496105_0008423
1092 Ga0496105_0021043
1093 Ga0496105_0448289
1094 Ga0496106_0000937
1095 Ga0496106_0012598
1096 Ga0496106_0015913
1097 Ga0496106_0190884
1098 Ga0496107_0002505
1099 Ga0496107_0010331
1100 Ga0496108_0041635
1101 Ga0496108_0159315
1102 Ga0496108_0440784
1103 Ga0496108_0684399
1104 Ga0496109_0114056
1105 Ga0496109_0595856
1106 Ga0496110_0001394
1107 Ga0496110_0046631
1108 Ga0496110_0132275
1109 Ga0496111_0001106
1110 Ga0496112_0016915
1111 Ga0496112_0101896
1112 Ga0496112_0160866
1113 Ga0496112_0405403
1114 Ga0496113_0041565
1115 Ga0496113_0078573
1116 Ga0496113_0398107
1117 Ga0496114_0011002
1118 Ga0496114_0066266
1119 Ga0496114_0432063
1120 Ga0496115_0021616
1121 Ga0496115_0315854
1122 Ga0501075_0605342
1123 Ga0501079_0561383
1124 Ga0501080_0493369
1125 Ga0501081_0242444
1126 Ga0501045_0455940
1127 nmdc:mga05p37_152330_c1
1128 nmdc:mga05p37_189306_c1
1129 nmdc:mga05p37_208720_c1
1130 nmdc:mga09592_687532_c1
1131 nmdc:mga09592_96195_c1
1132 nmdc:mga06r32_595690_c1
1133 nmdc:mga08y16_20990_c1
1134 nmdc:mga0n895_214_c1
1135 nmdc:mga0n895_2395_c1
1136 nmdc:mga0n895_261304_c1
1137 nmdc:mga0n895_2973_c1
1138 nmdc:mga0n895_34781_c1
1139 nmdc:mga0n895_49601_c1
1140 nmdc:mga0n895_99741_c1
1141 nmdc:mga0rr50_14_c1
1142 nmdc:mga0rr50_163804_c1
1143 nmdc:mga0rr50_16671_c1
1144 nmdc:mga0rr50_19219_c1
1145 nmdc:mga0rr50_212823_c1
1146 nmdc:mga0rr50_21432_c1
1147 nmdc:mga0rr50_328677_c1
1148 nmdc:mga0rr50_60131_c1
1149 nmdc:mga0rr50_95304_c1
1150 nmdc:mga08x19_114291_c1
1151 nmdc:mga08x19_145_c1
1152 nmdc:mga08x19_15726_c1
1153 nmdc:mga08x19_423145_c1
1154 nmdc:mga08x19_47298_c1
1155 nmdc:mga0a205_32402_c1
1156 nmdc:mga0a205_3291_c1
1157 nmdc:mga0a205_44992_c1
1158 nmdc:mga0a205_9885_c1
1159 Ga0495601_0069145
1160 2904549806
1161 2928120792
1162 2929161773

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

19

214

0.94

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

14

251

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.99 5 259
3myb-assembly1.cif.gz_B crystal structure of enoyl-coa hydratase mycobacterium smegmatis 0.9786 5 259
3l3s-assembly2.cif.gz_F crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.9649 8 242
2vx2-assembly3.cif.gz_G crystal structure of human enoyl coenzyme a hydratase domain- containing protein 3 (echdc3) 0.9646 7 259
3l3s-assembly4.cif.gz_J crystal structure of an enoyl-coa hydrotase/isomerase family protein from silicibacter pomeroyi 0.9608 8 241
ID Description Score Start End Superfamily
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9932 5 204 3.90.226.10
3mybC01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9883 5 204 3.90.226.10
2vx2B02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9865 205 260 1.10.12.10
2vx2H02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9862 205 259 1.10.12.10
3mybB02 Mainly Alpha;Orthogonal Bundle;Lyase 2-enoyl-coa Hydratase; Chain;Lyase 2-enoyl-coa Hydratase, Chain 0.9818 205 259 1.10.12.10
ID Description Score Start End GO Terms
AF-A0A2W5FT57-F1-model_v4 deleted 0.9882 60 260
AF-A0A2G6HP14-F1-model_v4 deleted 0.9809 1 197
AF-A0A7W0NWT1-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9809 5 260 GO:0004300
GO:0006631
AF-K8XSR9-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.9783 35 260 GO:0006631
GO:0016836
AF-A0A3D3B0K3-F1-model_v4 Enoyl-CoA hydratase domain-containing protein 3, mitochondrial 0.973 109 261 GO:0006631
GO:0016836

Map