F465944

General Info

Members Datasets Scaffolds Average Seq Length
580 242 1160 299

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10337239|Ga0163163_103372392
Length 351
Sequence VWRPLRRELRLWGQAAWRALIGLLSRNDLTHAASIAYYSLLSLFPFLLLLLSILGFVTADEGDRARVLGFIFRYFPTRLDFMTDQLDAFRADSIRIGVAGGLGLVWASLGFFGAVTSAVNEAWGVEKQRSFWKHRLVSFLLLVAATVAMAVALVVVSFIQVAETSRVGQLLVGAPWFVALQTFVFRYLAMVLLMAGTGLVFYFIPNARTRFRDVWVGAILTGLLWRVALSGFSWYVRQNQRLSMIHGSITTVVVFLLWIYISSVILMYGVEFTAAYARLRRHRTETMPAAASPRTRDSGHQALGSGLVVVCSWPRRARQPWRWCRSRRRSKSGAPQTSRYASRCPSSRIPW

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
55 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
59 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
72 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
73 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
81 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
83 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
84 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
85 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
150 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
151 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
152 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
153 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
154 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
155 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
159 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
160 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
161 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
164 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
165 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
168 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
169 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
170 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
171 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
172 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
173 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
174 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
175 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
176 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
177 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
178 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
183 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
184 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
185 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
188 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
189 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
190 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
191 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
192 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
198 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
217 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
220 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
221 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
222 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
223 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
225 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
226 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
227 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
228 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
229 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
230 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
231 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
232 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
233 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
234 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
235 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
236 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
237 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
240 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.07
Rhizosphere 97.93
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10337239 3300014325 Bacteria 1563
2 JGI25406J46586_10000235 3300003203 Bacteria 24695
3 JGI25406J46586_10000273 3300003203 Bacteria 22927
4 Ga0065714_10114914 3300005288 Bacteria 1422
5 Ga0065712_10005708 3300005290 Bacteria 7309
6 Ga0065712_10011636 3300005290 Bacteria 3126
7 Ga0065712_10067869 3300005290 Bacteria 24284
8 Ga0065715_10027164 3300005293 Bacteria 1432
9 Ga0065707_10097424 3300005295 Bacteria 3174
10 Ga0070676_10004786 3300005328 Bacteria 7159
11 Ga0070676_10034448 3300005328 Bacteria 2908
12 Ga0070676_10045617 3300005328 Bacteria 2553
13 Ga0070683_100232407 3300005329 Bacteria 1753
14 Ga0070690_100065289 3300005330 Bacteria 2353
15 Ga0070690_100087021 3300005330 Bacteria 2052
16 Ga0070690_100151338 3300005330 Bacteria 1583
17 Ga0070670_100022550 3300005331 Bacteria 5418
18 Ga0070670_100240829 3300005331 Unclassified 1575
19 Ga0070677_10003647 3300005333 Bacteria 4974
20 Ga0070677_10083315 3300005333 Bacteria 1374
21 Ga0070677_10115177 3300005333 Bacteria 1206
22 Ga0068869_100015423 3300005334 Bacteria 5125
23 Ga0068869_100055419 3300005334 Bacteria 2889
24 Ga0068869_100137459 3300005334 Bacteria 1884
25 Ga0068869_100210520 3300005334 Bacteria 1537
26 Ga0070666_10086443 3300005335 Bacteria 2148
27 Ga0070666_10216969 3300005335 Bacteria 1348
28 Ga0070680_100074097 3300005336 Bacteria 2801
29 Ga0068868_100008626 3300005338 Bacteria 7299
30 Ga0068868_100286126 3300005338 Unclassified 1396
31 Ga0070660_100008495 3300005339 Bacteria 7187
32 Ga0070689_100023448 3300005340 Bacteria 4620
33 Ga0070689_100026340 3300005340 Bacteria 4377
34 Ga0070689_100034940 3300005340 Bacteria 3837
35 Ga0070691_10063057 3300005341 Bacteria 1786
36 Ga0070691_10099392 3300005341 Bacteria 1443
37 Ga0070661_100213867 3300005344 Bacteria 1477
38 Ga0070668_100098664 3300005347 Bacteria 2312
39 Ga0070669_100001014 3300005353 Bacteria 20446
40 Ga0070669_100014299 3300005353 Bacteria 5648
41 Ga0070669_100015252 3300005353 Bacteria 5474
