F465837
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 579 | 256 | 1158 | 82 |
Family's Representative Sequence
| Representative Sequence | 3300025920|Ga0207649_10497233|Ga0207649_104972331 |
| Length | 95 |
| Sequence | MTPLLTCKEFLQELTDYLDEKTDAELRAKLERHITECPNCWVVADTTRKTIQIYKGMEPCSIPADVEGRLMKALEAKIAAKQAHLTGAAGLFKQG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 3 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 6 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 53 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 57 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 65 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 66 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300019181 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 95 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 97 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 98 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 99 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 104 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 105 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300030877 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 159 | 3300030880 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 160 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 161 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 162 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 164 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 166 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 167 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 170 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 172 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 173 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 174 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 178 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 180 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 181 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 182 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 183 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 187 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 188 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 189 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 190 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 191 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 192 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 193 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 196 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 197 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 198 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 232 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 234 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 235 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 238 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 240 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 241 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 242 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 243 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 244 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 245 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 246 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 247 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 248 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 249 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 250 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 251 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 252 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 89.98 |
| Metatranscriptomes | 10.02 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.86 |
| Rhizosphere | 97.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 54.75 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207649_10497233 | 3300025920 | Bacteria | 927 |
| 2 | Ga0058859_11431176 | 3300004798 | Unclassified | 510 |
| 3 | Ga0058863_10019330 | 3300004799 | Unclassified | 954 |
| 4 | Ga0058863_11521521 | 3300004799 | Unclassified | 890 |
| 5 | Ga0058861_11377615 | 3300004800 | Bacteria | 784 |
| 6 | Ga0058861_11682296 | 3300004800 | Unclassified | 936 |
| 7 | Ga0058861_11862140 | 3300004800 | Unclassified | 530 |
| 8 | Ga0058860_12036233 | 3300004801 | Unclassified | 598 |
| 9 | Ga0058862_12546383 | 3300004803 | Bacteria | 575 |
| 10 | Ga0058862_12602623 | 3300004803 | Unclassified | 884 |
| 11 | Ga0070676_10189067 | 3300005328 | Bacteria | 1343 |
| 12 | Ga0070676_10228262 | 3300005328 | Unclassified | 1233 |
| 13 | Ga0070683_100000106 | 3300005329 | Bacteria | 54661 |
| 14 | Ga0070683_100579736 | 3300005329 | Unclassified | 1073 |
| 15 | Ga0070683_101015517 | 3300005329 | Bacteria | 796 |
| 16 | Ga0070683_101255622 | 3300005329 | Unclassified | 712 |
| 17 | Ga0070683_101710137 | 3300005329 | Unclassified | 605 |
| 18 | Ga0070666_10358888 | 3300005335 | Unclassified | 1044 |
| 19 | Ga0070666_10848464 | 3300005335 | Bacteria | 674 |
