F465872

General Info

Members Datasets Scaffolds Average Seq Length
579 272 1158 134

Family's Representative Sequence

Representative Sequence 3300048928|Ga0496125_0046577|Ga0496125_0046577_211_660
Length 149
Sequence MRRGERRMIIGLGSDLCSIERIQNSLDRFGDRFLDRVFTPTERMRAERRPLTRAGTYAKRFAAKEALSKAVGTGFKHGVFMRDIGVANLPSGAPTLILTGGAKARLDALTPPGHAVTIHLTLTDDHPWAQAFVILEARPTPESIQGEIA

Samples

Sample ID Description Type Environment
1 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
4 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
7 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
8 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
9 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
10 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
11 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
12 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
72 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
73 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
86 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
142 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
143 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
144 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
145 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
146 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
150 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
151 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
152 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
163 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
164 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
165 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
166 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
167 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
168 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
169 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
170 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
171 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
174 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
175 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
176 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
177 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
178 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
179 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
180 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
181 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
186 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
190 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
191 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
192 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
193 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
194 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
195 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
196 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
197 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
198 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
202 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
203 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
204 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
205 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
206 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
207 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
208 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
209 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
210 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
211 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
212 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
213 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
220 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
221 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
222 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
223 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
226 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
227 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
228 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
229 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
230 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
231 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
232 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
236 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
237 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
238 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
239 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
240 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
241 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
242 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
243 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
244 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
245 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
246 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
247 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
248 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
249 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
250 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
251 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
252 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
253 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
254 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
255 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
256 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
257 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
258 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
259 2582581305 Rhizorhabdus wittichii YR128 Isolate Rhizosphere
260 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
261 2643221588 Altererythrobacter sp. Root672 Isolate Unclassified
262 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
263 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
264 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
265 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
266 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