42 Ga0070669_100022330 3300005353 Bacteria 4524
43 Ga0070669_100162163 3300005353 Bacteria 1738
44 Ga0070669_100256109 3300005353 Unclassified 1395
45 Ga0070675_100001382 3300005354 Bacteria 17782
46 Ga0070675_100005316 3300005354 Bacteria 9839
47 Ga0070675_100006685 3300005354 Bacteria 8863
48 Ga0070675_100014866 3300005354 Bacteria 6144
49 Ga0070675_100033497 3300005354 Bacteria 4166
50 Ga0070675_100035743 3300005354 Bacteria 4039
51 Ga0070675_100110529 3300005354 Bacteria 2324
52 Ga0070675_100177958 3300005354 Bacteria 1838
53 Ga0070675_100200425 3300005354 Bacteria 1732
54 Ga0070675_100322357 3300005354 Unclassified 1365
55 Ga0070671_100001881 3300005355 Bacteria 16043
56 Ga0070671_100208280 3300005355 Bacteria 1658
57 Ga0070671_100219488 3300005355 Bacteria 1613
58 Ga0070674_100001210 3300005356 Bacteria 13538
59 Ga0070674_100027905 3300005356 Bacteria 3703
60 Ga0070673_100031528 3300005364 Bacteria 3979
61 Ga0070673_100097537 3300005364 Bacteria 2414
62 Ga0070673_100115680 3300005364 Bacteria 2230
63 Ga0070673_100134360 3300005364 Bacteria 2080
64 Ga0070673_100376694 3300005364 Unclassified 1265
65 Ga0070688_100017797 3300005365 Bacteria 4085
66 Ga0070688_100037610 3300005365 Bacteria 2950
67 Ga0070688_100216482 3300005365 Bacteria 1348
68 Ga0070667_100222075 3300005367 Bacteria 1682
69 Ga0070709_10114147 3300005434 Bacteria 1820
70 Ga0070713_100020257 3300005436 Bacteria 5096
71 Ga0070701_10007624 3300005438 Bacteria 4637
72 Ga0070700_100038251 3300005441 Bacteria 2923
73 Ga0070700_100048558 3300005441 Bacteria 2631
74 Ga0070700_100072145 3300005441 Bacteria 2206
75 Ga0070700_100217469 3300005441 Bacteria 1352
76 Ga0070694_100187954 3300005444 Unclassified 1532
77 Ga0070708_100020049 3300005445 Bacteria 5631
78 Ga0070678_100057882 3300005456 Bacteria 2842
79 Ga0070662_100033368 3300005457 Bacteria 3624
80 Ga0070662_100106331 3300005457 Bacteria 2131
81 Ga0070662_100197655 3300005457 Bacteria 1594
82 Ga0070662_100231258 3300005457 Bacteria 1479
83 Ga0070681_10007676 3300005458 Bacteria 10549
84 Ga0070681_10320901 3300005458 Bacteria 1458
85 Ga0068867_100000659 3300005459 Bacteria 22852
86 Ga0068867_100004057 3300005459 Bacteria 10307
87 Ga0068867_100024495 3300005459 Bacteria 4324
88 Ga0068867_100069380 3300005459 Bacteria 2632
89 Ga0068867_100100299 3300005459 Unclassified 2210
90 Ga0068867_100260125 3300005459 Bacteria 1414
91 Ga0068867_100282753 3300005459 Unclassified 1361
92 Ga0070685_10097067 3300005466 Bacteria 1794
93 Ga0070698_100081015 3300005471 Bacteria 3241
94 Ga0070698_100191133 3300005471 Bacteria 1985
95 Ga0070698_100204667 3300005471 Bacteria 1909
96 Ga0070699_100002954 3300005518 Bacteria 15112
97 Ga0070699_100037073 3300005518 Bacteria 4219
98 Ga0070679_100075944 3300005530 Bacteria 3350
99 Ga0070679_100109839 3300005530 Bacteria 2744
100 Ga0070697_100140884 3300005536 Unclassified 2028
101 Ga0070672_100004473 3300005543 Bacteria 9156
102 Ga0070672_100005504 3300005543 Bacteria 8398
103 Ga0070672_100032301 3300005543 Bacteria 3949
104 Ga0070672_100033561 3300005543 Bacteria 3888
105 Ga0070672_100137236 3300005543 Bacteria 2015
106 Ga0070686_100011050 3300005544 Bacteria 5112
107 Ga0070686_100017740 3300005544 Bacteria 4165
108 Ga0070686_100030816 3300005544 Bacteria 3274
109 Ga0070686_100122635 3300005544 Bacteria 1786
110 Ga0070695_100062030 3300005545 Bacteria 2427
111 Ga0070695_100169724 3300005545 Bacteria 1538
112 Ga0070696_100004217 3300005546 Bacteria 9576
113 Ga0070696_100196394 3300005546 Bacteria 1504
114 Ga0070665_100001655 3300005548 Bacteria 25682
115 Ga0070665_100112708 3300005548 Bacteria 2722
116 Ga0070665_100383470 3300005548 Bacteria 1413
117 Ga0070665_100409869 3300005548 Unclassified 1363
118 Ga0070704_100000518 3300005549 Bacteria 18407
119 Ga0070704_100074594 3300005549 Bacteria 2475
120 Ga0070704_100216686 3300005549 Unclassified 1554
121 Ga0068855_100125797 3300005563 Bacteria 2931
122 Ga0070664_100003564 3300005564 Bacteria 12566
123 Ga0070664_100020858 3300005564 Bacteria 5398
124 Ga0070664_100086799 3300005564 Unclassified 2704
125 Ga0070664_100140852 3300005564 Bacteria 2123
126 Ga0070664_100193866 3300005564 Unclassified 1811
127 Ga0070664_100372898 3300005564 Bacteria 1301
128 Ga0070664_100374363 3300005564 Bacteria 1299
129 Ga0068857_100022626 3300005577 Bacteria 5528
130 Ga0068857_100163257 3300005577 Bacteria 2022
131 Ga0068854_100009997 3300005578 Bacteria 6142
132 Ga0068854_100123907 3300005578 Bacteria 1966
133 Ga0068854_100161390 3300005578 Bacteria 1736
134 Ga0068856_100474989 3300005614 Bacteria 1271
135 Ga0070702_100258445 3300005615 Unclassified 1184
136 Ga0068852_100112001 3300005616 Bacteria 2482
137 Ga0068852_100181020 3300005616 Bacteria 1982
138 Ga0068859_100002029 3300005617 Bacteria 20680
139 Ga0068859_100008555 3300005617 Bacteria 10348
140 Ga0068859_100023188 3300005617 Bacteria 6227
141 Ga0068859_100040146 3300005617 Bacteria 4698
142 Ga0068859_100042151 3300005617 Bacteria 4584
143 Ga0068859_100537215 3300005617 Bacteria 1264
144 Ga0068864_100080122 3300005618 Unclassified 2860
145 Ga0068864_100315040 3300005618 Bacteria 1468
146 Ga0068861_100022880 3300005719 Bacteria 4505
147 Ga0068870_10001038 3300005840 Bacteria 10959
148 Ga0068870_10207820 3300005840 Bacteria 1190
149 Ga0068863_100186437 3300005841 Bacteria 1993
150 Ga0068863_100255674 3300005841 Bacteria 1693
151 Ga0068863_100370597 3300005841 Bacteria 1397
152 Ga0068858_100028278 3300005842 Bacteria 5209
153 Ga0068858_100067357 3300005842 Bacteria 3316
154 Ga0068858_100201471 3300005842 Bacteria 1882
155 Ga0068858_100408445 3300005842 Unclassified 1305
156 Ga0068860_100003972 3300005843 Bacteria 15185
157 Ga0068860_100005490 3300005843 Bacteria 12847
158 Ga0068862_100000972 3300005844 Bacteria 27598
159 Ga0068862_100008818 3300005844 Bacteria 8350
160 Ga0068862_100048411 3300005844 Bacteria 3629
161 Ga0081539_10000017 3300005985 Bacteria 375107
162 Ga0081539_10000358 3300005985 Bacteria 100577