| 20 | Ga0070680_100006829 | 3300005336 | Bacteria | 8697 |
| 21 | Ga0070682_100633258 | 3300005337 | Bacteria | 849 |
| 22 | Ga0068868_100381495 | 3300005338 | Unclassified | 1213 |
| 23 | Ga0068868_101470709 | 3300005338 | Unclassified | 637 |
| 24 | Ga0070689_100351308 | 3300005340 | Bacteria | 1237 |
| 25 | Ga0070689_100526196 | 3300005340 | Bacteria | 1016 |
| 26 | Ga0070687_101294234 | 3300005343 | Bacteria | 541 |
| 27 | Ga0070661_100200087 | 3300005344 | Unclassified | 1526 |
| 28 | Ga0070675_100967256 | 3300005354 | Bacteria | 781 |
| 29 | Ga0070674_100123799 | 3300005356 | Unclassified | 1917 |
| 30 | Ga0070674_102142181 | 3300005356 | Unclassified | 510 |
| 31 | Ga0070673_100332715 | 3300005364 | Unclassified | 1344 |
| 32 | Ga0070688_100236190 | 3300005365 | Bacteria | 1295 |
| 33 | Ga0070688_101308786 | 3300005365 | Unclassified | 585 |
| 34 | Ga0070659_100143096 | 3300005366 | Bacteria | 1947 |
| 35 | Ga0070667_100714070 | 3300005367 | Unclassified | 928 |
| 36 | Ga0070667_100878026 | 3300005367 | Bacteria | 834 |
| 37 | Ga0070667_101171697 | 3300005367 | Unclassified | 719 |
| 38 | Ga0070714_100032741 | 3300005435 | Bacteria | 4341 |
| 39 | Ga0070714_100156076 | 3300005435 | Bacteria | 2060 |
| 40 | Ga0070713_100001239 | 3300005436 | Bacteria | 16326 |
| 41 | Ga0070713_100041160 | 3300005436 | Bacteria | 3763 |
| 42 | Ga0070713_100069063 | 3300005436 | Bacteria | 2979 |
| 43 | Ga0070713_100177508 | 3300005436 | Unclassified | 1912 |
| 44 | Ga0070713_100211533 | 3300005436 | Unclassified | 1756 |
| 45 | Ga0070710_10804174 | 3300005437 | Unclassified | 672 |
| 46 | Ga0070711_100011107 | 3300005439 | Bacteria | 5587 |
| 47 | Ga0070711_101038225 | 3300005439 | Unclassified | 704 |
| 48 | Ga0070705_100682896 | 3300005440 | Unclassified | 804 |
| 49 | Ga0070700_101364060 | 3300005441 | Unclassified | 598 |
| 50 | Ga0070662_100726347 | 3300005457 | Bacteria | 841 |
| 51 | Ga0070681_10478609 | 3300005458 | Bacteria | 1158 |
| 52 | Ga0068867_100608221 | 3300005459 | Bacteria | 954 |
| 53 | Ga0068867_100974921 | 3300005459 | Unclassified | 767 |
| 54 | Ga0068867_101617205 | 3300005459 | Unclassified | 606 |
| 55 | Ga0070685_10702199 | 3300005466 | Bacteria | 738 |
| 56 | Ga0070685_11188532 | 3300005466 | Unclassified | 579 |
| 57 | Ga0070707_101318567 | 3300005468 | Unclassified | 688 |
| 58 | Ga0070699_101535107 | 3300005518 | Viruses | 610 |
| 59 | Ga0070679_100162016 | 3300005530 | Bacteria | 2211 |
| 60 | Ga0070679_100170119 | 3300005530 | Bacteria | 2152 |
| 61 | Ga0070679_100296811 | 3300005530 | Unclassified | 1567 |
| 62 | Ga0070684_100000710 | 3300005535 | Bacteria | 23047 |
| 63 | Ga0070684_100067812 | 3300005535 | Bacteria | 3135 |
| 64 | Ga0070684_100473201 | 3300005535 | Bacteria | 1159 |
| 65 | Ga0070684_100700087 | 3300005535 | Unclassified | 944 |
| 66 | Ga0070684_100892748 | 3300005535 | Bacteria | 833 |
| 67 | Ga0070684_101224066 | 3300005535 | Unclassified | 706 |
| 68 | Ga0070697_100276262 | 3300005536 | Bacteria | 1441 |
| 69 | Ga0068853_100591541 | 3300005539 | Unclassified | 1053 |
| 70 | Ga0068853_100653184 | 3300005539 | Bacteria | 1001 |
| 71 | Ga0070672_100432908 | 3300005543 | Bacteria | 1131 |
| 72 | Ga0070672_101754636 | 3300005543 | Unclassified | 558 |
| 73 | Ga0070686_101007754 | 3300005544 | Bacteria | 683 |
| 74 | Ga0070695_100720045 | 3300005545 | Bacteria | 793 |
| 75 | Ga0070696_100147632 | 3300005546 | Bacteria | 1723 |
| 76 | Ga0070693_101453879 | 3300005547 | Unclassified | 534 |
| 77 | Ga0070665_100223223 | 3300005548 | Unclassified | 1885 |
| 78 | Ga0070665_100326803 | 3300005548 | Bacteria | 1538 |
| 79 | Ga0070665_100376115 | 3300005548 | Unclassified | 1427 |
| 80 | Ga0070665_100802902 | 3300005548 | Unclassified | 954 |
| 81 | Ga0068855_100050093 | 3300005563 | Bacteria | 4923 |
| 82 | Ga0068855_100099560 | 3300005563 | Bacteria | 3348 |
| 83 | Ga0068855_100136689 | 3300005563 | Unclassified | 2796 |
| 84 | Ga0068855_100518276 | 3300005563 | Unclassified | 1294 |
| 85 | Ga0068855_101383011 | 3300005563 | Bacteria | 726 |
| 86 | Ga0068855_101803032 | 3300005563 | Unclassified | 622 |
| 87 | Ga0070664_102066650 | 3300005564 | Unclassified | 541 |
| 88 | Ga0070664_102261604 | 3300005564 | Unclassified | 516 |
| 89 | Ga0068857_100793152 | 3300005577 | Unclassified | 904 |
| 90 | Ga0068857_100882059 | 3300005577 | Bacteria | 857 |
| 91 | Ga0068857_101287585 | 3300005577 | Unclassified | 709 |
| 92 | Ga0068857_101517421 | 3300005577 | Unclassified | 653 |
| 93 | Ga0068856_101249226 | 3300005614 | Unclassified | 759 |
| 94 | Ga0068856_101811215 | 3300005614 | Unclassified | 622 |
| 95 | Ga0068856_102182963 | 3300005614 | Unclassified | 563 |
| 96 | Ga0070702_101696780 | 3300005615 | Bacteria | 525 |
| 97 | Ga0068852_100040822 | 3300005616 | Unclassified | 3918 |
| 98 | Ga0068852_100047240 | 3300005616 | Bacteria | 3672 |
| 99 | Ga0068852_100080299 | 3300005616 | Unclassified | 2891 |
| 100 | Ga0068852_101733936 | 3300005616 | Unclassified | 647 |
| 101 | Ga0068859_101426057 | 3300005617 | Unclassified | 764 |
| 102 | Ga0068859_101686868 | 3300005617 | Unclassified | 700 |