267 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
268 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
269 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
270 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
271 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
272 3000865235 Altericroceibacterium indicum DSM 18604 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.41
Metatranscriptomes 0.17
Isolates 2.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.35
Nodule 0
Rhizoplane 4.49
Rhizosphere 84.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496125_0046577 3300048928 Bacteria 3637
2 SwRhRL2b_contig_2117351 2162886007 Bacteria 4365
3 JGI24736J21556_1000163 3300001904 Bacteria 11858
4 JGI24752J21851_1000144 3300001976 Bacteria 9609
5 JGI24752J21851_1003532 3300001976 Bacteria 2059
6 JGI24740J21852_10039629 3300001979 Bacteria 1435
7 JGI24739J22299_10006424 3300001989 Bacteria 4438
8 JGI24739J22299_10022927 3300001989 Bacteria 2211
9 JGI24737J22298_10009065 3300001990 Bacteria 3317
10 JGI24737J22298_10012548 3300001990 Bacteria 2763
11 JGI24737J22298_10203747 3300001990 Bacteria 584
12 JGI24735J21928_10013909 3300002067 Bacteria 2524
13 JGI24735J21928_10045198 3300002067 Bacteria 1279
14 JGI24750J21931_1001939 3300002070 Bacteria 2527
15 JGI24748J21848_1000041 3300002074 Bacteria 64764
16 JGI24738J21930_10013004 3300002075 Bacteria 1808
17 JGI24749J21850_1026963 3300002076 Bacteria 820
18 JGI24034J26672_10000020 3300002239 Bacteria 122643
19 JGI24034J26672_10017466 3300002239 Bacteria 1110
20 JGI24742J22300_10006615 3300002244 Bacteria 1911
21 JGI24751J29686_10000070 3300002459 Bacteria 59622
22 JGI24751J29686_10004210 3300002459 Bacteria 2920
23 JGI24751J29686_10023349 3300002459 Bacteria 1282
24 JGI24751J29686_10042590 3300002459 Bacteria 938
25 Ga0055536_1008355 3300003781 Bacteria 4468
26 Ga0065704_10000610 3300005289 Bacteria 15295
27 Ga0070658_10000269 3300005327 Bacteria 45712
28 Ga0070658_10725660 3300005327 Bacteria 863
29 Ga0070683_100033941 3300005329 Bacteria 4657
30 Ga0070683_100533461 3300005329 Bacteria 1122
31 Ga0070690_100000181 3300005330 Bacteria 32447
32 Ga0070690_100163231 3300005330 Bacteria 1528
33 Ga0070690_100307727 3300005330 Bacteria 1138
34 Ga0070670_100004423 3300005331 Bacteria 11771
35 Ga0070670_100007969 3300005331 Bacteria 9009
36 Ga0070670_100027650 3300005331 Bacteria 4879
37 Ga0070670_100071411 3300005331 Bacteria 2981
38 Ga0070670_100095099 3300005331 Bacteria 2562
39 Ga0070666_10000027 3300005335 Bacteria 151010
40 Ga0070666_10000330 3300005335 Bacteria 29917
41 Ga0070666_10044185 3300005335 Bacteria 2984
42 Ga0070666_10103688 3300005335 Bacteria 1962
43 Ga0070666_10151922 3300005335 Bacteria 1616
44 Ga0070666_10274090 3300005335 Bacteria 1198
45 Ga0070666_10440342 3300005335 Bacteria 940
46 Ga0070660_100000109 3300005339 Bacteria 50964
47 Ga0070660_100149961 3300005339 Bacteria 1874
48 Ga0070689_100025504 3300005340 Bacteria 4442
49 Ga0070689_100087792 3300005340 Bacteria 2447
50 Ga0070689_100776555 3300005340 Bacteria 841
51 Ga0070661_100000070 3300005344 Bacteria 82818
52 Ga0070668_100002152 3300005347 Bacteria 14427
53 Ga0070668_100008276 3300005347 Bacteria 7719
54 Ga0070668_100010018 3300005347 Bacteria 7023
55 Ga0070668_100022622 3300005347 Bacteria 4753
56 Ga0070669_100000004 3300005353 Bacteria 314707
57 Ga0070669_100000099 3300005353 Bacteria 85328
58 Ga0070669_100113568 3300005353 Bacteria 2058
59 Ga0070675_100036089 3300005354 Bacteria 4020
60 Ga0070671_100000003 3300005355 Bacteria 270186
61 Ga0070671_100000004 3300005355 Bacteria 262155
62 Ga0070671_100000435 3300005355 Bacteria 28993
63 Ga0070671_100005801 3300005355 Bacteria 9835
64 Ga0070671_100206158 3300005355 Bacteria 1667
65 Ga0070673_100012023 3300005364 Bacteria 5929
66 Ga0070688_100003794 3300005365 Bacteria 7834
67 Ga0070659_100000312 3300005366 Bacteria 37872
68 Ga0070659_101540197 3300005366 Bacteria 593
69 Ga0070667_100000298 3300005367 Bacteria 55786
70 Ga0070667_100000398 3300005367 Bacteria 46959
71 Ga0070667_100002080 3300005367 Bacteria 17708
72 Ga0070667_100036759 3300005367 Bacteria 4106
73 Ga0070667_100243847 3300005367 Bacteria 1605
74 Ga0070667_100270613 3300005367 Bacteria 1523
75 Ga0070667_101030767 3300005367 Bacteria 768
76 Ga0070705_100094880 3300005440 Bacteria 1869
77 Ga0070708_100080653 3300005445 Bacteria 2945
78 Ga0070663_100014474 3300005455 Bacteria 5065
79 Ga0070663_100238510 3300005455 Bacteria 1434
80 Ga0070663_101159287 3300005455 Bacteria 678
81 Ga0070662_100000037 3300005457 Bacteria 76596
82 Ga0070662_100037783 3300005457 Bacteria 3425
83 Ga0070681_10172187 3300005458 Bacteria 2087
84 Ga0070685_10000040 3300005466 Bacteria 77295
85 Ga0070685_10225060 3300005466 Bacteria 1231
86 Ga0070684_100082732 3300005535 Bacteria 2843
87 Ga0068853_100000309 3300005539 Bacteria 34282
88 Ga0068853_100002388 3300005539 Bacteria 14035
89 Ga0068853_100428488 3300005539 Bacteria 1241
90 Ga0068853_100650899 3300005539 Bacteria 1003
91 Ga0070686_100000010 3300005544 Bacteria 192116
92 Ga0070686_100091233 3300005544 Bacteria 2038
93 Ga0070686_100465770 3300005544 Bacteria 974
94 Ga0070686_101577934 3300005544 Bacteria 555
95 Ga0070696_100217275 3300005546 Bacteria 1433
96 Ga0070665_100000331 3300005548 Bacteria 72744
97 Ga0070665_100003015 3300005548 Bacteria 18160
98 Ga0070665_100044025 3300005548 Bacteria 4483
99 Ga0070665_100226276 3300005548 Bacteria 1871
100 Ga0070665_100724174 3300005548 Bacteria 1008
101 Ga0068855_100004288 3300005563 Bacteria 17424
102 Ga0070664_100000077 3300005564 Bacteria 62053
103 Ga0070664_100011185 3300005564 Bacteria 7279
104 Ga0068857_100014305 3300005577 Bacteria 6915
105 Ga0068857_100056450 3300005577 Bacteria 3485
106 Ga0068857_100741837 3300005577 Bacteria 935
107 Ga0068857_100952512 3300005577 Bacteria 825
108 Ga0068854_100003394 3300005578 Bacteria 9925
109 Ga0068854_100257642 3300005578 Bacteria 1396
110 Ga0068854_100608777 3300005578 Bacteria 933
111 Ga0068856_100000444 3300005614 Bacteria 45674
112 Ga0068856_101129996 3300005614 Bacteria 800
113 Ga0068852_100000350 3300005616 Bacteria 31032
114 Ga0068852_100173855 3300005616 Bacteria 2021
115 Ga0068852_100318019 3300005616 Bacteria 1511
116 Ga0068852_100340587 3300005616 Bacteria 1461