163 Ga0081539_10043503 3300005985 Bacteria 2603
164 Ga0070716_100145908 3300006173 Bacteria 1516
165 Ga0070712_100184980 3300006175 Bacteria 1626
166 Ga0097621_100051088 3300006237 Bacteria 3363
167 Ga0097621_100053616 3300006237 Bacteria 3287
168 Ga0097621_100255207 3300006237 Bacteria 1537
169 Ga0097621_100303589 3300006237 Bacteria 1410
170 Ga0068871_100186562 3300006358 Bacteria 1785
171 Ga0068871_100426147 3300006358 Bacteria 1185
172 Ga0075428_100008808 3300006844 Bacteria 11198
173 Ga0075428_100014304 3300006844 Bacteria 8823
174 Ga0075428_100020861 3300006844 Bacteria 7254
175 Ga0075428_100021769 3300006844 Bacteria 7098
176 Ga0075428_100037618 3300006844 Bacteria 5326
177 Ga0075428_100038458 3300006844 Bacteria 5265
178 Ga0075430_100000773 3300006846 Bacteria 24700
179 Ga0075430_100005205 3300006846 Bacteria 10963
180 Ga0075430_100030307 3300006846 Bacteria 4593
181 Ga0075431_100000711 3300006847 Bacteria 28704
182 Ga0075431_100018488 3300006847 Bacteria 7098
183 Ga0075431_100025499 3300006847 Bacteria 6060
184 Ga0075431_100045186 3300006847 Bacteria 4541
185 Ga0075431_100110588 3300006847 Bacteria 2835
186 Ga0075431_100396997 3300006847 Unclassified 1381
187 Ga0075433_10005075 3300006852 Bacteria 10323
188 Ga0075433_10017099 3300006852 Bacteria 5998
189 Ga0075433_10039366 3300006852 Bacteria 4087
190 Ga0075433_10044531 3300006852 Bacteria 3856
191 Ga0075433_10204716 3300006852 Unclassified 1754
192 Ga0075434_100010692 3300006871 Bacteria 8617
193 Ga0075434_100013035 3300006871 Bacteria 7894
194 Ga0075434_100039409 3300006871 Bacteria 4681
195 Ga0075434_100233019 3300006871 Bacteria 1861
196 Ga0075429_100006958 3300006880 Bacteria 9827
197 Ga0075429_100031804 3300006880 Bacteria 4587
198 Ga0075429_100050162 3300006880 Unclassified 3631
199 Ga0075429_100077348 3300006880 Bacteria 2899
200 Ga0075429_100092140 3300006880 Unclassified 2643
201 Ga0075429_100140304 3300006880 Unclassified 2115
202 Ga0075429_100187832 3300006880 Unclassified 1811
203 Ga0075429_100232104 3300006880 Bacteria 1616
204 Ga0068865_100035716 3300006881 Bacteria 3346
205 Ga0068865_100076272 3300006881 Bacteria 2392
206 Ga0097620_100002029 3300006931 Bacteria 20680
207 Ga0097620_100008555 3300006931 Bacteria 10348
208 Ga0097620_100023187 3300006931 Bacteria 6227
209 Ga0097620_100040143 3300006931 Bacteria 4698
210 Ga0097620_100042151 3300006931 Bacteria 4584
211 Ga0097620_100537144 3300006931 Bacteria 1264
212 Ga0075435_100006466 3300007076 Bacteria 8288
213 Ga0075435_100114372 3300007076 Bacteria 2246
214 Ga0075435_100192884 3300007076 Bacteria 1725
215 Ga0075435_100325061 3300007076 Unclassified 1317
216 Ga0105240_10453380 3300009093 Bacteria 1435
217 Ga0111539_10000111 3300009094 Bacteria 89076
218 Ga0111539_10001905 3300009094 Bacteria 27766
219 Ga0111539_10004419 3300009094 Bacteria 18380
220 Ga0111539_10006179 3300009094 Bacteria 15459
221 Ga0111539_10010168 3300009094 Bacteria 11857
222 Ga0111539_10050295 3300009094 Bacteria 4964
223 Ga0111539_10166164 3300009094 Bacteria 2580
224 Ga0111539_10167193 3300009094 Bacteria 2571
225 Ga0111539_10175379 3300009094 Unclassified 2504
226 Ga0111539_10328881 3300009094 Bacteria 1779
227 Ga0105247_10008214 3300009101 Bacteria 6368
228 Ga0105247_10009496 3300009101 Bacteria 5900
229 Ga0114129_10002087 3300009147 Bacteria 27478
230 Ga0114129_10002689 3300009147 Bacteria 24741
231 Ga0114129_10011893 3300009147 Bacteria 12381
232 Ga0114129_10022155 3300009147 Bacteria 9017
233 Ga0114129_10074825 3300009147 Bacteria 4717
234 Ga0114129_10183248 3300009147 Bacteria 2848
235 Ga0114129_10364324 3300009147 Bacteria 1912
236 Ga0105243_10007186 3300009148 Bacteria 8558
237 Ga0105243_10542707 3300009148 Unclassified 1109
238 Ga0105243_10665482 3300009148 Bacteria 1011
239 Ga0105241_10203327 3300009174 Bacteria 1656
240 Ga0105242_10004318 3300009176 Bacteria 11070
241 Ga0105242_10041206 3300009176 Bacteria 3724
242 Ga0105248_10017898 3300009177 Bacteria 7819
243 Ga0105248_10051824 3300009177 Bacteria 4605
244 Ga0105248_10060711 3300009177 Bacteria 4244
245 Ga0105248_10096527 3300009177 Bacteria 3330
246 Ga0105248_10175322 3300009177 Bacteria 2417
247 Ga0105248_10258337 3300009177 Bacteria 1961
248 Ga0105248_10271226 3300009177 Bacteria 1911
249 Ga0105248_10684552 3300009177 Unclassified 1157
250 Ga0105238_10011017 3300009551 Bacteria 9092
251 Ga0105249_10003136 3300009553 Bacteria 14292
252 Ga0105249_10035637 3300009553 Bacteria 4512
253 Ga0105246_10046282 3300011119 Bacteria 2966
254 Ga0105246_10121661 3300011119 Bacteria 1935
255 Ga0105246_10502189 3300011119 Bacteria 1030
256 Ga0157370_10330958 3300013104 Unclassified 1404
257 Ga0157374_10043774 3300013296 Bacteria 4137
258 Ga0157378_10202399 3300013297 Bacteria 1878
259 Ga0163162_10133918 3300013306 Bacteria 2588
260 Ga0163162_10166877 3300013306 Bacteria 2325
261 Ga0163162_10191617 3300013306 Bacteria 2172
262 Ga0163162_10529151 3300013306 Bacteria 1308
263 Ga0157375_10045779 3300013308 Bacteria 4259
264 Ga0157375_10070044 3300013308 Bacteria 3515
265 Ga0157375_10627661 3300013308 Bacteria 1232
266 Ga0163163_10011052 3300014325 Bacteria 8165
267 Ga0163163_10311112 3300014325 Unclassified 1628
268 Ga0163163_10532425 3300014325 Unclassified 1237
269 Ga0157380_10007887 3300014326 Bacteria 7578
270 Ga0157380_10055591 3300014326 Bacteria 3144
271 Ga0157380_10059636 3300014326 Bacteria 3046
272 Ga0157380_10064656 3300014326 Bacteria 2938
273 Ga0157380_10066455 3300014326 Bacteria 2900
274 Ga0157380_10107330 3300014326 Bacteria 2338
275 Ga0157380_10115359 3300014326 Bacteria 2265
276 Ga0157380_10134150 3300014326 Bacteria 2116
277 Ga0157380_10285803 3300014326 Bacteria 1512
278 Ga0157380_10678218 3300014326 Bacteria 1032
279 Ga0157377_10006208 3300014745 Bacteria 5684
280 Ga0157377_10015849 3300014745 Bacteria 3864
281 Ga0157379_10010494 3300014968 Bacteria 8074
282 Ga0157376_10007775 3300014969 Bacteria 7685
283 Ga0157376_10200327 3300014969 Bacteria 1836
284 Ga0157376_10211330 3300014969 Bacteria 1791