| 103 | Ga0068864_101093816 | 3300005618 | Unclassified | 793 |
| 104 | Ga0068864_101878542 | 3300005618 | Bacteria | 604 |
| 105 | Ga0068870_10382257 | 3300005840 | Unclassified | 912 |
| 106 | Ga0068863_100138454 | 3300005841 | Bacteria | 2326 |
| 107 | Ga0068863_101234534 | 3300005841 | Unclassified | 754 |
| 108 | Ga0068863_101617973 | 3300005841 | Bacteria | 657 |
| 109 | Ga0068858_100124399 | 3300005842 | Bacteria | 2414 |
| 110 | Ga0068858_100254177 | 3300005842 | Unclassified | 1669 |
| 111 | Ga0068858_100267128 | 3300005842 | Bacteria | 1627 |
| 112 | Ga0068858_100390577 | 3300005842 | Unclassified | 1336 |
| 113 | Ga0068858_100802961 | 3300005842 | Bacteria | 918 |
| 114 | Ga0068858_101553153 | 3300005842 | Unclassified | 653 |
| 115 | Ga0068860_100917612 | 3300005843 | Unclassified | 892 |
| 116 | Ga0068860_100917920 | 3300005843 | Unclassified | 892 |
| 117 | Ga0068860_101398744 | 3300005843 | Unclassified | 721 |
| 118 | Ga0068860_102773100 | 3300005843 | Unclassified | 508 |
| 119 | Ga0068862_101261525 | 3300005844 | Unclassified | 739 |
| 120 | Ga0068862_102733802 | 3300005844 | Unclassified | 505 |
| 121 | Ga0070717_10019244 | 3300006028 | Bacteria | 5352 |
| 122 | Ga0070717_10042408 | 3300006028 | Bacteria | 3711 |
| 123 | Ga0070717_10253191 | 3300006028 | Bacteria | 1556 |
| 124 | Ga0070717_10672511 | 3300006028 | Unclassified | 940 |
| 125 | Ga0070717_11188915 | 3300006028 | Bacteria | 694 |
| 126 | Ga0070717_11294096 | 3300006028 | Unclassified | 663 |
| 127 | Ga0070716_100142131 | 3300006173 | Bacteria | 1532 |
| 128 | Ga0070716_100357575 | 3300006173 | Unclassified | 1036 |
| 129 | Ga0070716_100659873 | 3300006173 | Unclassified | 794 |
| 130 | Ga0070716_100766372 | 3300006173 | Unclassified | 744 |
| 131 | Ga0070712_100347073 | 3300006175 | Unclassified | 1214 |
| 132 | Ga0070712_100551649 | 3300006175 | Unclassified | 971 |
| 133 | Ga0097621_100126945 | 3300006237 | Bacteria | 2168 |
| 134 | Ga0097621_100184569 | 3300006237 | Bacteria | 1804 |
| 135 | Ga0097621_100491797 | 3300006237 | Bacteria | 1110 |
| 136 | Ga0097621_100560489 | 3300006237 | Unclassified | 1041 |
| 137 | Ga0097621_101537244 | 3300006237 | Bacteria | 632 |
| 138 | Ga0097621_102027559 | 3300006237 | Unclassified | 550 |
| 139 | Ga0068871_100129331 | 3300006358 | Bacteria | 2140 |
| 140 | Ga0068871_100285963 | 3300006358 | Unclassified | 1444 |
| 141 | Ga0068871_100301413 | 3300006358 | Unclassified | 1407 |
| 142 | Ga0068871_100495170 | 3300006358 | Unclassified | 1101 |
| 143 | Ga0068871_101107124 | 3300006358 | Unclassified | 741 |
| 144 | Ga0068871_101385729 | 3300006358 | Bacteria | 663 |
| 145 | Ga0068871_102335754 | 3300006358 | Unclassified | 510 |
| 146 | Ga0075428_101839331 | 3300006844 | Unclassified | 630 |
| 147 | Ga0075431_100007713 | 3300006847 | Bacteria | 10716 |
| 148 | Ga0075431_100293428 | 3300006847 | Unclassified | 1644 |
| 149 | Ga0075431_100990850 | 3300006847 | Unclassified | 807 |
| 150 | Ga0068865_100752953 | 3300006881 | Unclassified | 837 |
| 151 | Ga0068865_100800782 | 3300006881 | Bacteria | 813 |
| 152 | Ga0075436_100725721 | 3300006914 | Unclassified | 737 |
| 153 | Ga0097620_101425623 | 3300006931 | Unclassified | 764 |
| 154 | Ga0097620_101662453 | 3300006931 | Unclassified | 705 |
| 155 | Ga0097620_101686633 | 3300006931 | Unclassified | 700 |
| 156 | Ga0075435_100855082 | 3300007076 | Bacteria | 793 |
| 157 | Ga0105240_10002103 | 3300009093 | Bacteria | 32584 |
| 158 | Ga0105240_10356355 | 3300009093 | Unclassified | 1658 |
| 159 | Ga0105240_10959364 | 3300009093 | Unclassified | 917 |
| 160 | Ga0111539_11572424 | 3300009094 | Unclassified | 763 |
| 161 | Ga0105245_10413250 | 3300009098 | Unclassified | 1351 |
| 162 | Ga0105245_11066098 | 3300009098 | Unclassified | 854 |
| 163 | Ga0105245_11106840 | 3300009098 | Bacteria | 838 |
| 164 | Ga0105245_11774794 | 3300009098 | Bacteria | 670 |
| 165 | Ga0105245_12357607 | 3300009098 | Unclassified | 586 |
| 166 | Ga0105247_10193279 | 3300009101 | Bacteria | 1364 |
| 167 | Ga0105247_10747752 | 3300009101 | Bacteria | 741 |
| 168 | Ga0114129_10182862 | 3300009147 | Bacteria | 2851 |
| 169 | Ga0105241_11307874 | 3300009174 | Unclassified | 691 |
| 170 | Ga0105241_11458766 | 3300009174 | Bacteria | 657 |
| 171 | Ga0105241_12161896 | 3300009174 | Unclassified | 551 |
| 172 | Ga0105242_10699898 | 3300009176 | Bacteria | 991 |
| 173 | Ga0105242_12021016 | 3300009176 | Bacteria | 619 |
| 174 | Ga0105242_13298595 | 3300009176 | Unclassified | 502 |
| 175 | Ga0105248_10084525 | 3300009177 | Unclassified | 3570 |
| 176 | Ga0105248_10380699 | 3300009177 | Bacteria | 1589 |
| 177 | Ga0105248_10554766 | 3300009177 | Bacteria | 1296 |
| 178 | Ga0105248_11270983 | 3300009177 | Unclassified | 832 |
| 179 | Ga0105248_13168694 | 3300009177 | Bacteria | 523 |
| 180 | Ga0105237_10014239 | 3300009545 | Bacteria | 8327 |
| 181 | Ga0105237_10076594 | 3300009545 | Bacteria | 3335 |
| 182 | Ga0105237_11163799 | 3300009545 | Unclassified | 778 |
| 183 | Ga0105237_11269098 | 3300009545 | Unclassified | 743 |
| 184 | Ga0105238_10171633 | 3300009551 | Bacteria | 2145 |