117 Ga0068852_100892243 3300005616 Bacteria 906
118 Ga0068852_101876342 3300005616 Bacteria 621
119 Ga0068859_100000965 3300005617 Bacteria 29425
120 Ga0068859_100001079 3300005617 Bacteria 27844
121 Ga0068859_100009719 3300005617 Bacteria 9713
122 Ga0068859_100255100 3300005617 Bacteria 1844
123 Ga0068859_100476280 3300005617 Bacteria 1344
124 Ga0068859_102417853 3300005617 Bacteria 579
125 Ga0068864_100000544 3300005618 Bacteria 32111
126 Ga0068864_100016801 3300005618 Bacteria 6099
127 Ga0068864_100018517 3300005618 Bacteria 5819
128 Ga0068864_100073922 3300005618 Bacteria 2973
129 Ga0068861_100000203 3300005719 Bacteria 31717
130 Ga0068861_100130367 3300005719 Bacteria 2040
131 Ga0068861_100462813 3300005719 Bacteria 1139
132 Ga0068861_100538847 3300005719 Bacteria 1062
133 Ga0068851_10005509 3300005834 Bacteria 5736
134 Ga0068851_10019522 3300005834 Bacteria 3275
135 Ga0068851_10040020 3300005834 Bacteria 2356
136 Ga0068863_100000148 3300005841 Bacteria 73607
137 Ga0068863_100008863 3300005841 Bacteria 9823
138 Ga0068863_100010100 3300005841 Bacteria 9182
139 Ga0068863_100038130 3300005841 Bacteria 4573
140 Ga0068863_100068523 3300005841 Bacteria 3356
141 Ga0068858_100000782 3300005842 Bacteria 33248
142 Ga0068858_100002557 3300005842 Bacteria 18336
143 Ga0068858_100012984 3300005842 Bacteria 7853
144 Ga0068858_100057119 3300005842 Bacteria 3607
145 Ga0068858_100150227 3300005842 Bacteria 2190
146 Ga0068860_100000080 3300005843 Bacteria 170152
147 Ga0068860_100000143 3300005843 Bacteria 116787
148 Ga0068860_100000412 3300005843 Bacteria 55786
149 Ga0068860_100012732 3300005843 Bacteria 8274
150 Ga0068860_100014490 3300005843 Bacteria 7719
151 Ga0068860_100025103 3300005843 Bacteria 5751
152 Ga0068860_100384451 3300005843 Bacteria 1386
153 Ga0068860_101725549 3300005843 Bacteria 648
154 Ga0068862_100000115 3300005844 Bacteria 94951
155 Ga0068862_100000716 3300005844 Bacteria 33750
156 Ga0068862_100004866 3300005844 Bacteria 11308
157 Ga0068862_100015638 3300005844 Bacteria 6303
158 Ga0068862_100018753 3300005844 Bacteria 5764
159 Ga0068862_100026182 3300005844 Bacteria 4903
160 Ga0068862_100504213 3300005844 Bacteria 1149
161 Ga0070717_10219145 3300006028 Bacteria 1672
162 Ga0075366_10050197 3300006195 Bacteria 2477
163 Ga0075429_100282276 3300006880 Bacteria 1454
164 Ga0097620_100000965 3300006931 Bacteria 29425
165 Ga0097620_100001079 3300006931 Bacteria 27844
166 Ga0097620_100009720 3300006931 Bacteria 9713
167 Ga0097620_100255114 3300006931 Bacteria 1844
168 Ga0097620_100476335 3300006931 Bacteria 1344
169 Ga0097620_102416993 3300006931 Bacteria 579
170 Ga0105251_10054254 3300009011 Bacteria 1904
171 Ga0105251_10073113 3300009011 Bacteria 1594
172 Ga0105250_10252168 3300009092 Bacteria 754
173 Ga0105250_10467857 3300009092 Bacteria 568
174 Ga0105240_10723942 3300009093 Bacteria 1084
175 Ga0105247_10022323 3300009101 Bacteria 3811
176 Ga0105247_10225942 3300009101 Bacteria 1269
177 Ga0105241_10123039 3300009174 Bacteria 2092
178 Ga0105241_10288997 3300009174 Bacteria 1403
179 Ga0105248_10000719 3300009177 Bacteria 37511
180 Ga0105248_10021643 3300009177 Bacteria 7122
181 Ga0105248_10023215 3300009177 Bacteria 6889
182 Ga0105248_10039813 3300009177 Bacteria 5267
183 Ga0105248_10091394 3300009177 Bacteria 3428
184 Ga0105248_10111958 3300009177 Bacteria 3079
185 Ga0105248_10281301 3300009177 Bacteria 1873
186 Ga0105248_12576382 3300009177 Bacteria 580
187 Ga0105238_10087105 3300009551 Bacteria 3110
188 Ga0105238_10647290 3300009551 Bacteria 1067
189 Ga0105238_11164363 3300009551 Bacteria 795
190 Ga0105249_10000064 3300009553 Bacteria 151646
191 Ga0105249_10002202 3300009553 Bacteria 16889
192 Ga0105249_10467853 3300009553 Bacteria 1302
193 Ga0105249_10862738 3300009553 Bacteria 971
194 Ga0157327_1073075 3300012512 Bacteria 536
195 Ga0157326_1000001 3300012513 Bacteria 19397
196 Ga0157373_10035475 3300013100 Bacteria 3580
197 Ga0157371_10023554 3300013102 Bacteria 4502
198 Ga0157370_10027671 3300013104 Bacteria 5589
199 Ga0157369_10052060 3300013105 Bacteria 4430
200 Ga0163162_10004217 3300013306 Bacteria 13820
201 Ga0163162_10045046 3300013306 Bacteria 4419
202 Ga0157375_11159547 3300013308 Bacteria 906
203 Ga0163163_10000123 3300014325 Bacteria 82366
204 Ga0163163_10055648 3300014325 Bacteria 3910
205 Ga0163163_10252812 3300014325 Bacteria 1813
206 Ga0163163_13138556 3300014325 Bacteria 515
207 Ga0157380_10009996 3300014326 Bacteria 6811
208 Ga0157380_10148059 3300014326 Bacteria 2026
209 Ga0157380_10972097 3300014326 Bacteria 880
210 Ga0157379_10010623 3300014968 Bacteria 8026
211 Ga0157379_10025000 3300014968 Bacteria 5302
212 Ga0157379_10165506 3300014968 Bacteria 1996
213 Ga0157376_11071495 3300014969 Bacteria 831
214 Ga0163161_10002050 3300017792 Bacteria 14595
215 Ga0207672_1002083 3300025223 Bacteria 1266
216 Ga0207673_1002233 3300025290 Bacteria 2188
217 Ga0209050_1026404 3300025298 Bacteria 1945
218 Ga0209050_1049014 3300025298 Bacteria 1086
219 Ga0207697_10000699 3300025315 Bacteria 19087
220 Ga0207697_10044372 3300025315 Bacteria 1829
221 Ga0207697_10243171 3300025315 Bacteria 795
222 Ga0207656_10003701 3300025321 Bacteria 5292
223 Ga0207656_10011612 3300025321 Bacteria 3333
224 Ga0207656_10029089 3300025321 Bacteria 2273
225 Ga0207696_1174715 3300025711 Bacteria 568
226 Ga0207710_10004106 3300025900 Bacteria 6395
227 Ga0207680_10000009 3300025903 Bacteria 464571
228 Ga0207680_10000253 3300025903 Bacteria 25735
229 Ga0207680_10001021 3300025903 Bacteria 13204
230 Ga0207680_10053827 3300025903 Bacteria 2418
231 Ga0207680_10056586 3300025903 Bacteria 2369
232 Ga0207680_10330458 3300025903 Bacteria 1068
233 Ga0207647_10017660 3300025904 Bacteria 4848
234 Ga0207647_10019264 3300025904 Bacteria 4593
235 Ga0207705_10000086 3300025909 Bacteria 116132
236 Ga0207705_11184478 3300025909 Bacteria 586
237 Ga0207654_10003465 3300025911 Bacteria 7980
238 Ga0207707_10018528 3300025912 Bacteria 6068
239 Ga0207707_10734544 3300025912 Bacteria 827
240 Ga0207695_10001846 3300025913 Bacteria 33222
241 Ga0207695_11128925 3300025913 Bacteria 664
242 Ga0207671_10001516 3300025914 Bacteria 26700
243 Ga0207657_10001020 3300025919 Bacteria 29724
244 Ga0207649_10000420 3300025920 Bacteria 31171
245 Ga0207652_10860060 3300025921 Bacteria 803