285 Ga0163161_10006782 3300017792 Bacteria 7912
286 Ga0163161_10028348 3300017792 Bacteria 3976
287 Ga0207697_10100856 3300025315 Bacteria 1230
288 Ga0207682_10001371 3300025893 Bacteria 11230
289 Ga0207642_10200431 3300025899 Bacteria 1102
290 Ga0207688_10001579 3300025901 Bacteria 12014
291 Ga0207688_10134622 3300025901 Unclassified 1450
292 Ga0207680_10032364 3300025903 Bacteria 2972
293 Ga0207680_10110266 3300025903 Bacteria 1784
294 Ga0207699_10403045 3300025906 Bacteria 974
295 Ga0207645_10011543 3300025907 Bacteria 6025
296 Ga0207645_10022449 3300025907 Bacteria 4105
297 Ga0207645_10039553 3300025907 Bacteria 3022
298 Ga0207645_10044926 3300025907 Bacteria 2825
299 Ga0207643_10001033 3300025908 Bacteria 16536
300 Ga0207643_10294555 3300025908 Bacteria 1009
301 Ga0207695_10041039 3300025913 Bacteria 4954
302 Ga0207693_10187145 3300025915 Bacteria 1629
303 Ga0207662_10074181 3300025918 Bacteria 2065
304 Ga0207657_10024463 3300025919 Bacteria 5589
305 Ga0207681_10019826 3300025923 Bacteria 4256
306 Ga0207681_10028043 3300025923 Bacteria 3645
307 Ga0207681_10118971 3300025923 Bacteria 1934
308 Ga0207681_10137495 3300025923 Bacteria 1815
309 Ga0207681_10153962 3300025923 Bacteria 1726
310 Ga0207650_10099462 3300025925 Bacteria 2236
311 Ga0207650_10100027 3300025925 Bacteria 2230
312 Ga0207650_10153376 3300025925 Bacteria 1820
313 Ga0207659_10000848 3300025926 Bacteria 18108
314 Ga0207659_10007437 3300025926 Bacteria 6734
315 Ga0207659_10012105 3300025926 Bacteria 5472
316 Ga0207659_10033373 3300025926 Bacteria 3542
317 Ga0207659_10042110 3300025926 Bacteria 3200
318 Ga0207659_10074387 3300025926 Unclassified 2490
319 Ga0207700_10020600 3300025928 Unclassified 4483
320 Ga0207644_10135844 3300025931 Bacteria 1888
321 Ga0207690_10142950 3300025932 Bacteria 1765
322 Ga0207706_10002105 3300025933 Bacteria 19489
323 Ga0207706_10081688 3300025933 Bacteria 2840
324 Ga0207706_10098226 3300025933 Bacteria 2575
325 Ga0207706_10403921 3300025933 Bacteria 1184
326 Ga0207686_10002853 3300025934 Bacteria 9321
327 Ga0207686_10027771 3300025934 Bacteria 3317
328 Ga0207686_10044614 3300025934 Bacteria 2723
329 Ga0207709_10022770 3300025935 Bacteria 3557
330 Ga0207670_10007463 3300025936 Bacteria 6101
331 Ga0207670_10107242 3300025936 Bacteria 2005
332 Ga0207670_10428592 3300025936 Bacteria 1063
333 Ga0207669_10000462 3300025937 Bacteria 17697
334 Ga0207669_10016643 3300025937 Bacteria 3743
335 Ga0207669_10148344 3300025937 Bacteria 1639
336 Ga0207665_10028932 3300025939 Bacteria 3663
337 Ga0207691_10000931 3300025940 Bacteria 29049
338 Ga0207691_10010522 3300025940 Bacteria 8878
339 Ga0207691_10022394 3300025940 Bacteria 5958
340 Ga0207691_10040439 3300025940 Bacteria 4307
341 Ga0207691_10240197 3300025940 Bacteria 1566
342 Ga0207691_10242627 3300025940 Bacteria 1557
343 Ga0207691_10317825 3300025940 Bacteria 1335
344 Ga0207711_10060217 3300025941 Bacteria 3271
345 Ga0207711_10096170 3300025941 Bacteria 2613
346 Ga0207711_10096972 3300025941 Bacteria 2603
347 Ga0207711_10106788 3300025941 Bacteria 2485
348 Ga0207711_10143195 3300025941 Bacteria 2152
349 Ga0207711_10161367 3300025941 Bacteria 2029
350 Ga0207711_10263816 3300025941 Bacteria 1584
351 Ga0207689_10002356 3300025942 Bacteria 17651
352 Ga0207689_10041572 3300025942 Bacteria 3804
353 Ga0207689_10119686 3300025942 Bacteria 2166
354 Ga0207689_10182971 3300025942 Bacteria 1728
355 Ga0207689_10320373 3300025942 Bacteria 1286
356 Ga0207661_10210274 3300025944 Bacteria 1714
357 Ga0207679_10067929 3300025945 Bacteria 2676
358 Ga0207679_10095205 3300025945 Bacteria 2314
359 Ga0207679_10104699 3300025945 Unclassified 2220
360 Ga0207679_10115975 3300025945 Bacteria 2123
361 Ga0207679_10127659 3300025945 Bacteria 2035
362 Ga0207667_10670358 3300025949 Bacteria 1041
363 Ga0207651_10017656 3300025960 Bacteria 4221
364 Ga0207651_10059613 3300025960 Bacteria 2645
365 Ga0207651_10080988 3300025960 Bacteria 2339
366 Ga0207651_10174625 3300025960 Bacteria 1698
367 Ga0207712_10053340 3300025961 Bacteria 2836
368 Ga0207668_10071896 3300025972 Bacteria 2473
369 Ga0207668_10458573 3300025972 Bacteria 1089
370 Ga0207640_10027119 3300025981 Bacteria 3487
371 Ga0207703_10022129 3300026035 Bacteria 4983
372 Ga0207703_10221824 3300026035 Bacteria 1691
373 Ga0207703_10347709 3300026035 Unclassified 1364
374 Ga0207708_10004299 3300026075 Bacteria 10483
375 Ga0207708_10020889 3300026075 Bacteria 4940
376 Ga0207708_10028468 3300026075 Bacteria 4231
377 Ga0207641_10198002 3300026088 Bacteria 1850
378 Ga0207648_10002501 3300026089 Bacteria 19725
379 Ga0207648_10037208 3300026089 Bacteria 4286
380 Ga0207648_10061510 3300026089 Bacteria 3274
381 Ga0207648_10074521 3300026089 Bacteria 2958
382 Ga0207648_10096118 3300026089 Bacteria 2592
383 Ga0207648_10181831 3300026089 Bacteria 1861
384 Ga0207648_10195284 3300026089 Bacteria 1794
385 Ga0207648_10411940 3300026089 Bacteria 1226
386 Ga0207676_10043784 3300026095 Bacteria 3449
387 Ga0207676_10170686 3300026095 Unclassified 1895
388 Ga0207676_10291111 3300026095 Unclassified 1487
389 Ga0207676_10733057 3300026095 Unclassified 960
390 Ga0207674_10039280 3300026116 Bacteria 4908
391 Ga0207675_100015123 3300026118 Bacteria 7197
392 Ga0207675_100019837 3300026118 Bacteria 6274
393 Ga0207675_100203829 3300026118 Bacteria 1900
394 Ga0207683_10026217 3300026121 Bacteria 5031
395 Ga0207683_10059221 3300026121 Bacteria 3365
396 Ga0207683_10481043 3300026121 Bacteria 1146
397 Ga0210002_1012705 3300027617 Bacteria 1310
398 Ga0209974_10054981 3300027876 Bacteria 1342
399 Ga0207428_10001325 3300027907 Bacteria 26367
400 Ga0207428_10001462 3300027907 Bacteria 24707
401 Ga0207428_10003407 3300027907 Bacteria 15450
402 Ga0207428_10005615 3300027907 Bacteria 11662
403 Ga0207428_10025922 3300027907 Bacteria 4898
404 Ga0207428_10025957 3300027907 Bacteria 4895
405 Ga0207428_10142126 3300027907 Unclassified 1831
406 Ga0268266_10007482 3300028379 Bacteria 9844
407 Ga0268265_10003214 3300028380 Bacteria 11865
408 Ga0268265_10041751 3300028380 Bacteria 3398