| 185 | Ga0105238_10428539 | 3300009551 | Unclassified | 1318 |
| 186 | Ga0105238_12788119 | 3300009551 | Unclassified | 525 |
| 187 | Ga0105249_10828171 | 3300009553 | Unclassified | 990 |
| 188 | Ga0105249_11787751 | 3300009553 | Bacteria | 687 |
| 189 | Ga0105249_11973742 | 3300009553 | Unclassified | 656 |
| 190 | Ga0105239_10032817 | 3300010375 | Bacteria | 5705 |
| 191 | Ga0105239_11972442 | 3300010375 | Bacteria | 677 |
| 192 | Ga0105239_12819467 | 3300010375 | Unclassified | 567 |
| 193 | Ga0105246_10259631 | 3300011119 | Bacteria | 1383 |
| 194 | Ga0105246_10797203 | 3300011119 | Unclassified | 838 |
| 195 | Ga0157370_10001006 | 3300013104 | Bacteria | 35575 |
| 196 | Ga0157369_10020452 | 3300013105 | Bacteria | 7398 |
| 197 | Ga0157369_10767910 | 3300013105 | Unclassified | 991 |
| 198 | Ga0157374_10647625 | 3300013296 | Bacteria | 1068 |
| 199 | Ga0157374_10904888 | 3300013296 | Unclassified | 900 |
| 200 | Ga0157374_11497039 | 3300013296 | Unclassified | 698 |
| 201 | Ga0157374_11505227 | 3300013296 | Unclassified | 696 |
| 202 | Ga0157374_12263576 | 3300013296 | Unclassified | 571 |
| 203 | Ga0157378_10457355 | 3300013297 | Bacteria | 1268 |
| 204 | Ga0157378_10821493 | 3300013297 | Bacteria | 956 |
| 205 | Ga0157378_11771784 | 3300013297 | Unclassified | 665 |
| 206 | Ga0157378_12378962 | 3300013297 | Unclassified | 581 |
| 207 | Ga0163162_10432417 | 3300013306 | Bacteria | 1448 |
| 208 | Ga0163162_10497018 | 3300013306 | Unclassified | 1350 |
| 209 | Ga0163162_10801368 | 3300013306 | Unclassified | 1059 |
| 210 | Ga0163162_10899535 | 3300013306 | Bacteria | 998 |
| 211 | Ga0163162_11076062 | 3300013306 | Bacteria | 911 |
| 212 | Ga0157372_10047703 | 3300013307 | Bacteria | 4760 |
| 213 | Ga0157372_11180634 | 3300013307 | Unclassified | 885 |
| 214 | Ga0157372_12771247 | 3300013307 | Unclassified | 562 |
| 215 | Ga0157375_10141906 | 3300013308 | Bacteria | 2530 |
| 216 | Ga0157375_10728593 | 3300013308 | Unclassified | 1144 |
| 217 | Ga0163163_10007638 | 3300014325 | Bacteria | 9550 |
| 218 | Ga0163163_10680404 | 3300014325 | Bacteria | 1092 |
| 219 | Ga0163163_11204843 | 3300014325 | Unclassified | 820 |
| 220 | Ga0163163_13305527 | 3300014325 | Unclassified | 503 |
| 221 | Ga0157380_10214656 | 3300014326 | Bacteria | 1717 |
| 222 | Ga0157377_11454484 | 3300014745 | Unclassified | 543 |
| 223 | Ga0157379_11989210 | 3300014968 | Unclassified | 574 |
| 224 | Ga0157379_12377725 | 3300014968 | Unclassified | 529 |
| 225 | Ga0157376_10096378 | 3300014969 | Bacteria | 2574 |
| 226 | Ga0157376_10181148 | 3300014969 | Bacteria | 1926 |
| 227 | Ga0157376_10516620 | 3300014969 | Unclassified | 1176 |
| 228 | Ga0157376_10793321 | 3300014969 | Unclassified | 959 |
| 229 | Ga0157376_11261800 | 3300014969 | Unclassified | 768 |
| 230 | Ga0157376_11786894 | 3300014969 | Unclassified | 651 |
| 231 | Ga0163161_11173828 | 3300017792 | Bacteria | 663 |
| 232 | Ga0163161_11518333 | 3300017792 | Unclassified | 588 |
| 233 | Ga0163161_11944847 | 3300017792 | Unclassified | 523 |
| 234 | Ga0184594_105567 | 3300019181 | Unclassified | 542 |
| 235 | Ga0197907_10671103 | 3300020069 | Bacteria | 1025 |
| 236 | Ga0197907_10677688 | 3300020069 | Unclassified | 980 |
| 237 | Ga0197907_11172313 | 3300020069 | Unclassified | 1304 |
| 238 | Ga0206356_10632151 | 3300020070 | Unclassified | 1047 |
| 239 | Ga0206356_10896598 | 3300020070 | Unclassified | 746 |
| 240 | Ga0206356_11136904 | 3300020070 | Unclassified | 639 |
| 241 | Ga0206349_1226731 | 3300020075 | Unclassified | 1020 |
| 242 | Ga0206355_1074272 | 3300020076 | Unclassified | 1296 |
| 243 | Ga0206355_1650620 | 3300020076 | Unclassified | 923 |
| 244 | Ga0206352_10009959 | 3300020078 | Unclassified | 518 |
| 245 | Ga0206352_10514620 | 3300020078 | Unclassified | 1021 |
| 246 | Ga0206352_10534455 | 3300020078 | Bacteria | 1149 |
| 247 | Ga0206352_10655281 | 3300020078 | Bacteria | 1064 |
| 248 | Ga0206350_10520751 | 3300020080 | Unclassified | 1257 |
| 249 | Ga0206354_10031776 | 3300020081 | Unclassified | 920 |
| 250 | Ga0206354_11247450 | 3300020081 | Bacteria | 1140 |
| 251 | Ga0206353_10597002 | 3300020082 | Unclassified | 977 |
| 252 | Ga0206353_11219566 | 3300020082 | Unclassified | 1001 |
| 253 | Ga0206353_11547426 | 3300020082 | Bacteria | 938 |
| 254 | Ga0213876_10027352 | 3300021384 | Bacteria | 3010 |
| 255 | Ga0213875_10137840 | 3300021388 | Bacteria | 1141 |
| 256 | Ga0213875_10372084 | 3300021388 | Unclassified | 680 |
| 257 | Ga0224712_10115543 | 3300022467 | Bacteria | 1156 |
| 258 | Ga0224712_10192405 | 3300022467 | Unclassified | 924 |
| 259 | Ga0224712_10551295 | 3300022467 | Unclassified | 560 |
| 260 | Ga0207682_10273661 | 3300025893 | Unclassified | 789 |
| 261 | Ga0207692_10612186 | 3300025898 | Bacteria | 701 |
| 262 | Ga0207710_10777109 | 3300025900 | Unclassified | 503 |
| 263 | Ga0207680_10063596 | 3300025903 | Unclassified | 2259 |
| 264 | Ga0207680_10198249 | 3300025903 | Bacteria | 1367 |
| 265 | Ga0207685_10122388 | 3300025905 | Bacteria | 1144 |
| 266 | Ga0207645_10775792 | 3300025907 | Unclassified | 652 |