246 Ga0207681_10000010 3300025923 Bacteria 403379
247 Ga0207681_10003625 3300025923 Bacteria 9599
248 Ga0207681_10010008 3300025923 Bacteria 5804
249 Ga0207681_10093567 3300025923 Bacteria 2152
250 Ga0207694_10003515 3300025924 Bacteria 12436
251 Ga0207650_10002156 3300025925 Bacteria 13756
252 Ga0207650_10002978 3300025925 Bacteria 11686
253 Ga0207650_10019363 3300025925 Bacteria 4780
254 Ga0207650_10021114 3300025925 Bacteria 4602
255 Ga0207650_10099170 3300025925 Bacteria 2239
256 Ga0207659_10005663 3300025926 Bacteria 7601
257 Ga0207659_10314789 3300025926 Bacteria 1289
258 Ga0207664_10233077 3300025929 Bacteria 1601
259 Ga0207644_10000004 3300025931 Bacteria 566613
260 Ga0207644_10000007 3300025931 Bacteria 381778
261 Ga0207644_10000447 3300025931 Bacteria 26636
262 Ga0207644_10005175 3300025931 Bacteria 8517
263 Ga0207644_10013631 3300025931 Bacteria 5424
264 Ga0207644_10252125 3300025931 Bacteria 1408
265 Ga0207690_10000413 3300025932 Bacteria 27940
266 Ga0207690_10121334 3300025932 Bacteria 1899
267 Ga0207690_10243948 3300025932 Bacteria 1385
268 Ga0207690_10258090 3300025932 Bacteria 1349
269 Ga0207690_10450337 3300025932 Bacteria 1035
270 Ga0207706_10000192 3300025933 Bacteria 68319
271 Ga0207709_10316718 3300025935 Bacteria 1166
272 Ga0207670_10071222 3300025936 Bacteria 2403
273 Ga0207704_10173422 3300025938 Bacteria 1550
274 Ga0207691_10003939 3300025940 Bacteria 14420
275 Ga0207711_10002038 3300025941 Bacteria 18270
276 Ga0207711_10011658 3300025941 Bacteria 7304
277 Ga0207711_10046882 3300025941 Bacteria 3693
278 Ga0207711_10085480 3300025941 Bacteria 2764
279 Ga0207689_10520252 3300025942 Bacteria 998
280 Ga0207661_10045917 3300025944 Bacteria 3461
281 Ga0207679_10000347 3300025945 Bacteria 33719
282 Ga0207667_10000850 3300025949 Bacteria 39399
283 Ga0207667_10014998 3300025949 Bacteria 8814
284 Ga0207667_10748127 3300025949 Bacteria 977
285 Ga0207651_10003751 3300025960 Bacteria 7519
286 Ga0207712_10000044 3300025961 Bacteria 171240
287 Ga0207712_10010030 3300025961 Bacteria 6004
288 Ga0207712_10750592 3300025961 Bacteria 855
289 Ga0207712_11056442 3300025961 Bacteria 722
290 Ga0207668_10001156 3300025972 Bacteria 15685
291 Ga0207668_10001363 3300025972 Bacteria 14427
292 Ga0207668_10007256 3300025972 Bacteria 6582
293 Ga0207640_10016104 3300025981 Bacteria 4342
294 Ga0207640_10023032 3300025981 Bacteria 3738
295 Ga0207640_10310959 3300025981 Bacteria 1250
296 Ga0207640_10421722 3300025981 Bacteria 1092
297 Ga0207640_10548859 3300025981 Bacteria 970
298 Ga0207640_11965909 3300025981 Bacteria 530
299 Ga0207658_10000026 3300025986 Bacteria 178292
300 Ga0207658_10000254 3300025986 Bacteria 55800
301 Ga0207658_10000340 3300025986 Bacteria 46680
302 Ga0207658_10005150 3300025986 Bacteria 9003
303 Ga0207658_10005466 3300025986 Bacteria 8714
304 Ga0207658_10095372 3300025986 Bacteria 2318
305 Ga0207658_10161140 3300025986 Bacteria 1839
306 Ga0207703_10002337 3300026035 Bacteria 16540
307 Ga0207703_10002950 3300026035 Bacteria 14435
308 Ga0207703_10014818 3300026035 Bacteria 6084
309 Ga0207703_10016442 3300026035 Bacteria 5769
310 Ga0207639_10000263 3300026041 Bacteria 37984
311 Ga0207639_10000412 3300026041 Bacteria 29612
312 Ga0207639_10103752 3300026041 Bacteria 2304
313 Ga0207678_10001460 3300026067 Bacteria 21690
314 Ga0207678_10053816 3300026067 Bacteria 3468
315 Ga0207708_10373668 3300026075 Bacteria 1174
316 Ga0207702_10001692 3300026078 Bacteria 21793
317 Ga0207702_10005023 3300026078 Bacteria 11624
318 Ga0207641_10000672 3300026088 Bacteria 37136
319 Ga0207641_10005605 3300026088 Bacteria 10695
320 Ga0207641_10022495 3300026088 Bacteria 5187
321 Ga0207641_10031888 3300026088 Bacteria 4372
322 Ga0207641_10033632 3300026088 Bacteria 4259
323 Ga0207641_10042063 3300026088 Bacteria 3832
324 Ga0207641_10043158 3300026088 Bacteria 3786
325 Ga0207676_10001067 3300026095 Bacteria 20877
326 Ga0207676_10001455 3300026095 Bacteria 17617
327 Ga0207676_10043969 3300026095 Bacteria 3443
328 Ga0207676_10049945 3300026095 Bacteria 3258
329 Ga0207674_10000748 3300026116 Bacteria 42600
330 Ga0207674_10057696 3300026116 Bacteria 3936
331 Ga0207674_10480639 3300026116 Bacteria 1201
332 Ga0207675_100000329 3300026118 Bacteria 45296
333 Ga0207675_100001681 3300026118 Bacteria 22129
334 Ga0207675_100025310 3300026118 Bacteria 5522
335 Ga0207675_100089329 3300026118 Bacteria 2895
336 Ga0207683_11723830 3300026121 Bacteria 576
337 Ga0207698_10000542 3300026142 Bacteria 21912
338 Ga0207698_10046733 3300026142 Bacteria 3272
339 Ga0207698_10347588 3300026142 Bacteria 1399
340 Ga0207698_10389972 3300026142 Bacteria 1328
341 Ga0207698_10855395 3300026142 Bacteria 915
342 Ga0207698_11210090 3300026142 Bacteria 769
343 Ga0209970_1011930 3300027614 Bacteria 1434
344 Ga0268266_10000069 3300028379 Bacteria 239714
345 Ga0268266_10003034 3300028379 Bacteria 17235
346 Ga0268265_10000058 3300028380 Bacteria 154702
347 Ga0268265_10000100 3300028380 Bacteria 108659
348 Ga0268265_10000986 3300028380 Bacteria 25848
349 Ga0268265_10007112 3300028380 Bacteria 7554
350 Ga0268265_10025071 3300028380 Bacteria 4227
351 Ga0268265_10382869 3300028380 Bacteria 1295
352 Ga0268264_10000076 3300028381 Bacteria 255518
353 Ga0268264_10000083 3300028381 Bacteria 245366
354 Ga0268264_10000106 3300028381 Bacteria 210031
355 Ga0268264_10000131 3300028381 Bacteria 181459
356 Ga0268264_10030330 3300028381 Bacteria 4432
357 Ga0268264_11245513 3300028381 Bacteria 754
358 Ga0307513_10323622 3300031456 Bacteria 1299
359 Ga0307408_100066571 3300031548 Bacteria 2646
360 Ga0307408_100088644 3300031548 Bacteria 2331
361 Ga0307408_100129153 3300031548 Bacteria 1969
362 Ga0307408_100131443 3300031548 Bacteria 1953
363 Ga0307408_100618051 3300031548 Bacteria 965
364 Ga0307408_100988659 3300031548 Bacteria 775
365 Ga0307405_11156056 3300031731 Bacteria 667
366 Ga0307413_10005361 3300031824 Bacteria 5715
367 Ga0307413_10041725 3300031824 Bacteria 2689
368 Ga0307413_10249290 3300031824 Bacteria 1316
369 Ga0307413_10343345 3300031824 Bacteria 1149
370 Ga0307413_11660976 3300031824 Bacteria 569
371 Ga0307410_10100906 3300031852 Bacteria 2068
372 Ga0307410_10299399 3300031852 Bacteria 1268
373 Ga0307410_10829470 3300031852 Bacteria 788