409 Ga0268265_10396309 3300028380 Bacteria 1275
410 Ga0268264_10031089 3300028381 Bacteria 4377
411 Ga0268264_10097678 3300028381 Bacteria 2546
412 Ga0268264_10214839 3300028381 Bacteria 1768
413 Ga0268264_10401020 3300028381 Unclassified 1318
414 Ga0265332_10055994 3300031238 Bacteria 1690
415 Ga0307408_100440621 3300031548 Bacteria 1128
416 Ga0265314_10060414 3300031711 Bacteria 2587
417 Ga0307405_10012523 3300031731 Bacteria 4494
418 Ga0307413_10168982 3300031824 Bacteria 1545
419 Ga0307410_10005570 3300031852 Bacteria 6686
420 Ga0307410_10127260 3300031852 Bacteria 1866
421 Ga0307410_10405979 3300031852 Bacteria 1102
422 Ga0307406_10139745 3300031901 Bacteria 1712
423 Ga0307407_10004499 3300031903 Bacteria 5930
424 Ga0307407_10046386 3300031903 Bacteria 2460
425 Ga0307412_10111847 3300031911 Bacteria 1951
426 Ga0307409_100010407 3300031995 Bacteria 5782
427 Ga0307409_100152742 3300031995 Bacteria 2007
428 Ga0307409_100672188 3300031995 Bacteria 1032
429 Ga0307416_100011541 3300032002 Bacteria 5901
430 Ga0307416_100020349 3300032002 Bacteria 4732
431 Ga0307416_100310201 3300032002 Bacteria 1574
432 Ga0307416_100477242 3300032002 Unclassified 1306
433 Ga0307414_10057713 3300032004 Bacteria 2730
434 Ga0307414_10088789 3300032004 Bacteria 2289
435 Ga0307414_10185067 3300032004 Bacteria 1679
436 Ga0307411_10038488 3300032005 Bacteria 3017
437 Ga0307415_100301358 3300032126 Bacteria 1328
438 Ga0373948_0001028 3300034817 Bacteria 3757
439 Ga0373959_0002966 3300034820 Bacteria 2695
440 Ga0373940_0001036 3300035088 Bacteria 4787
441 Ga0373949_0024132 3300035090 Bacteria 1412
442 Ga0373951_0001168 3300035091 Bacteria 6936
443 Ga0373952_0003916 3300035092 Bacteria 2694
444 Ga0373932_0000813 3300035112 Bacteria 9235
445 Ga0373939_0040265 3300035114 Bacteria 1402
446 Ga0373941_0000058 3300035115 Bacteria 17110
447 Ga0373942_0004135 3300035207 Bacteria 3379
448 Ga0373961_0003929 3300035241 Bacteria 3629
449 Ga0373962_0002832 3300035242 Bacteria 4145
450 Ga0373931_0011883 3300035691 Bacteria 4211
451 Ga0439439_0029874 3300041406 Bacteria 1384
452 Ga0439446_0030797 3300042156 Bacteria 1551
453 Ga0439440_0025164 3300042993 Unclassified 1369
454 Ga0451576_0041748 3300045051 Bacteria 4848
455 Ga0451576_0055832 3300045051 Bacteria 4131
456 Ga0451576_0063411 3300045051 Bacteria 3852
457 Ga0451576_0085245 3300045051 Bacteria 3286
458 Ga0451576_0103509 3300045051 Unclassified 2961
459 Ga0495603_0125460 3300046455 Bacteria 1496
460 Ga0495582_0056181 3300046473 Bacteria 2170
461 Ga0495639_0105362 3300046475 Bacteria 1335
462 Ga0495594_0013821 3300046499 Bacteria 4221
463 Ga0495643_0002446 3300046522 Bacteria 14706
464 Ga0495644_0083053 3300046523 Bacteria 1208
465 Ga0495598_0005156 3300046537 Bacteria 2880
466 Ga0495598_0058676 3300046537 Bacteria 1181
467 Ga0495609_0042803 3300046538 Bacteria 2034
468 Ga0495621_0005925 3300046539 Bacteria 3542
469 Ga0495621_0015905 3300046539 Bacteria 2406
470 Ga0495621_0016512 3300046539 Bacteria 2371
471 Ga0495621_0044151 3300046539 Unclassified 1575
472 Ga0495621_0093340 3300046539 Bacteria 1137
473 Ga0495634_0092328 3300046642 Bacteria 1964
474 Ga0495659_0037121 3300046664 Bacteria 1725
475 Ga0495588_0086310 3300046674 Bacteria 1641
476 Ga0495581_0103819 3300047315 Unclassified 1652
477 Ga0495636_0037326 3300047318 Bacteria 2007
478 Ga0496102_0338315 3300048905 Bacteria 1418
479 Ga0496104_0053459 3300048907 Bacteria 3816
480 Ga0496105_0117690 3300048908 Bacteria 2192
481 Ga0496105_0237461 3300048908 Unclassified 1480
482 Ga0496106_0281581 3300048909 Unclassified 1332
483 Ga0496108_0259031 3300048911 Bacteria 1514
484 Ga0496109_0051275 3300048912 Bacteria 3759
485 Ga0496110_0161392 3300048913 Bacteria 2032
486 Ga0496112_0017697 3300048915 Bacteria 6705
487 Ga0496113_0136855 3300048916 Bacteria 1925
488 Ga0496114_0010595 3300048917 Bacteria 7335
489 Ga0496114_0041146 3300048917 Bacteria 3829
490 Ga0501031_0086095 3300049568 Bacteria 2049
491 Ga0501032_0122570 3300049569 Bacteria 1718
492 Ga0501032_0175298 3300049569 Bacteria 1405
493 Ga0501033_0066258 3300049570 Bacteria 2656
494 Ga0501033_0195571 3300049570 Bacteria 1446
495 Ga0501034_0040478 3300049571 Bacteria 4718
496 Ga0501036_0051114 3300049572 Bacteria 3500
497 Ga0501037_0050747 3300049573 Bacteria 3036
498 Ga0501039_0064705 3300049575 Bacteria 2835
499 Ga0501039_0173089 3300049575 Bacteria 1697
500 Ga0501040_0008800 3300049576 Bacteria 6559
501 Ga0501040_0046952 3300049576 Bacteria 2948
502 Ga0501041_0001450 3300049577 Bacteria 13103
503 Ga0501042_0001308 3300049578 Bacteria 14511
504 Ga0501042_0022222 3300049578 Bacteria 4431
505 Ga0501043_0087839 3300049579 Bacteria 2443
506 Ga0501046_0068380 3300049580 Bacteria 2765
507 Ga0501047_0049772 3300049581 Bacteria 4046
508 Ga0501048_0011671 3300049582 Bacteria 6553
509 Ga0501071_0019058 3300049587 Bacteria 4761
510 Ga0501071_0178434 3300049587 Bacteria 1591
511 Ga0501072_0073118 3300049588 Bacteria 2710
512 Ga0501075_0001901 3300049591 Bacteria 13784
513 Ga0501076_0004206 3300049592 Bacteria 10192
514 Ga0501077_0186699 3300049593 Unclassified 1317
515 Ga0501081_0013212 3300049743 Bacteria 5429
516 Ga0501283_015741 3300049779 Unclassified 1167
517 Ga0501035_0124631 3300049822 Bacteria 2249
518 Ga0501045_0016109 3300049824 Bacteria 5304
519 Ga0501045_0044031 3300049824 Bacteria 3250
520 Ga0501045_0180770 3300049824 Bacteria 1572
521 nmdc:mga05p37_1042_c1 3300050507 Bacteria 31584
522 nmdc:mga05p37_127582_c1 3300050507 Bacteria 3123
523 nmdc:mga05p37_192323_c1 3300050507 Bacteria 2476
524 nmdc:mga05p37_257633_c1 3300050507 Unclassified 2090
525 nmdc:mga05p37_490915_c1 3300050507 Bacteria 1412
526 nmdc:mga05p37_49140_c1 3300050507 Bacteria 5188
527 nmdc:mga05p37_82561_c1 3300050507 Bacteria 3960
528 nmdc:mga09592_109458_c1 3300050508 Unclassified 2370
529 nmdc:mga09592_116845_c1 3300050508 Bacteria 2290
530 nmdc:mga09592_161191_c1 3300050508 Bacteria 1937
531 nmdc:mga09592_19837_c1 3300050508 Bacteria 5523