| 267 | Ga0207645_11046269 | 3300025907 | Unclassified | 552 |
| 268 | Ga0207705_10526724 | 3300025909 | Unclassified | 918 |
| 269 | Ga0207654_10346407 | 3300025911 | Unclassified | 1022 |
| 270 | Ga0207654_11262478 | 3300025911 | Unclassified | 538 |
| 271 | Ga0207707_10392075 | 3300025912 | Bacteria | 1193 |
| 272 | Ga0207695_10070246 | 3300025913 | Unclassified | 3581 |
| 273 | Ga0207695_10152574 | 3300025913 | Bacteria | 2248 |
| 274 | Ga0207695_10835679 | 3300025913 | Unclassified | 801 |
| 275 | Ga0207671_10014158 | 3300025914 | Bacteria | 6316 |
| 276 | Ga0207671_10176366 | 3300025914 | Bacteria | 1661 |
| 277 | Ga0207671_10368149 | 3300025914 | Unclassified | 1141 |
| 278 | Ga0207671_10380694 | 3300025914 | Unclassified | 1121 |
| 279 | Ga0207671_10438108 | 3300025914 | Unclassified | 1040 |
| 280 | Ga0207671_10610337 | 3300025914 | Bacteria | 869 |
| 281 | Ga0207671_11333452 | 3300025914 | Unclassified | 558 |
| 282 | Ga0207693_10126903 | 3300025915 | Unclassified | 2005 |
| 283 | Ga0207663_10012618 | 3300025916 | Bacteria | 4574 |
| 284 | Ga0207663_10216258 | 3300025916 | Bacteria | 1392 |
| 285 | Ga0207663_10632276 | 3300025916 | Bacteria | 843 |
| 286 | Ga0207660_10015229 | 3300025917 | Bacteria | 5073 |
| 287 | Ga0207660_11444253 | 3300025917 | Unclassified | 557 |
| 288 | Ga0207649_10231755 | 3300025920 | Bacteria | 1321 |
| 289 | Ga0207652_10134010 | 3300025921 | Bacteria | 2211 |
| 290 | Ga0207652_10477068 | 3300025921 | Bacteria | 1124 |
| 291 | Ga0207681_10927563 | 3300025923 | Unclassified | 730 |
| 292 | Ga0207694_10150957 | 3300025924 | Bacteria | 1872 |
| 293 | Ga0207694_10655649 | 3300025924 | Bacteria | 884 |
| 294 | Ga0207694_10659818 | 3300025924 | Unclassified | 881 |
| 295 | Ga0207650_10541444 | 3300025925 | Bacteria | 975 |
| 296 | Ga0207650_10911888 | 3300025925 | Bacteria | 746 |
| 297 | Ga0207659_10993653 | 3300025926 | Bacteria | 722 |
| 298 | Ga0207687_10443587 | 3300025927 | Bacteria | 1075 |
| 299 | Ga0207687_10736097 | 3300025927 | Bacteria | 838 |
| 300 | Ga0207687_10853081 | 3300025927 | Unclassified | 778 |
| 301 | Ga0207700_10002779 | 3300025928 | Bacteria | 10081 |
| 302 | Ga0207700_10054918 | 3300025928 | Bacteria | 2992 |
| 303 | Ga0207700_10474732 | 3300025928 | Bacteria | 1104 |
| 304 | Ga0207700_11893657 | 3300025928 | Unclassified | 523 |
| 305 | Ga0207664_10019610 | 3300025929 | Bacteria | 5001 |
| 306 | Ga0207664_10178458 | 3300025929 | Bacteria | 1822 |
| 307 | Ga0207644_10192586 | 3300025931 | Bacteria | 1604 |
| 308 | Ga0207690_10162284 | 3300025932 | Bacteria | 1667 |
| 309 | Ga0207686_10667267 | 3300025934 | Unclassified | 824 |
| 310 | Ga0207686_11609528 | 3300025934 | Unclassified | 536 |
| 311 | Ga0207670_10233680 | 3300025936 | Bacteria | 1413 |
| 312 | Ga0207670_10263815 | 3300025936 | Bacteria | 1336 |
| 313 | Ga0207704_10847736 | 3300025938 | Unclassified | 766 |
| 314 | Ga0207704_10990590 | 3300025938 | Bacteria | 710 |
| 315 | Ga0207704_11207801 | 3300025938 | Unclassified | 645 |
| 316 | Ga0207665_10136076 | 3300025939 | Bacteria | 1748 |
| 317 | Ga0207691_10608302 | 3300025940 | Bacteria | 925 |
| 318 | Ga0207691_10860376 | 3300025940 | Unclassified | 760 |
| 319 | Ga0207711_10101279 | 3300025941 | Unclassified | 2549 |
| 320 | Ga0207711_10344085 | 3300025941 | Unclassified | 1380 |
| 321 | Ga0207711_10465203 | 3300025941 | Unclassified | 1178 |
| 322 | Ga0207711_10662397 | 3300025941 | Bacteria | 974 |
| 323 | Ga0207711_11505867 | 3300025941 | Unclassified | 616 |
| 324 | Ga0207711_12067822 | 3300025941 | Bacteria | 512 |
| 325 | Ga0207689_10704792 | 3300025942 | Bacteria | 851 |
| 326 | Ga0207689_11033664 | 3300025942 | Unclassified | 693 |
| 327 | Ga0207661_10000054 | 3300025944 | Bacteria | 88056 |
| 328 | Ga0207661_10265432 | 3300025944 | Unclassified | 1530 |
| 329 | Ga0207661_10417013 | 3300025944 | Bacteria | 1219 |
| 330 | Ga0207661_10493624 | 3300025944 | Unclassified | 1118 |
| 331 | Ga0207661_10887787 | 3300025944 | Bacteria | 821 |
| 332 | Ga0207661_12007447 | 3300025944 | Bacteria | 524 |
| 333 | Ga0207679_12204691 | 3300025945 | Unclassified | 500 |
| 334 | Ga0207667_10113338 | 3300025949 | Unclassified | 2796 |
| 335 | Ga0207667_10176642 | 3300025949 | Bacteria | 2193 |
| 336 | Ga0207667_10235657 | 3300025949 | Bacteria | 1873 |
| 337 | Ga0207651_10312202 | 3300025960 | Unclassified | 1311 |
| 338 | Ga0207651_11984228 | 3300025960 | Unclassified | 523 |
| 339 | Ga0207658_10313923 | 3300025986 | Unclassified | 1355 |
| 340 | Ga0207658_10734022 | 3300025986 | Unclassified | 894 |
| 341 | Ga0207658_11228608 | 3300025986 | Unclassified | 685 |
| 342 | Ga0207677_10366541 | 3300026023 | Unclassified | 1212 |
| 343 | Ga0207677_11316655 | 3300026023 | Unclassified | 664 |
| 344 | Ga0207677_11647808 | 3300026023 | Unclassified | 594 |
| 345 | Ga0207703_10144338 | 3300026035 | Bacteria | 2069 |
| 346 | Ga0207703_10216821 | 3300026035 | Bacteria | 1709 |
| 347 | Ga0207703_10683395 | 3300026035 | Unclassified | 975 |
| 348 | Ga0207703_10875007 | 3300026035 | Bacteria | 860 |
| 349 | Ga0207703_11852053 | 3300026035 | Unclassified | 579 |