374 Ga0307406_10012598 3300031901 Bacteria 4822
375 Ga0307406_10115282 3300031901 Bacteria 1857
376 Ga0307406_10216930 3300031901 Bacteria 1419
377 Ga0307406_10471821 3300031901 Bacteria 1011
378 Ga0307406_10578161 3300031901 Bacteria 923
379 Ga0307407_10008174 3300031903 Bacteria 4785
380 Ga0307407_11425177 3300031903 Bacteria 546
381 Ga0307407_11550967 3300031903 Bacteria 525
382 Ga0307412_10328090 3300031911 Bacteria 1220
383 Ga0307412_10341491 3300031911 Bacteria 1199
384 Ga0307412_10342973 3300031911 Bacteria 1196
385 Ga0307412_11012947 3300031911 Bacteria 734
386 Ga0307412_11401105 3300031911 Bacteria 632
387 Ga0307409_100077741 3300031995 Bacteria 2667
388 Ga0307409_100233395 3300031995 Bacteria 1669
389 Ga0307409_101003507 3300031995 Bacteria 853
390 Ga0307416_100018663 3300032002 Bacteria 4894
391 Ga0307416_100103144 3300032002 Bacteria 2489
392 Ga0307416_100352298 3300032002 Bacteria 1490
393 Ga0307416_100755142 3300032002 Bacteria 1065
394 Ga0307416_102715207 3300032002 Bacteria 592
395 Ga0307414_10031283 3300032004 Bacteria 3489
396 Ga0307414_10046786 3300032004 Bacteria 2972
397 Ga0307414_10119765 3300032004 Bacteria 2021
398 Ga0307414_10121460 3300032004 Bacteria 2009
399 Ga0307414_10595855 3300032004 Bacteria 990
400 Ga0307414_10964175 3300032004 Bacteria 784
401 Ga0307411_10167875 3300032005 Bacteria 1651
402 Ga0307411_10202992 3300032005 Bacteria 1524
403 Ga0307411_10438590 3300032005 Bacteria 1089
404 Ga0307411_10894272 3300032005 Bacteria 788
405 Ga0307411_11459838 3300032005 Bacteria 627
406 Ga0307411_11562611 3300032005 Bacteria 608
407 Ga0373959_0191581 3300034820 Bacteria 536
408 Ga0373938_0204356 3300034957 Bacteria 548
409 Ga0373952_0010930 3300035092 Bacteria 1763
410 Ga0373939_0052096 3300035114 Bacteria 1274
411 Ga0373943_0123320 3300035170 Bacteria 1379
412 Ga0373942_0004964 3300035207 Bacteria 3085
413 Ga0373961_0025745 3300035241 Bacteria 1602
414 Ga0373962_0208689 3300035242 Bacteria 664
415 Ga0373931_0001320 3300035691 Bacteria 10617
416 Ga0373927_0261267 3300035695 Bacteria 1139
417 Ga0373947_0159059 3300035725 Bacteria 1460
418 Ga0373925_0317011 3300037068 Bacteria 1261
419 Ga0395905_0846941 3300037471 Bacteria 817
420 Ga0436364_0906193 3300037853 Bacteria 619
421 Ga0436364_1230255 3300037853 Bacteria 662
422 Ga0439432_017031 3300042006 Bacteria 2441
423 Ga0450902_087658 3300042137 Bacteria 549
424 Ga0466961_0075701 3300044693 Bacteria 2133
425 Ga0466961_0261135 3300044693 Bacteria 1062
426 Ga0466963_0010200 3300044694 Bacteria 5681
427 Ga0466963_0012634 3300044694 Bacteria 5172
428 Ga0466971_0110436 3300044719 Bacteria 1268
429 Ga0466970_0084406 3300044765 Bacteria 1719
430 Ga0466957_0022875 3300044842 Bacteria 3690
431 Ga0451576_0000007 3300045051 Bacteria 782228
432 Ga0451576_1554742 3300045051 Bacteria 687
433 Ga0466958_0013804 3300045836 Bacteria 4605
434 Ga0495638_0051791 3300046460 Bacteria 2560
435 Ga0495638_0080503 3300046460 Bacteria 1979
436 Ga0495638_0088020 3300046460 Bacteria 1875
437 Ga0495638_0440949 3300046460 Bacteria 667
438 Ga0495605_0072917 3300046474 Bacteria 1618
439 Ga0495607_0287126 3300046501 Bacteria 779
440 Ga0495610_0001009 3300046512 Bacteria 25934
441 Ga0495637_0092985 3300046520 Bacteria 1187
442 Ga0495643_0000080 3300046522 Bacteria 161872
443 Ga0495643_0024092 3300046522 Bacteria 3455
444 Ga0495643_0024657 3300046522 Bacteria 3410
445 Ga0495648_0057871 3300046524 Bacteria 2321
446 Ga0495609_0139141 3300046538 Bacteria 1036
447 Ga0495597_0012300 3300046542 Bacteria 4130
448 Ga0495597_0253984 3300046542 Bacteria 690
449 Ga0495633_0031232 3300046558 Bacteria 2584
450 Ga0495633_0154810 3300046558 Bacteria 1058
451 Ga0495668_0204485 3300046616 Bacteria 1081
452 Ga0495611_0114040 3300046648 Bacteria 1259
453 Ga0495625_0019526 3300046660 Bacteria 5253
454 Ga0495669_0162392 3300046684 Bacteria 1060
455 Ga0495681_0340408 3300047470 Bacteria 572
456 Ga0495686_0038737 3300047472 Bacteria 3047
457 Ga0495686_0105395 3300047472 Bacteria 1696
458 Ga0496100_0049815 3300048903 Bacteria 2711
459 Ga0496101_0016491 3300048904 Bacteria 4992
460 Ga0496102_0015704 3300048905 Bacteria 6597
461 Ga0496102_0062272 3300048905 Bacteria 3416
462 Ga0496102_0229872 3300048905 Bacteria 1749
463 Ga0496103_0003007 3300048906 Bacteria 10406
464 Ga0496103_0069879 3300048906 Bacteria 2196
465 Ga0496103_0196673 3300048906 Bacteria 1296
466 Ga0496104_0021849 3300048907 Bacteria 5877
467 Ga0496104_0120478 3300048907 Bacteria 2519
468 Ga0496105_0198812 3300048908 Bacteria 1636
469 Ga0496106_0000220 3300048909 Bacteria 39777
470 Ga0496106_1315609 3300048909 Bacteria 561
471 Ga0496107_0003475 3300048910 Bacteria 10531
472 Ga0496107_0060738 3300048910 Bacteria 2736
473 Ga0496107_0732220 3300048910 Bacteria 726
474 Ga0496108_0027579 3300048911 Bacteria 4692
475 Ga0496108_0032484 3300048911 Bacteria 4335
476 Ga0496108_0082084 3300048911 Bacteria 2733
477 Ga0496109_0161201 3300048912 Bacteria 2101
478 Ga0496109_0203096 3300048912 Bacteria 1863
479 Ga0496109_0347777 3300048912 Bacteria 1400
480 Ga0496109_1056964 3300048912 Bacteria 749
481 Ga0496112_1037137 3300048915 Bacteria 739
482 Ga0496113_0108148 3300048916 Bacteria 2161
483 Ga0496115_1354229 3300048918 Bacteria 528
484 Ga0496116_0044811 3300048919 Bacteria 3000
485 Ga0496116_0051231 3300048919 Bacteria 2744
486 Ga0496116_0173293 3300048919 Bacteria 1166
487 Ga0496117_0007931 3300048920 Bacteria 10203
488 Ga0496117_0008015 3300048920 Bacteria 10129
489 Ga0496117_0012887 3300048920 Bacteria 7330
490 Ga0496118_0007538 3300048921 Bacteria 11492
491 Ga0496118_0024094 3300048921 Bacteria 5264
492 Ga0496118_0435898 3300048921 Bacteria 669
493 Ga0496120_0307401 3300048923 Bacteria 724
494 Ga0496121_0000652 3300048924 Bacteria 64960
495 Ga0496121_0001561 3300048924 Bacteria 38247
496 Ga0496121_0373988 3300048924 Bacteria 942
497 Ga0496124_0010858 3300048927 Bacteria 9167
498 Ga0496124_0069061 3300048927 Bacteria 2935
499 Ga0496124_0142620 3300048927 Bacteria 1888
500 Ga0496124_0170821 3300048927 Bacteria 1684
501 Ga0496124_0565373 3300048927 Bacteria 747
502 Ga0496124_0620236 3300048927 Bacteria 700
503 Ga0496125_0019357 3300048928 Bacteria 6423
504 Ga0496125_0144903 3300048928 Bacteria 1644
505 Ga0496125_0167279 3300048928 Bacteria 1484
506 Ga0496125_0217475 3300048928 Bacteria 1234