532 nmdc:mga09592_5515_c1 3300050508 Bacteria 10295
533 nmdc:mga09592_67773_c1 3300050508 Bacteria 3027
534 nmdc:mga09592_95116_c1 3300050508 Bacteria 2548
535 nmdc:mga0qj67_12051_c1 3300050509 Bacteria 6501
536 nmdc:mga0qj67_128060_c1 3300050509 Bacteria 2055
537 nmdc:mga0qj67_141281_c1 3300050509 Bacteria 1952
538 nmdc:mga0qj67_6897_c1 3300050509 Bacteria 8359
539 nmdc:mga06r32_117196_c1 3300050510 Unclassified 2625
540 nmdc:mga06r32_27961_c1 3300050510 Bacteria 5275
541 nmdc:mga06r32_446670_c1 3300050510 Bacteria 1273
542 nmdc:mga08y16_151489_c1 3300050511 Unclassified 2410
543 nmdc:mga08y16_240250_c1 3300050511 Bacteria 1872
544 nmdc:mga08y16_459_c1 3300050511 Bacteria 37980
545 nmdc:mga08y16_4731_c1 3300050511 Bacteria 14196
546 nmdc:mga08y16_504021_c1 3300050511 Unclassified 1229
547 nmdc:mga08y16_52183_c1 3300050511 Bacteria 4279
548 nmdc:mga08y16_61535_c1 3300050511 Bacteria 3920
549 nmdc:mga08y16_7447_c1 3300050511 Bacteria 11466
550 nmdc:mga08y16_8357_c1 3300050511 Bacteria 10829
551 nmdc:mga08y16_9810_c1 3300050511 Bacteria 10050
552 nmdc:mga0n895_205889_c1 3300050512 Bacteria 1998
553 nmdc:mga0n895_206257_c1 3300050512 Bacteria 1996
554 nmdc:mga0n895_31535_c1 3300050512 Bacteria 5076
555 nmdc:mga0n895_37108_c1 3300050512 Bacteria 4712
556 nmdc:mga0n895_94048_c1 3300050512 Bacteria 3001
557 nmdc:mga0rr50_254918_c1 3300050513 Unclassified 1458
558 nmdc:mga0rr50_2576_c1 3300050513 Bacteria 10266
559 nmdc:mga0rr50_38227_c1 3300050513 Bacteria 3471
560 nmdc:mga0rr50_38895_c1 3300050513 Bacteria 3447
561 nmdc:mga0rr50_420905_c1 3300050513 Unclassified 1130
562 nmdc:mga08x19_33002_c1 3300050514 Bacteria 3266
563 nmdc:mga08x19_71011_c1 3300050514 Bacteria 2270
564 nmdc:mga0a205_19880_c1 3300050515 Bacteria 6335
565 nmdc:mga0a205_306_c1 3300050515 Bacteria 36284
566 nmdc:mga0a205_37275_c1 3300050515 Bacteria 4675
567 nmdc:mga0a205_47206_c1 3300050515 Bacteria 4155
568 nmdc:mga0a205_78802_c1 3300050515 Bacteria 3183
569 Ga0495601_0161121 3300053077 Bacteria 1466
570 Ga0495619_0027386 3300053085 Bacteria 3670
571 Ga0501084_0006802 3300054114 Bacteria 9406
572 Ga0501084_0206218 3300054114 Unclassified 1659
573 Ga0590071_000027 3300059421 Bacteria 37630
574 Ga0590071_018652 3300059421 Bacteria 1631
575 Ga0590074_003436 3300059423 Bacteria 2615
576 Ga0590075_019451 3300059424 Bacteria 1686
577 Ga0590077_000703 3300059426 Bacteria 8846
578 Ga0501082_0004178 3300060353 Bacteria 12623
579 Ga0530510_0014069 3300061734 Bacteria 5641
580 Ga0530510_0015039 3300061734 Bacteria 5465
581 Ga0163163_10337239
582 JGI25406J46586_10000235
583 JGI25406J46586_10000273
584 Ga0065714_10114914
585 Ga0065712_10005708
586 Ga0065712_10011636
587 Ga0065712_10067869
588 Ga0065715_10027164
589 Ga0065707_10097424
590 Ga0070676_10004786
591 Ga0070676_10034448
592 Ga0070676_10045617
593 Ga0070683_100232407
594 Ga0070690_100065289
595 Ga0070690_100087021
596 Ga0070690_100151338
597 Ga0070670_100022550
598 Ga0070670_100240829
599 Ga0070677_10003647
600 Ga0070677_10083315
601 Ga0070677_10115177
602 Ga0068869_100015423
603 Ga0068869_100055419
604 Ga0068869_100137459
605 Ga0068869_100210520
606 Ga0070666_10086443
607 Ga0070666_10216969
608 Ga0070680_100074097
609 Ga0068868_100008626
610 Ga0068868_100286126
611 Ga0070660_100008495
612 Ga0070689_100023448
613 Ga0070689_100026340
614 Ga0070689_100034940
615 Ga0070691_10063057
616 Ga0070691_10099392
617 Ga0070661_100213867
618 Ga0070668_100098664
619 Ga0070669_100001014
620 Ga0070669_100014299
621 Ga0070669_100015252
622 Ga0070669_100022330
623 Ga0070669_100162163
624 Ga0070669_100256109
625 Ga0070675_100001382
626 Ga0070675_100005316
627 Ga0070675_100006685
628 Ga0070675_100014866
629 Ga0070675_100033497
630 Ga0070675_100035743
631 Ga0070675_100110529
632 Ga0070675_100177958
633 Ga0070675_100200425
634 Ga0070675_100322357
635 Ga0070671_100001881
636 Ga0070671_100208280
637 Ga0070671_100219488
638 Ga0070674_100001210
639 Ga0070674_100027905
640 Ga0070673_100031528
641 Ga0070673_100097537
642 Ga0070673_100115680
643 Ga0070673_100134360
644 Ga0070673_100376694
645 Ga0070688_100017797
646 Ga0070688_100037610
647 Ga0070688_100216482
648 Ga0070667_100222075
649 Ga0070709_10114147
650 Ga0070713_100020257
651 Ga0070701_10007624
652 Ga0070700_100038251
653 Ga0070700_100048558
654 Ga0070700_100072145
655 Ga0070700_100217469
656 Ga0070694_100187954
657 Ga0070708_100020049
658 Ga0070678_100057882
659 Ga0070662_100033368
660 Ga0070662_100106331
661 Ga0070662_100197655
662 Ga0070662_100231258
663 Ga0070681_10007676
664 Ga0070681_10320901
665 Ga0068867_100000659
666 Ga0068867_100004057
667 Ga0068867_100024495
668 Ga0068867_100069380
669 Ga0068867_100100299
670 Ga0068867_100260125
671 Ga0068867_100282753
672 Ga0070685_10097067
673 Ga0070698_100081015
674 Ga0070698_100191133
675 Ga0070698_100204667
676 Ga0070699_100002954
677 Ga0070699_100037073
678 Ga0070679_100075944
679 Ga0070679_100109839
680 Ga0070697_100140884
681 Ga0070672_100004473
682 Ga0070672_100005504
683 Ga0070672_100032301
684 Ga0070672_100033561
685 Ga0070672_100137236
686 Ga0070686_100011050
687 Ga0070686_100017740
688 Ga0070686_100030816
689 Ga0070686_100122635
690 Ga0070695_100062030
691 Ga0070695_100169724
692 Ga0070696_100004217
693 Ga0070696_100196394
694 Ga0070665_100001655
695 Ga0070665_100112708
696 Ga0070665_100383470
697 Ga0070665_100409869
698 Ga0070704_100000518
699 Ga0070704_100074594
700 Ga0070704_100216686
701 Ga0068855_100125797
702 Ga0070664_100003564
703 Ga0070664_100020858
704 Ga0070664_100086799
705 Ga0070664_100140852
706 Ga0070664_100193866
707 Ga0070664_100372898
708 Ga0070664_100374363
709 Ga0068857_100022626
710 Ga0068857_100163257
711 Ga0068854_100009997
712 Ga0068854_100123907
713 Ga0068854_100161390
714 Ga0068856_100474989
715 Ga0070702_100258445
716 Ga0068852_100112001
717 Ga0068852_100181020
718 Ga0068859_100002029
719 Ga0068859_100008555
720 Ga0068859_100023188
721 Ga0068859_100040146
722 Ga0068859_100042151
723 Ga0068859_100537215
724 Ga0068864_100080122
725 Ga0068864_100315040