| 350 | Ga0207703_11951225 | 3300026035 | Unclassified | 563 |
| 351 | Ga0207639_10156484 | 3300026041 | Bacteria | 1915 |
| 352 | Ga0207639_11628669 | 3300026041 | Unclassified | 605 |
| 353 | Ga0207702_11284625 | 3300026078 | Unclassified | 726 |
| 354 | Ga0207702_11412787 | 3300026078 | Unclassified | 690 |
| 355 | Ga0207641_10025690 | 3300026088 | Bacteria | 4856 |
| 356 | Ga0207641_10150987 | 3300026088 | Unclassified | 2104 |
| 357 | Ga0207641_11072626 | 3300026088 | Bacteria | 804 |
| 358 | Ga0207648_10500580 | 3300026089 | Unclassified | 1112 |
| 359 | Ga0207648_10510778 | 3300026089 | Bacteria | 1100 |
| 360 | Ga0207676_11061922 | 3300026095 | Bacteria | 800 |
| 361 | Ga0207676_11365219 | 3300026095 | Unclassified | 704 |
| 362 | Ga0207674_10288418 | 3300026116 | Bacteria | 1590 |
| 363 | Ga0207674_11050426 | 3300026116 | Unclassified | 784 |
| 364 | Ga0207683_11146901 | 3300026121 | Bacteria | 721 |
| 365 | Ga0207698_10028061 | 3300026142 | Bacteria | 4007 |
| 366 | Ga0207698_10088836 | 3300026142 | Bacteria | 2522 |
| 367 | Ga0207428_10841026 | 3300027907 | Unclassified | 650 |
| 368 | Ga0268266_10056752 | 3300028379 | Bacteria | 3369 |
| 369 | Ga0268266_10178896 | 3300028379 | Bacteria | 1930 |
| 370 | Ga0268266_10234265 | 3300028379 | Unclassified | 1692 |
| 371 | Ga0268266_11281790 | 3300028379 | Unclassified | 708 |
| 372 | Ga0268265_11103858 | 3300028380 | Bacteria | 788 |
| 373 | Ga0268264_10453639 | 3300028381 | Unclassified | 1243 |
| 374 | Ga0268264_10677792 | 3300028381 | Unclassified | 1022 |
| 375 | Ga0268264_10687989 | 3300028381 | Unclassified | 1015 |
| 376 | Ga0268264_10738469 | 3300028381 | Unclassified | 980 |
| 377 | Ga0265336_10258919 | 3300028666 | Unclassified | 517 |
| 378 | Ga0265338_10631489 | 3300028800 | Unclassified | 744 |
| 379 | Ga0265338_11058457 | 3300028800 | Unclassified | 548 |
| 380 | Ga0265777_124749 | 3300030877 | Bacteria | 511 |
| 381 | Ga0265776_102212 | 3300030880 | Unclassified | 883 |
| 382 | Ga0265760_10041399 | 3300031090 | Unclassified | 1373 |
| 383 | Ga0265760_10373122 | 3300031090 | Unclassified | 513 |
| 384 | Ga0265330_10091818 | 3300031235 | Unclassified | 1303 |
| 385 | Ga0265330_10137509 | 3300031235 | Bacteria | 1039 |
| 386 | Ga0265332_10259334 | 3300031238 | Unclassified | 719 |
| 387 | Ga0265325_10038744 | 3300031241 | Bacteria | 2514 |
| 388 | Ga0265339_10104153 | 3300031249 | Bacteria | 1474 |
| 389 | Ga0265331_10079620 | 3300031250 | Bacteria | 1524 |
| 390 | Ga0265331_10138809 | 3300031250 | Bacteria | 1106 |
| 391 | Ga0265331_10287382 | 3300031250 | Unclassified | 737 |
| 392 | Ga0265316_10003102 | 3300031344 | Bacteria | 16928 |
| 393 | Ga0265316_10003615 | 3300031344 | Bacteria | 15593 |
| 394 | Ga0265316_10027311 | 3300031344 | Bacteria | 4729 |
| 395 | Ga0265316_10029107 | 3300031344 | Bacteria | 4547 |
| 396 | Ga0265316_10178799 | 3300031344 | Bacteria | 1580 |
| 397 | Ga0265316_10193856 | 3300031344 | Unclassified | 1508 |
| 398 | Ga0265316_10402064 | 3300031344 | Bacteria | 986 |
| 399 | Ga0265316_10403899 | 3300031344 | Unclassified | 984 |
| 400 | Ga0265316_10771680 | 3300031344 | Unclassified | 675 |
| 401 | Ga0265316_10960437 | 3300031344 | Unclassified | 595 |
| 402 | Ga0265314_10326877 | 3300031711 | Unclassified | 851 |
| 403 | Ga0265342_10226840 | 3300031712 | Unclassified | 1005 |
| 404 | Ga0265342_10343157 | 3300031712 | Bacteria | 779 |
| 405 | Ga0373926_0160074 | 3300035083 | Bacteria | 859 |
| 406 | Ga0373934_0254451 | 3300035086 | Bacteria | 726 |
| 407 | Ga0373936_0549991 | 3300035113 | Bacteria | 540 |
| 408 | Ga0373953_0032882 | 3300035117 | Bacteria | 2026 |
| 409 | Ga0373953_0142838 | 3300035117 | Bacteria | 1024 |
| 410 | Ga0373954_0007705 | 3300035118 | Bacteria | 4713 |
| 411 | Ga0373954_0111184 | 3300035118 | Unclassified | 1325 |
| 412 | Ga0373956_0112020 | 3300035119 | Bacteria | 1271 |
| 413 | Ga0373957_0223411 | 3300035120 | Unclassified | 789 |
| 414 | Ga0373943_0051742 | 3300035170 | Bacteria | 2023 |
| 415 | Ga0373943_0117718 | 3300035170 | Bacteria | 1409 |
| 416 | Ga0373943_0726284 | 3300035170 | Unclassified | 589 |
| 417 | Ga0373946_0038149 | 3300035171 | Bacteria | 1956 |
| 418 | Ga0373955_0519805 | 3300035172 | Unclassified | 727 |
| 419 | Ga0373955_0598546 | 3300035172 | Unclassified | 675 |
| 420 | Ga0373924_0132121 | 3300035410 | Bacteria | 1086 |
| 421 | Ga0373924_0237049 | 3300035410 | Unclassified | 807 |
| 422 | Ga0373924_0457978 | 3300035410 | Bacteria | 572 |
| 423 | Ga0373935_0045276 | 3300035692 | Bacteria | 2776 |
| 424 | Ga0373935_0086266 | 3300035692 | Bacteria | 2048 |
| 425 | Ga0373935_0245558 | 3300035692 | Bacteria | 1251 |
| 426 | Ga0373935_0444167 | 3300035692 | Unclassified | 936 |
| 427 | Ga0373935_0753073 | 3300035692 | Unclassified | 718 |
| 428 | Ga0373927_0000205 | 3300035695 | Bacteria | 47428 |
| 429 | Ga0373927_0015195 | 3300035695 | Bacteria | 5089 |
| 430 | Ga0373927_0051502 | 3300035695 | Bacteria | 2662 |
| 431 | Ga0373927_0309339 | 3300035695 | Bacteria | 1040 |
| 432 | Ga0373927_0573069 | 3300035695 | Bacteria | 746 |
| 433 | Ga0373927_0850675 | 3300035695 | Bacteria | 602 |