507 Ga0496126_0017533 3300048929 Bacteria 7132
508 Ga0496126_0025141 3300048929 Bacteria 5735
509 Ga0496126_0537164 3300048929 Bacteria 930
510 Ga0501290_000583 3300049513 Bacteria 5507
511 Ga0501292_000302 3300049515 Bacteria 6878
512 Ga0501294_000609 3300049517 Bacteria 4081
513 Ga0501301_005466 3300049524 Bacteria 932
514 Ga0501317_005838 3300049533 Bacteria 1335
515 Ga0501038_0161392 3300049574 Bacteria 1821
516 Ga0501043_0072909 3300049579 Bacteria 2697
517 Ga0501046_1077179 3300049580 Bacteria 556
518 Ga0501047_0000773 3300049581 Bacteria 33434
519 Ga0501048_0239358 3300049582 Bacteria 1288
520 Ga0501206_004309 3300049653 Bacteria 1808
521 Ga0501222_000402 3300049662 Bacteria 6541
522 Ga0501223_003349 3300049663 Bacteria 3499
523 Ga0501224_000607 3300049664 Bacteria 4416
524 Ga0501235_015441 3300049669 Bacteria 1683
525 Ga0501249_018938 3300049679 Bacteria 1491
526 Ga0501259_000972 3300049688 Bacteria 4754
527 Ga0501261_000317 3300049690 Bacteria 6605
528 Ga0501225_0060979 3300049705 Bacteria 1061
529 Ga0501245_006510 3300049708 Bacteria 1634
530 Ga0501279_000304 3300049775 Bacteria 6609
531 Ga0501280_001289 3300049776 Bacteria 4817
532 Ga0501281_00219 3300049777 Bacteria 6431
533 Ga0501282_000287 3300049778 Bacteria 6089
534 Ga0501035_0080160 3300049822 Bacteria 2883
535 Ga0501044_0229628 3300049823 Bacteria 1804
536 Ga0501204_008088 3300049850 Bacteria 1194
537 nmdc:mga0k408_171067_c1 3300050493 Bacteria 1295
538 nmdc:mga07m45_146615_c1 3300050496 Bacteria 1368
539 nmdc:mga09592_429369_c1 3300050508 Bacteria 1141
540 Ga0500643_000400 3300053087 Bacteria 33193
541 Ga0500643_002227 3300053087 Bacteria 10238
542 Ga0500643_005673 3300053087 Bacteria 5335
543 Ga0500647_0077967 3300053091 Bacteria 1589
544 Ga0500583_0146956 3300053092 Bacteria 1173
545 Ga0500651_0005593 3300053093 Bacteria 7194
546 Ga0500641_0010528 3300053096 Bacteria 3344
547 Ga0500650_0165690 3300053098 Bacteria 1018
548 Ga0500650_0435108 3300053098 Bacteria 564
549 Ga0500556_0000158 3300053104 Bacteria 55541
550 Ga0500556_0126992 3300053104 Bacteria 998
551 Ga0500557_073418 3300053105 Bacteria 1124
552 Ga0500608_044664 3300053122 Bacteria 2127
553 Ga0500618_076155 3300053125 Bacteria 752
554 Ga0500642_0000001 3300053130 Bacteria 1468402
555 Ga0500642_0000923 3300053130 Bacteria 8537
556 Ga0500655_000452 3300053133 Bacteria 8413
557 Ga0500590_001369 3300053148 Bacteria 9945
558 Ga0500622_0012908 3300053156 Bacteria 4514
559 Ga0500624_000012 3300053157 Bacteria 165895
560 Ga0500627_0000056 3300053158 Bacteria 53879
561 Ga0500636_0153009 3300053177 Bacteria 1265
562 Ga0500570_005787 3300053724 Bacteria 6651
563 Ga0500645_002048 3300053730 Bacteria 9388
564 Ga0500645_036254 3300053730 Bacteria 1468
565 Ga0466962_0179996 3300061719 Bacteria 1030
566 2585263315 2582581305 Bacteria 4895574
567 2643728099 2643221541 Bacteria 5498788
568 2643948640 2643221588 Bacteria 3692460
569 2644038926 2643221605 Bacteria 4772303
570 2644042952 2643221606 Bacteria 5588032
571 2644395617 2643221671 Bacteria 5496681
572 2809064790 2808606401 Bacteria 4586670
573 2809080757 2808606404 Bacteria 4652788
574 2809085122 2808606405 Bacteria 4586632
575 2852681719 2852680915 Bacteria 4100189
576 2880521818 2880518877 Bacteria 5012590
577 2896255764 2896253425 Bacteria 3418029
578 2896432012 2896429255 Bacteria 2557483
579 3000865315 3000865235 Bacteria 3106258
580 Ga0496125_0046577
581 SwRhRL2b_contig_2117351
582 JGI24736J21556_1000163
583 JGI24752J21851_1000144
584 JGI24752J21851_1003532
585 JGI24740J21852_10039629
586 JGI24739J22299_10006424
587 JGI24739J22299_10022927
588 JGI24737J22298_10009065
589 JGI24737J22298_10012548
590 JGI24737J22298_10203747
591 JGI24735J21928_10013909
592 JGI24735J21928_10045198
593 JGI24750J21931_1001939
594 JGI24748J21848_1000041
595 JGI24738J21930_10013004
596 JGI24749J21850_1026963
597 JGI24034J26672_10000020
598 JGI24034J26672_10017466
599 JGI24742J22300_10006615
600 JGI24751J29686_10000070
601 JGI24751J29686_10004210
602 JGI24751J29686_10023349
603 JGI24751J29686_10042590
604 Ga0055536_1008355
605 Ga0065704_10000610
606 Ga0070658_10000269
607 Ga0070658_10725660
608 Ga0070683_100033941
609 Ga0070683_100533461
610 Ga0070690_100000181
611 Ga0070690_100163231
612 Ga0070690_100307727
613 Ga0070670_100004423
614 Ga0070670_100007969
615 Ga0070670_100027650
616 Ga0070670_100071411
617 Ga0070670_100095099
618 Ga0070666_10000027
619 Ga0070666_10000330
620 Ga0070666_10044185
621 Ga0070666_10103688
622 Ga0070666_10151922
623 Ga0070666_10274090
624 Ga0070666_10440342
625 Ga0070660_100000109
626 Ga0070660_100149961
627 Ga0070689_100025504
628 Ga0070689_100087792
629 Ga0070689_100776555
630 Ga0070661_100000070
631 Ga0070668_100002152
632 Ga0070668_100008276
633 Ga0070668_100010018
634 Ga0070668_100022622
635 Ga0070669_100000004
636 Ga0070669_100000099
637 Ga0070669_100113568
638 Ga0070675_100036089
639 Ga0070671_100000003
640 Ga0070671_100000004
641 Ga0070671_100000435
642 Ga0070671_100005801
643 Ga0070671_100206158
644 Ga0070673_100012023
645 Ga0070688_100003794
646 Ga0070659_100000312
647 Ga0070659_101540197
648 Ga0070667_100000298
649 Ga0070667_100000398
650 Ga0070667_100002080
651 Ga0070667_100036759
652 Ga0070667_100243847
653 Ga0070667_100270613
654 Ga0070667_101030767
655 Ga0070705_100094880
656 Ga0070708_100080653
657 Ga0070663_100014474
658 Ga0070663_100238510
659 Ga0070663_101159287
660 Ga0070662_100000037
661 Ga0070662_100037783
662 Ga0070681_10172187
663 Ga0070685_10000040
664 Ga0070685_10225060
665 Ga0070684_100082732
666 Ga0068853_100000309
667 Ga0068853_100002388
668 Ga0068853_100428488
669 Ga0068853_100650899
670 Ga0070686_100000010
671 Ga0070686_100091233
672 Ga0070686_100465770
673 Ga0070686_101577934
674 Ga0070696_100217275
675 Ga0070665_100000331
676 Ga0070665_100003015
677 Ga0070665_100044025
678 Ga0070665_100226276
679 Ga0070665_100724174
680 Ga0068855_100004288
681 Ga0070664_100000077
682 Ga0070664_100011185
683 Ga0068857_100014305
684 Ga0068857_100056450
685 Ga0068857_100741837
686 Ga0068857_100952512
687 Ga0068854_100003394
688 Ga0068854_100257642
689 Ga0068854_100608777
690 Ga0068856_100000444
691 Ga0068856_101129996
692 Ga0068852_100000350
693 Ga0068852_100173855
694 Ga0068852_100318019
695 Ga0068852_100340587