726 Ga0068861_100022880
727 Ga0068870_10001038
728 Ga0068870_10207820
729 Ga0068863_100186437
730 Ga0068863_100255674
731 Ga0068863_100370597
732 Ga0068858_100028278
733 Ga0068858_100067357
734 Ga0068858_100201471
735 Ga0068858_100408445
736 Ga0068860_100003972
737 Ga0068860_100005490
738 Ga0068862_100000972
739 Ga0068862_100008818
740 Ga0068862_100048411
741 Ga0081539_10000017
742 Ga0081539_10000358
743 Ga0081539_10043503
744 Ga0070716_100145908
745 Ga0070712_100184980
746 Ga0097621_100051088
747 Ga0097621_100053616
748 Ga0097621_100255207
749 Ga0097621_100303589
750 Ga0068871_100186562
751 Ga0068871_100426147
752 Ga0075428_100008808
753 Ga0075428_100014304
754 Ga0075428_100020861
755 Ga0075428_100021769
756 Ga0075428_100037618
757 Ga0075428_100038458
758 Ga0075430_100000773
759 Ga0075430_100005205
760 Ga0075430_100030307
761 Ga0075431_100000711
762 Ga0075431_100018488
763 Ga0075431_100025499
764 Ga0075431_100045186
765 Ga0075431_100110588
766 Ga0075431_100396997
767 Ga0075433_10005075
768 Ga0075433_10017099
769 Ga0075433_10039366
770 Ga0075433_10044531
771 Ga0075433_10204716
772 Ga0075434_100010692
773 Ga0075434_100013035
774 Ga0075434_100039409
775 Ga0075434_100233019
776 Ga0075429_100006958
777 Ga0075429_100031804
778 Ga0075429_100050162
779 Ga0075429_100077348
780 Ga0075429_100092140
781 Ga0075429_100140304
782 Ga0075429_100187832
783 Ga0075429_100232104
784 Ga0068865_100035716
785 Ga0068865_100076272
786 Ga0097620_100002029
787 Ga0097620_100008555
788 Ga0097620_100023187
789 Ga0097620_100040143
790 Ga0097620_100042151
791 Ga0097620_100537144
792 Ga0075435_100006466
793 Ga0075435_100114372
794 Ga0075435_100192884
795 Ga0075435_100325061
796 Ga0105240_10453380
797 Ga0111539_10000111
798 Ga0111539_10001905
799 Ga0111539_10004419
800 Ga0111539_10006179
801 Ga0111539_10010168
802 Ga0111539_10050295
803 Ga0111539_10166164
804 Ga0111539_10167193
805 Ga0111539_10175379
806 Ga0111539_10328881
807 Ga0105247_10008214
808 Ga0105247_10009496
809 Ga0114129_10002087
810 Ga0114129_10002689
811 Ga0114129_10011893
812 Ga0114129_10022155
813 Ga0114129_10074825
814 Ga0114129_10183248
815 Ga0114129_10364324
816 Ga0105243_10007186
817 Ga0105243_10542707
818 Ga0105243_10665482
819 Ga0105241_10203327
820 Ga0105242_10004318
821 Ga0105242_10041206
822 Ga0105248_10017898
823 Ga0105248_10051824
824 Ga0105248_10060711
825 Ga0105248_10096527
826 Ga0105248_10175322
827 Ga0105248_10258337
828 Ga0105248_10271226
829 Ga0105248_10684552
830 Ga0105238_10011017
831 Ga0105249_10003136
832 Ga0105249_10035637
833 Ga0105246_10046282
834 Ga0105246_10121661
835 Ga0105246_10502189
836 Ga0157370_10330958
837 Ga0157374_10043774
838 Ga0157378_10202399
839 Ga0163162_10133918
840 Ga0163162_10166877
841 Ga0163162_10191617
842 Ga0163162_10529151
843 Ga0157375_10045779
844 Ga0157375_10070044
845 Ga0157375_10627661
846 Ga0163163_10011052
847 Ga0163163_10311112
848 Ga0163163_10532425
849 Ga0157380_10007887
850 Ga0157380_10055591
851 Ga0157380_10059636
852 Ga0157380_10064656
853 Ga0157380_10066455
854 Ga0157380_10107330
855 Ga0157380_10115359
856 Ga0157380_10134150
857 Ga0157380_10285803
858 Ga0157380_10678218
859 Ga0157377_10006208
860 Ga0157377_10015849
861 Ga0157379_10010494
862 Ga0157376_10007775
863 Ga0157376_10200327
864 Ga0157376_10211330
865 Ga0163161_10006782
866 Ga0163161_10028348
867 Ga0207697_10100856
868 Ga0207682_10001371
869 Ga0207642_10200431
870 Ga0207688_10001579
871 Ga0207688_10134622
872 Ga0207680_10032364
873 Ga0207680_10110266
874 Ga0207699_10403045
875 Ga0207645_10011543
876 Ga0207645_10022449
877 Ga0207645_10039553
878 Ga0207645_10044926
879 Ga0207643_10001033
880 Ga0207643_10294555
881 Ga0207695_10041039
882 Ga0207693_10187145
883 Ga0207662_10074181
884 Ga0207657_10024463
885 Ga0207681_10019826
886 Ga0207681_10028043
887 Ga0207681_10118971
888 Ga0207681_10137495
889 Ga0207681_10153962
890 Ga0207650_10099462
891 Ga0207650_10100027
892 Ga0207650_10153376
893 Ga0207659_10000848
894 Ga0207659_10007437
895 Ga0207659_10012105
896 Ga0207659_10033373
897 Ga0207659_10042110
898 Ga0207659_10074387
899 Ga0207700_10020600
900 Ga0207644_10135844
901 Ga0207690_10142950
902 Ga0207706_10002105
903 Ga0207706_10081688
904 Ga0207706_10098226
905 Ga0207706_10403921
906 Ga0207686_10002853
907 Ga0207686_10027771
908 Ga0207686_10044614
909 Ga0207709_10022770
910 Ga0207670_10007463
911 Ga0207670_10107242
912 Ga0207670_10428592
913 Ga0207669_10000462
914 Ga0207669_10016643
915 Ga0207669_10148344
916 Ga0207665_10028932
917 Ga0207691_10000931
918 Ga0207691_10010522
919 Ga0207691_10022394
920 Ga0207691_10040439
921 Ga0207691_10240197
922 Ga0207691_10242627
923 Ga0207691_10317825
924 Ga0207711_10060217
925 Ga0207711_10096170
926 Ga0207711_10096972
927 Ga0207711_10106788
928 Ga0207711_10143195
929 Ga0207711_10161367
930 Ga0207711_10263816
931 Ga0207689_10002356
932 Ga0207689_10041572
933 Ga0207689_10119686
934 Ga0207689_10182971
935 Ga0207689_10320373
936 Ga0207661_10210274
937 Ga0207679_10067929
938 Ga0207679_10095205
939 Ga0207679_10104699
940 Ga0207679_10115975
941 Ga0207679_10127659
942 Ga0207667_10670358
943 Ga0207651_10017656
944 Ga0207651_10059613
945 Ga0207651_10080988
946 Ga0207651_10174625
947 Ga0207712_10053340
948 Ga0207668_10071896
949 Ga0207668_10458573
950 Ga0207640_10027119
951 Ga0207703_10022129
952 Ga0207703_10221824
953 Ga0207703_10347709
954 Ga0207708_10004299
955 Ga0207708_10020889
956 Ga0207708_10028468
957 Ga0207641_10198002
958 Ga0207648_10002501
959 Ga0207648_10037208
960 Ga0207648_10061510
961 Ga0207648_10074521
962 Ga0207648_10096118
963 Ga0207648_10181831
964 Ga0207648_10195284
965 Ga0207648_10411940
966 Ga0207676_10043784
967 Ga0207676_10170686
968 Ga0207676_10291111
969 Ga0207676_10733057
970 Ga0207674_10039280
971 Ga0207675_100015123
972 Ga0207675_100019837
973 Ga0207675_100203829
974 Ga0207683_10026217
975 Ga0207683_10059221
976 Ga0207683_10481043
977 Ga0210002_1012705
978 Ga0209974_10054981
979 Ga0207428_10001325
980 Ga0207428_10001462
981 Ga0207428_10003407
982 Ga0207428_10005615