| 434 | Ga0373933_0046015 | 3300035724 | Bacteria | 2589 |
| 435 | Ga0373933_0068882 | 3300035724 | Bacteria | 2150 |
| 436 | Ga0373933_0350889 | 3300035724 | Bacteria | 958 |
| 437 | Ga0373947_0001580 | 3300035725 | Bacteria | 13954 |
| 438 | Ga0373947_0211261 | 3300035725 | Bacteria | 1273 |
| 439 | Ga0373947_0399581 | 3300035725 | Bacteria | 927 |
| 440 | Ga0373947_0456341 | 3300035725 | Unclassified | 866 |
| 441 | Ga0373947_0654134 | 3300035725 | Unclassified | 717 |
| 442 | Ga0373937_0059162 | 3300036401 | Bacteria | 3521 |
| 443 | Ga0373937_0110033 | 3300036401 | Bacteria | 2562 |
| 444 | Ga0373925_0001066 | 3300037068 | Bacteria | 24764 |
| 445 | Ga0373925_0134949 | 3300037068 | Unclassified | 1928 |
| 446 | Ga0373925_0213405 | 3300037068 | Bacteria | 1538 |
| 447 | Ga0373925_0221597 | 3300037068 | Bacteria | 1510 |
| 448 | Ga0373925_0343958 | 3300037068 | Bacteria | 1210 |
| 449 | Ga0373925_0892025 | 3300037068 | Unclassified | 733 |
| 450 | Ga0373925_1059814 | 3300037068 | Unclassified | 667 |
| 451 | Ga0395900_0492029 | 3300037418 | Unclassified | 1178 |
| 452 | Ga0436364_0390292 | 3300037853 | Bacteria | 6240 |
| 453 | Ga0436365_0109023 | 3300039437 | Bacteria | 4449 |
| 454 | Ga0436360_0450429 | 3300039438 | Unclassified | 557 |
| 455 | Ga0436363_0925775 | 3300039450 | Unclassified | 848 |
| 456 | Ga0439448_0319431 | 3300042005 | Unclassified | 552 |
| 457 | Ga0451577_0971297 | 3300042876 | Unclassified | 763 |
| 458 | Ga0466961_0532012 | 3300044693 | Unclassified | 708 |
| 459 | Ga0466963_0314021 | 3300044694 | Unclassified | 1103 |
| 460 | Ga0466959_0252507 | 3300045049 | Unclassified | 1216 |
| 461 | Ga0466959_0377458 | 3300045049 | Unclassified | 965 |
| 462 | Ga0451576_0393799 | 3300045051 | Bacteria | 1452 |
| 463 | Ga0451576_0704674 | 3300045051 | Bacteria | 1061 |
| 464 | Ga0451576_1404302 | 3300045051 | Unclassified | 726 |
| 465 | Ga0451576_1902309 | 3300045051 | Unclassified | 614 |
| 466 | Ga0466958_0429728 | 3300045836 | Unclassified | 854 |
| 467 | Ga0466967_1705860 | 3300045976 | Unclassified | 627 |
| 468 | Ga0495592_0397782 | 3300046454 | Bacteria | 873 |
| 469 | Ga0495592_0805452 | 3300046454 | Unclassified | 558 |
| 470 | Ga0495603_0649133 | 3300046455 | Unclassified | 604 |
| 471 | Ga0495651_0793273 | 3300046462 | Unclassified | 585 |
| 472 | Ga0495651_0837851 | 3300046462 | Unclassified | 565 |
| 473 | Ga0495651_0945578 | 3300046462 | Unclassified | 525 |
| 474 | Ga0495651_1002594 | 3300046462 | Unclassified | 507 |
| 475 | Ga0495580_0000494 | 3300046472 | Bacteria | 32970 |
| 476 | Ga0495580_0002781 | 3300046472 | Bacteria | 15060 |
| 477 | Ga0495580_0033981 | 3300046472 | Unclassified | 3672 |
| 478 | Ga0495580_0123083 | 3300046472 | Bacteria | 1800 |
| 479 | Ga0495580_0128432 | 3300046472 | Bacteria | 1759 |
| 480 | Ga0495580_0137202 | 3300046472 | Bacteria | 1696 |
| 481 | Ga0495580_0363097 | 3300046472 | Unclassified | 980 |
| 482 | Ga0495580_0423058 | 3300046472 | Unclassified | 896 |
| 483 | Ga0495580_0755836 | 3300046472 | Unclassified | 633 |
| 484 | Ga0495580_0891386 | 3300046472 | Unclassified | 572 |
| 485 | Ga0495639_0168746 | 3300046475 | Bacteria | 1062 |
| 486 | Ga0495639_0426678 | 3300046475 | Unclassified | 672 |
| 487 | Ga0495662_0153072 | 3300046476 | Bacteria | 1136 |
| 488 | Ga0495662_0587185 | 3300046476 | Unclassified | 545 |
| 489 | Ga0495664_0059287 | 3300046477 | Unclassified | 2278 |
| 490 | Ga0495594_0761801 | 3300046499 | Unclassified | 546 |
| 491 | Ga0495608_0132832 | 3300046511 | Bacteria | 1592 |
| 492 | Ga0495618_0829239 | 3300046514 | Unclassified | 537 |
| 493 | Ga0495628_0187484 | 3300046516 | Bacteria | 1563 |
| 494 | Ga0495628_0349378 | 3300046516 | Bacteria | 1087 |
| 495 | Ga0495628_0383564 | 3300046516 | Bacteria | 1029 |
| 496 | Ga0495630_0250977 | 3300046517 | Unclassified | 1352 |
| 497 | Ga0495630_0507163 | 3300046517 | Bacteria | 925 |
| 498 | Ga0495666_0093084 | 3300046526 | Bacteria | 1422 |
| 499 | Ga0495642_0465063 | 3300046528 | Unclassified | 559 |
| 500 | Ga0495652_0130546 | 3300046529 | Bacteria | 1990 |
| 501 | Ga0495665_0015366 | 3300046531 | Bacteria | 4123 |
| 502 | Ga0495665_0063186 | 3300046531 | Unclassified | 1955 |
| 503 | Ga0495665_0212638 | 3300046531 | Bacteria | 1001 |
| 504 | Ga0495640_0232630 | 3300046533 | Unclassified | 1159 |
| 505 | Ga0495587_0145242 | 3300046536 | Unclassified | 1353 |
| 506 | Ga0495587_0634421 | 3300046536 | Unclassified | 587 |
| 507 | Ga0495645_0070580 | 3300046543 | Unclassified | 2521 |
| 508 | Ga0495645_0103378 | 3300046543 | Unclassified | 2024 |
| 509 | Ga0495645_0109365 | 3300046543 | Bacteria | 1957 |
| 510 | Ga0495645_0142561 | 3300046543 | Bacteria | 1671 |
| 511 | Ga0495645_0600903 | 3300046543 | Unclassified | 677 |
| 512 | Ga0495645_0925477 | 3300046543 | Unclassified | 516 |
| 513 | Ga0495667_0002646 | 3300046559 | Bacteria | 11954 |
| 514 | Ga0495667_0111420 | 3300046559 | Bacteria | 1768 |
| 515 | Ga0495667_0179393 | 3300046559 | Unclassified | 1360 |
| 516 | Ga0495635_0041715 | 3300046663 | Bacteria | 3170 |
| 517 | Ga0495635_0212145 | 3300046663 | Bacteria | 1311 |