696 Ga0068852_100892243
697 Ga0068852_101876342
698 Ga0068859_100000965
699 Ga0068859_100001079
700 Ga0068859_100009719
701 Ga0068859_100255100
702 Ga0068859_100476280
703 Ga0068859_102417853
704 Ga0068864_100000544
705 Ga0068864_100016801
706 Ga0068864_100018517
707 Ga0068864_100073922
708 Ga0068861_100000203
709 Ga0068861_100130367
710 Ga0068861_100462813
711 Ga0068861_100538847
712 Ga0068851_10005509
713 Ga0068851_10019522
714 Ga0068851_10040020
715 Ga0068863_100000148
716 Ga0068863_100008863
717 Ga0068863_100010100
718 Ga0068863_100038130
719 Ga0068863_100068523
720 Ga0068858_100000782
721 Ga0068858_100002557
722 Ga0068858_100012984
723 Ga0068858_100057119
724 Ga0068858_100150227
725 Ga0068860_100000080
726 Ga0068860_100000143
727 Ga0068860_100000412
728 Ga0068860_100012732
729 Ga0068860_100014490
730 Ga0068860_100025103
731 Ga0068860_100384451
732 Ga0068860_101725549
733 Ga0068862_100000115
734 Ga0068862_100000716
735 Ga0068862_100004866
736 Ga0068862_100015638
737 Ga0068862_100018753
738 Ga0068862_100026182
739 Ga0068862_100504213
740 Ga0070717_10219145
741 Ga0075366_10050197
742 Ga0075429_100282276
743 Ga0097620_100000965
744 Ga0097620_100001079
745 Ga0097620_100009720
746 Ga0097620_100255114
747 Ga0097620_100476335
748 Ga0097620_102416993
749 Ga0105251_10054254
750 Ga0105251_10073113
751 Ga0105250_10252168
752 Ga0105250_10467857
753 Ga0105240_10723942
754 Ga0105247_10022323
755 Ga0105247_10225942
756 Ga0105241_10123039
757 Ga0105241_10288997
758 Ga0105248_10000719
759 Ga0105248_10021643
760 Ga0105248_10023215
761 Ga0105248_10039813
762 Ga0105248_10091394
763 Ga0105248_10111958
764 Ga0105248_10281301
765 Ga0105248_12576382
766 Ga0105238_10087105
767 Ga0105238_10647290
768 Ga0105238_11164363
769 Ga0105249_10000064
770 Ga0105249_10002202
771 Ga0105249_10467853
772 Ga0105249_10862738
773 Ga0157327_1073075
774 Ga0157326_1000001
775 Ga0157373_10035475
776 Ga0157371_10023554
777 Ga0157370_10027671
778 Ga0157369_10052060
779 Ga0163162_10004217
780 Ga0163162_10045046
781 Ga0157375_11159547
782 Ga0163163_10000123
783 Ga0163163_10055648
784 Ga0163163_10252812
785 Ga0163163_13138556
786 Ga0157380_10009996
787 Ga0157380_10148059
788 Ga0157380_10972097
789 Ga0157379_10010623
790 Ga0157379_10025000
791 Ga0157379_10165506
792 Ga0157376_11071495
793 Ga0163161_10002050
794 Ga0207672_1002083
795 Ga0207673_1002233
796 Ga0209050_1026404
797 Ga0209050_1049014
798 Ga0207697_10000699
799 Ga0207697_10044372
800 Ga0207697_10243171
801 Ga0207656_10003701
802 Ga0207656_10011612
803 Ga0207656_10029089
804 Ga0207696_1174715
805 Ga0207710_10004106
806 Ga0207680_10000009
807 Ga0207680_10000253
808 Ga0207680_10001021
809 Ga0207680_10053827
810 Ga0207680_10056586
811 Ga0207680_10330458
812 Ga0207647_10017660
813 Ga0207647_10019264
814 Ga0207705_10000086
815 Ga0207705_11184478
816 Ga0207654_10003465
817 Ga0207707_10018528
818 Ga0207707_10734544
819 Ga0207695_10001846
820 Ga0207695_11128925
821 Ga0207671_10001516
822 Ga0207657_10001020
823 Ga0207649_10000420
824 Ga0207652_10860060
825 Ga0207681_10000010
826 Ga0207681_10003625
827 Ga0207681_10010008
828 Ga0207681_10093567
829 Ga0207694_10003515
830 Ga0207650_10002156
831 Ga0207650_10002978
832 Ga0207650_10019363
833 Ga0207650_10021114
834 Ga0207650_10099170
835 Ga0207659_10005663
836 Ga0207659_10314789
837 Ga0207664_10233077
838 Ga0207644_10000004
839 Ga0207644_10000007
840 Ga0207644_10000447
841 Ga0207644_10005175
842 Ga0207644_10013631
843 Ga0207644_10252125
844 Ga0207690_10000413
845 Ga0207690_10121334
846 Ga0207690_10243948
847 Ga0207690_10258090
848 Ga0207690_10450337
849 Ga0207706_10000192
850 Ga0207709_10316718
851 Ga0207670_10071222
852 Ga0207704_10173422
853 Ga0207691_10003939
854 Ga0207711_10002038
855 Ga0207711_10011658
856 Ga0207711_10046882
857 Ga0207711_10085480
858 Ga0207689_10520252
859 Ga0207661_10045917
860 Ga0207679_10000347
861 Ga0207667_10000850
862 Ga0207667_10014998
863 Ga0207667_10748127
864 Ga0207651_10003751
865 Ga0207712_10000044
866 Ga0207712_10010030
867 Ga0207712_10750592
868 Ga0207712_11056442
869 Ga0207668_10001156
870 Ga0207668_10001363
871 Ga0207668_10007256
872 Ga0207640_10016104
873 Ga0207640_10023032
874 Ga0207640_10310959
875 Ga0207640_10421722
876 Ga0207640_10548859
877 Ga0207640_11965909
878 Ga0207658_10000026
879 Ga0207658_10000254
880 Ga0207658_10000340
881 Ga0207658_10005150
882 Ga0207658_10005466
883 Ga0207658_10095372
884 Ga0207658_10161140
885 Ga0207703_10002337
886 Ga0207703_10002950
887 Ga0207703_10014818
888 Ga0207703_10016442
889 Ga0207639_10000263
890 Ga0207639_10000412
891 Ga0207639_10103752
892 Ga0207678_10001460
893 Ga0207678_10053816
894 Ga0207708_10373668
895 Ga0207702_10001692
896 Ga0207702_10005023
897 Ga0207641_10000672
898 Ga0207641_10005605
899 Ga0207641_10022495
900 Ga0207641_10031888
901 Ga0207641_10033632
902 Ga0207641_10042063
903 Ga0207641_10043158
904 Ga0207676_10001067
905 Ga0207676_10001455
906 Ga0207676_10043969
907 Ga0207676_10049945
908 Ga0207674_10000748
909 Ga0207674_10057696
910 Ga0207674_10480639
911 Ga0207675_100000329
912 Ga0207675_100001681
913 Ga0207675_100025310
914 Ga0207675_100089329
915 Ga0207683_11723830
916 Ga0207698_10000542
917 Ga0207698_10046733
918 Ga0207698_10347588
919 Ga0207698_10389972
920 Ga0207698_10855395
921 Ga0207698_11210090
922 Ga0209970_1011930
923 Ga0268266_10000069
924 Ga0268266_10003034
925 Ga0268265_10000058
926 Ga0268265_10000100
927 Ga0268265_10000986
928 Ga0268265_10007112
929 Ga0268265_10025071
930 Ga0268265_10382869
931 Ga0268264_10000076
932 Ga0268264_10000083
933 Ga0268264_10000106
934 Ga0268264_10000131
935 Ga0268264_10030330
936 Ga0268264_11245513
937 Ga0307513_10323622
938 Ga0307408_100066571
939 Ga0307408_100088644
940 Ga0307408_100129153
941 Ga0307408_100131443
942 Ga0307408_100618051
943 Ga0307408_100988659
944 Ga0307405_11156056
945 Ga0307413_10005361
946 Ga0307413_10041725
947 Ga0307413_10249290
948 Ga0307413_10343345
949 Ga0307413_11660976
950 Ga0307410_10100906
951 Ga0307410_10299399
952 Ga0307410_10829470
953 Ga0307406_10012598
954 Ga0307406_10115282
955 Ga0307406_10216930
956 Ga0307406_10471821
957 Ga0307406_10578161
958 Ga0307407_10008174
959 Ga0307407_11425177
960 Ga0307407_11550967
961 Ga0307412_10328090
962 Ga0307412_10341491
963 Ga0307412_10342973