983 Ga0207428_10025922
984 Ga0207428_10025957
985 Ga0207428_10142126
986 Ga0268266_10007482
987 Ga0268265_10003214
988 Ga0268265_10041751
989 Ga0268265_10396309
990 Ga0268264_10031089
991 Ga0268264_10097678
992 Ga0268264_10214839
993 Ga0268264_10401020
994 Ga0265332_10055994
995 Ga0307408_100440621
996 Ga0265314_10060414
997 Ga0307405_10012523
998 Ga0307413_10168982
999 Ga0307410_10005570
1000 Ga0307410_10127260
1001 Ga0307410_10405979
1002 Ga0307406_10139745
1003 Ga0307407_10004499
1004 Ga0307407_10046386
1005 Ga0307412_10111847
1006 Ga0307409_100010407
1007 Ga0307409_100152742
1008 Ga0307409_100672188
1009 Ga0307416_100011541
1010 Ga0307416_100020349
1011 Ga0307416_100310201
1012 Ga0307416_100477242
1013 Ga0307414_10057713
1014 Ga0307414_10088789
1015 Ga0307414_10185067
1016 Ga0307411_10038488
1017 Ga0307415_100301358
1018 Ga0373948_0001028
1019 Ga0373959_0002966
1020 Ga0373940_0001036
1021 Ga0373949_0024132
1022 Ga0373951_0001168
1023 Ga0373952_0003916
1024 Ga0373932_0000813
1025 Ga0373939_0040265
1026 Ga0373941_0000058
1027 Ga0373942_0004135
1028 Ga0373961_0003929
1029 Ga0373962_0002832
1030 Ga0373931_0011883
1031 Ga0439439_0029874
1032 Ga0439446_0030797
1033 Ga0439440_0025164
1034 Ga0451576_0041748
1035 Ga0451576_0055832
1036 Ga0451576_0063411
1037 Ga0451576_0085245
1038 Ga0451576_0103509
1039 Ga0495603_0125460
1040 Ga0495582_0056181
1041 Ga0495639_0105362
1042 Ga0495594_0013821
1043 Ga0495643_0002446
1044 Ga0495644_0083053
1045 Ga0495598_0005156
1046 Ga0495598_0058676
1047 Ga0495609_0042803
1048 Ga0495621_0005925
1049 Ga0495621_0015905
1050 Ga0495621_0016512
1051 Ga0495621_0044151
1052 Ga0495621_0093340
1053 Ga0495634_0092328
1054 Ga0495659_0037121
1055 Ga0495588_0086310
1056 Ga0495581_0103819
1057 Ga0495636_0037326
1058 Ga0496102_0338315
1059 Ga0496104_0053459
1060 Ga0496105_0117690
1061 Ga0496105_0237461
1062 Ga0496106_0281581
1063 Ga0496108_0259031
1064 Ga0496109_0051275
1065 Ga0496110_0161392
1066 Ga0496112_0017697
1067 Ga0496113_0136855
1068 Ga0496114_0010595
1069 Ga0496114_0041146
1070 Ga0501031_0086095
1071 Ga0501032_0122570
1072 Ga0501032_0175298
1073 Ga0501033_0066258
1074 Ga0501033_0195571
1075 Ga0501034_0040478
1076 Ga0501036_0051114
1077 Ga0501037_0050747
1078 Ga0501039_0064705
1079 Ga0501039_0173089
1080 Ga0501040_0008800
1081 Ga0501040_0046952
1082 Ga0501041_0001450
1083 Ga0501042_0001308
1084 Ga0501042_0022222
1085 Ga0501043_0087839
1086 Ga0501046_0068380
1087 Ga0501047_0049772
1088 Ga0501048_0011671
1089 Ga0501071_0019058
1090 Ga0501071_0178434
1091 Ga0501072_0073118
1092 Ga0501075_0001901
1093 Ga0501076_0004206
1094 Ga0501077_0186699
1095 Ga0501081_0013212
1096 Ga0501283_015741
1097 Ga0501035_0124631
1098 Ga0501045_0016109
1099 Ga0501045_0044031
1100 Ga0501045_0180770
1101 nmdc:mga05p37_1042_c1
1102 nmdc:mga05p37_127582_c1
1103 nmdc:mga05p37_192323_c1
1104 nmdc:mga05p37_257633_c1
1105 nmdc:mga05p37_490915_c1
1106 nmdc:mga05p37_49140_c1
1107 nmdc:mga05p37_82561_c1
1108 nmdc:mga09592_109458_c1
1109 nmdc:mga09592_116845_c1
1110 nmdc:mga09592_161191_c1
1111 nmdc:mga09592_19837_c1
1112 nmdc:mga09592_5515_c1
1113 nmdc:mga09592_67773_c1
1114 nmdc:mga09592_95116_c1
1115 nmdc:mga0qj67_12051_c1
1116 nmdc:mga0qj67_128060_c1
1117 nmdc:mga0qj67_141281_c1
1118 nmdc:mga0qj67_6897_c1
1119 nmdc:mga06r32_117196_c1
1120 nmdc:mga06r32_27961_c1
1121 nmdc:mga06r32_446670_c1
1122 nmdc:mga08y16_151489_c1
1123 nmdc:mga08y16_240250_c1
1124 nmdc:mga08y16_459_c1
1125 nmdc:mga08y16_4731_c1
1126 nmdc:mga08y16_504021_c1
1127 nmdc:mga08y16_52183_c1
1128 nmdc:mga08y16_61535_c1
1129 nmdc:mga08y16_7447_c1
1130 nmdc:mga08y16_8357_c1
1131 nmdc:mga08y16_9810_c1
1132 nmdc:mga0n895_205889_c1
1133 nmdc:mga0n895_206257_c1
1134 nmdc:mga0n895_31535_c1
1135 nmdc:mga0n895_37108_c1
1136 nmdc:mga0n895_94048_c1
1137 nmdc:mga0rr50_254918_c1
1138 nmdc:mga0rr50_2576_c1
1139 nmdc:mga0rr50_38227_c1
1140 nmdc:mga0rr50_38895_c1
1141 nmdc:mga0rr50_420905_c1
1142 nmdc:mga08x19_33002_c1
1143 nmdc:mga08x19_71011_c1
1144 nmdc:mga0a205_19880_c1
1145 nmdc:mga0a205_306_c1
1146 nmdc:mga0a205_37275_c1
1147 nmdc:mga0a205_47206_c1
1148 nmdc:mga0a205_78802_c1
1149 Ga0495601_0161121
1150 Ga0495619_0027386
1151 Ga0501084_0006802
1152 Ga0501084_0206218
1153 Ga0590071_000027
1154 Ga0590071_018652
1155 Ga0590074_003436
1156 Ga0590075_019451
1157 Ga0590077_000703
1158 Ga0501082_0004178
1159 Ga0530510_0014069
1160 Ga0530510_0015039

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03631

Virul_fac_BrkB

Virulence factor BrkB

25

280

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
6sxn-assembly2.cif.gz_C crystal structure of p212121 apo form of crte 0.4209 112 234
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.2802 60 235
7epd-assembly1.cif.gz_A cryo-em structure of inactive mglu2-7 heterodimer 0.2714 32 270
6o6n-assembly1.cif.gz_A structure of the regulator fasr from mycobacterium tuberculosis in complex with c20-coa 0.2518 60 235
7eb2-assembly1.cif.gz_C cryo-em structure of human gaba(b) receptor-gi protein complex 0.2393 11 277
ID Description Score Start End Superfamily
af_O44148_49_380_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3326 175 290 1.20.1070.10
af_Q3TQR0_18_241_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.3018 105 268 1.20.1070.10
af_Q9XV61_32_355_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2978 183 287 1.20.1070.10
af_Q7YZG0_1_327_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2932 33 277 1.20.1070.10
af_Q9XVD3_9_302_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.2687 110 277 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A523DFH1-F1-model_v4 YihY/virulence factor BrkB family protein 0.8441 3 276 GO:0005886
AF-A0A2V8EMU4-F1-model_v4 YihY/virulence factor BrkB family protein 0.8328 1 290 GO:0005886
AF-A0A1C0W1Q0-F1-model_v4 deleted 0.8316 19 277
AF-A0A2V8EMU4-F1-model_v4 YihY/virulence factor BrkB family protein 0.8303 1 290 GO:0005886
AF-A0A522UK40-F1-model_v4 YihY/virulence factor BrkB family protein 0.8176 20 277 GO:0005886

Map