964 Ga0307412_11012947
965 Ga0307412_11401105
966 Ga0307409_100077741
967 Ga0307409_100233395
968 Ga0307409_101003507
969 Ga0307416_100018663
970 Ga0307416_100103144
971 Ga0307416_100352298
972 Ga0307416_100755142
973 Ga0307416_102715207
974 Ga0307414_10031283
975 Ga0307414_10046786
976 Ga0307414_10119765
977 Ga0307414_10121460
978 Ga0307414_10595855
979 Ga0307414_10964175
980 Ga0307411_10167875
981 Ga0307411_10202992
982 Ga0307411_10438590
983 Ga0307411_10894272
984 Ga0307411_11459838
985 Ga0307411_11562611
986 Ga0373959_0191581
987 Ga0373938_0204356
988 Ga0373952_0010930
989 Ga0373939_0052096
990 Ga0373943_0123320
991 Ga0373942_0004964
992 Ga0373961_0025745
993 Ga0373962_0208689
994 Ga0373931_0001320
995 Ga0373927_0261267
996 Ga0373947_0159059
997 Ga0373925_0317011
998 Ga0395905_0846941
999 Ga0436364_0906193
1000 Ga0436364_1230255
1001 Ga0439432_017031
1002 Ga0450902_087658
1003 Ga0466961_0075701
1004 Ga0466961_0261135
1005 Ga0466963_0010200
1006 Ga0466963_0012634
1007 Ga0466971_0110436
1008 Ga0466970_0084406
1009 Ga0466957_0022875
1010 Ga0451576_0000007
1011 Ga0451576_1554742
1012 Ga0466958_0013804
1013 Ga0495638_0051791
1014 Ga0495638_0080503
1015 Ga0495638_0088020
1016 Ga0495638_0440949
1017 Ga0495605_0072917
1018 Ga0495607_0287126
1019 Ga0495610_0001009
1020 Ga0495637_0092985
1021 Ga0495643_0000080
1022 Ga0495643_0024092
1023 Ga0495643_0024657
1024 Ga0495648_0057871
1025 Ga0495609_0139141
1026 Ga0495597_0012300
1027 Ga0495597_0253984
1028 Ga0495633_0031232
1029 Ga0495633_0154810
1030 Ga0495668_0204485
1031 Ga0495611_0114040
1032 Ga0495625_0019526
1033 Ga0495669_0162392
1034 Ga0495681_0340408
1035 Ga0495686_0038737
1036 Ga0495686_0105395
1037 Ga0496100_0049815
1038 Ga0496101_0016491
1039 Ga0496102_0015704
1040 Ga0496102_0062272
1041 Ga0496102_0229872
1042 Ga0496103_0003007
1043 Ga0496103_0069879
1044 Ga0496103_0196673
1045 Ga0496104_0021849
1046 Ga0496104_0120478
1047 Ga0496105_0198812
1048 Ga0496106_0000220
1049 Ga0496106_1315609
1050 Ga0496107_0003475
1051 Ga0496107_0060738
1052 Ga0496107_0732220
1053 Ga0496108_0027579
1054 Ga0496108_0032484
1055 Ga0496108_0082084
1056 Ga0496109_0161201
1057 Ga0496109_0203096
1058 Ga0496109_0347777
1059 Ga0496109_1056964
1060 Ga0496112_1037137
1061 Ga0496113_0108148
1062 Ga0496115_1354229
1063 Ga0496116_0044811
1064 Ga0496116_0051231
1065 Ga0496116_0173293
1066 Ga0496117_0007931
1067 Ga0496117_0008015
1068 Ga0496117_0012887
1069 Ga0496118_0007538
1070 Ga0496118_0024094
1071 Ga0496118_0435898
1072 Ga0496120_0307401
1073 Ga0496121_0000652
1074 Ga0496121_0001561
1075 Ga0496121_0373988
1076 Ga0496124_0010858
1077 Ga0496124_0069061
1078 Ga0496124_0142620
1079 Ga0496124_0170821
1080 Ga0496124_0565373
1081 Ga0496124_0620236
1082 Ga0496125_0019357
1083 Ga0496125_0144903
1084 Ga0496125_0167279
1085 Ga0496125_0217475
1086 Ga0496126_0017533
1087 Ga0496126_0025141
1088 Ga0496126_0537164
1089 Ga0501290_000583
1090 Ga0501292_000302
1091 Ga0501294_000609
1092 Ga0501301_005466
1093 Ga0501317_005838
1094 Ga0501038_0161392
1095 Ga0501043_0072909
1096 Ga0501046_1077179
1097 Ga0501047_0000773
1098 Ga0501048_0239358
1099 Ga0501206_004309
1100 Ga0501222_000402
1101 Ga0501223_003349
1102 Ga0501224_000607
1103 Ga0501235_015441
1104 Ga0501249_018938
1105 Ga0501259_000972
1106 Ga0501261_000317
1107 Ga0501225_0060979
1108 Ga0501245_006510
1109 Ga0501279_000304
1110 Ga0501280_001289
1111 Ga0501281_00219
1112 Ga0501282_000287
1113 Ga0501035_0080160
1114 Ga0501044_0229628
1115 Ga0501204_008088
1116 nmdc:mga0k408_171067_c1
1117 nmdc:mga07m45_146615_c1
1118 nmdc:mga09592_429369_c1
1119 Ga0500643_000400
1120 Ga0500643_002227
1121 Ga0500643_005673
1122 Ga0500647_0077967
1123 Ga0500583_0146956
1124 Ga0500651_0005593
1125 Ga0500641_0010528
1126 Ga0500650_0165690
1127 Ga0500650_0435108
1128 Ga0500556_0000158
1129 Ga0500556_0126992
1130 Ga0500557_073418
1131 Ga0500608_044664
1132 Ga0500618_076155
1133 Ga0500642_0000001
1134 Ga0500642_0000923
1135 Ga0500655_000452
1136 Ga0500590_001369
1137 Ga0500622_0012908
1138 Ga0500624_000012
1139 Ga0500627_0000056
1140 Ga0500636_0153009
1141 Ga0500570_005787
1142 Ga0500645_002048
1143 Ga0500645_036254
1144 Ga0466962_0179996
1145 2585263315
1146 2643728099
1147 2643948640
1148 2644038926
1149 2644042952
1150 2644395617
1151 2809064790
1152 2809080757
1153 2809085122
1154 2852681719
1155 2880521818
1156 2896255764
1157 2896432012
1158 3000865315

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01648

ACPS

4'-phosphopantetheinyl transferase superfamily

11

131

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9345 1 129
5xuh-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) d9a mutant in complex with coa 0.9171 1 129
5xu7-assembly1.cif.gz_C crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9152 1 129
3qmn-assembly1.cif.gz_B crystal structure of 4'-phosphopantetheinyl transferase acps from vibrio cholerae o1 biovar eltor 0.9133 1 129
5xu7-assembly1.cif.gz_A crystal structure of escherichia coli holo-[acyl-carrier-protein] synthase (acps) 0.9118 1 129
ID Description Score Start End Superfamily
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.9047 1 129 3.90.470.20
5xuhB00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8904 1 129 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8816 1 129 3.90.470.20
5cmoC00 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8686 1 129 3.90.470.20
af_Q552R4_1_166_3.90.470.20 Alpha Beta;Alpha-Beta Complex;Ribosomal Protein L22; Chain A;4'-phosphopantetheinyl transferase domain 0.8654 1 131 3.90.470.20
ID Description Score Start End GO Terms
AF-A0A1H1LA01-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9956 1 133 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A840HS87-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9955 1 133 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A1T5BAD5-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9954 1 132 GO:0000287
GO:0005737
GO:0006633
GO:0008897
AF-A0A3B0REA0-F1-model_v4 Holo-[acyl-carrier-protein] synthase (EC 2.7.8.7) 0.9953 1 133 GO:0000287
GO:0006633
GO:0008897
AF-A0A519QVN2-F1-model_v4 Holo-[acyl-carrier-protein] synthase (Holo-ACP synthase) (EC 2.7.8.7) (4'-phosphopantetheinyl transferase AcpS) 0.9953 1 133 GO:0000287
GO:0005737
GO:0006633
GO:0008897

Map