| 518 | Ga0495635_0307809 | 3300046663 | Unclassified | 1062 |
| 519 | Ga0495635_0580974 | 3300046663 | Bacteria | 733 |
| 520 | Ga0495588_0178013 | 3300046674 | Unclassified | 1124 |
| 521 | Ga0495599_0230850 | 3300046678 | Bacteria | 1130 |
| 522 | Ga0495599_0498539 | 3300046678 | Unclassified | 717 |
| 523 | Ga0495599_0512808 | 3300046678 | Viruses | 705 |
| 524 | Ga0495623_0104474 | 3300046679 | Bacteria | 1723 |
| 525 | Ga0495623_0274358 | 3300046679 | Bacteria | 940 |
| 526 | Ga0495623_0493212 | 3300046679 | Unclassified | 647 |
| 527 | Ga0495646_0202404 | 3300046680 | Unclassified | 1081 |
| 528 | Ga0495646_0643096 | 3300046680 | Unclassified | 536 |
| 529 | Ga0495581_0278441 | 3300047315 | Unclassified | 978 |
| 530 | Ga0495604_0360172 | 3300047317 | Unclassified | 965 |
| 531 | Ga0495674_0023966 | 3300047319 | Bacteria | 5615 |
| 532 | Ga0495674_0042806 | 3300047319 | Bacteria | 4036 |
| 533 | Ga0495674_0079456 | 3300047319 | Bacteria | 2817 |
| 534 | Ga0495674_0277566 | 3300047319 | Unclassified | 1374 |
| 535 | Ga0495680_0726568 | 3300047322 | Unclassified | 654 |
| 536 | Ga0495675_0152661 | 3300047444 | Bacteria | 1426 |
| 537 | Ga0495675_0155211 | 3300047444 | Unclassified | 1412 |
| 538 | Ga0495684_0008355 | 3300047471 | Bacteria | 8021 |
| 539 | Ga0495684_0014424 | 3300047471 | Bacteria | 6080 |
| 540 | Ga0495684_0324188 | 3300047471 | Bacteria | 1100 |
| 541 | Ga0495684_0504947 | 3300047471 | Unclassified | 831 |
| 542 | Ga0495684_0934151 | 3300047471 | Unclassified | 556 |
| 543 | Ga0495602_0099475 | 3300048088 | Unclassified | 2390 |
| 544 | Ga0495602_0182395 | 3300048088 | Bacteria | 1618 |
| 545 | Ga0495602_0831957 | 3300048088 | Unclassified | 618 |
| 546 | Ga0496108_1391232 | 3300048911 | Bacteria | 587 |
| 547 | Ga0496109_0665574 | 3300048912 | Unclassified | 978 |
| 548 | Ga0496112_1525931 | 3300048915 | Unclassified | 582 |
| 549 | Ga0496115_0587472 | 3300048918 | Unclassified | 887 |
| 550 | Ga0496115_0910389 | 3300048918 | Unclassified | 678 |
| 551 | nmdc:mga05p37_585428_c1 | 3300050507 | Bacteria | 1263 |
| 552 | nmdc:mga09592_964751_c1 | 3300050508 | Bacteria | 714 |
| 553 | nmdc:mga06r32_16978_c1 | 3300050510 | Bacteria | 6641 |
| 554 | Ga0495601_0842000 | 3300053077 | Unclassified | 581 |
| 555 | Ga0495601_1013153 | 3300053077 | Unclassified | 522 |
| 556 | Ga0587070_111023 | 3300059491 | Unclassified | 644 |
| 557 | Ga0587070_210095 | 3300059491 | Unclassified | 522 |
| 558 | Ga0587073_0291043 | 3300059492 | Unclassified | 528 |
| 559 | Ga0587080_037088 | 3300059503 | Unclassified | 874 |
| 560 | Ga0587080_124910 | 3300059503 | Unclassified | 574 |
| 561 | Ga0587083_0118786 | 3300059505 | Unclassified | 680 |
| 562 | Ga0587083_0128521 | 3300059505 | Unclassified | 662 |
| 563 | Ga0587083_0131585 | 3300059505 | Bacteria | 657 |
| 564 | Ga0587085_079699 | 3300059506 | Unclassified | 657 |
| 565 | Ga0587089_074734 | 3300059509 | Unclassified | 581 |
| 566 | Ga0587091_032820 | 3300059511 | Bacteria | 984 |
| 567 | Ga0587106_071828 | 3300059605 | Unclassified | 657 |
| 568 | Ga0587109_171705 | 3300059624 | Unclassified | 549 |
| 569 | Ga0587128_054959 | 3300059630 | Unclassified | 737 |
| 570 | Ga0587128_055924 | 3300059630 | Unclassified | 733 |
| 571 | Ga0587075_023240 | 3300059644 | Unclassified | 937 |
| 572 | Ga0587075_089386 | 3300059644 | Unclassified | 600 |
| 573 | Ga0587076_212925 | 3300059645 | Unclassified | 503 |
| 574 | Ga0587079_034329 | 3300059647 | Bacteria | 992 |
| 575 | Ga0587100_037224 | 3300059648 | Unclassified | 537 |
| 576 | Ga0587071_160299 | 3300060344 | Unclassified | 565 |
| 577 | Ga0587111_0034022 | 3300060346 | Bacteria | 1056 |
| 578 | Ga0501082_0000581 | 3300060353 | Bacteria | 32431 |
| 579 | Ga0466962_0320197 | 3300061719 | Unclassified | 769 |
| 580 | Ga0207649_10497233 | |||
| 581 | Ga0058859_11431176 | |||
| 582 | Ga0058863_10019330 | |||
| 583 | Ga0058863_11521521 | |||
| 584 | Ga0058861_11377615 | |||
| 585 | Ga0058861_11682296 | |||
| 586 | Ga0058861_11862140 | |||
| 587 | Ga0058860_12036233 | |||
| 588 | Ga0058862_12546383 | |||
| 589 | Ga0058862_12602623 | |||
| 590 | Ga0070676_10189067 | |||
| 591 | Ga0070676_10228262 | |||
| 592 | Ga0070683_100000106 | |||
| 593 | Ga0070683_100579736 | |||
| 594 | Ga0070683_101015517 | |||
| 595 | Ga0070683_101255622 | |||
| 596 | Ga0070683_101710137 | |||
| 597 | Ga0070666_10358888 | |||
| 598 | Ga0070666_10848464 | |||
| 599 | Ga0070680_100006829 | |||
| 600 | Ga0070682_100633258 | |||
| 601 | Ga0068868_100381495 | |||
| 602 | Ga0068868_101470709 | |||
| 603 | Ga0070689_100351308 | |||
| 604 | Ga0070689_100526196 | |||
| 605 | Ga0070687_101294234 | |||
| 606 | Ga0070661_100200087 | |||
| 607 | Ga0070675_100967256 | |||
| 608 | Ga0070674_100123799 | |||
| 609 | Ga0070674_102142181 | |||
| 610 | Ga0070673_100332715 | |||
| 611 | Ga0070688_100236190 | |||
| 612 | Ga0070688_101308786 | |||
| 613 | Ga0070659_100143096 | |||
| 614 | Ga0070667_100714070 | |||
| 615 | Ga0070667_100878026 | |||
| 616 | Ga0070667_101171697 | |||
| 617 | Ga0070714_100032741 | |||
| 618 | Ga0070714_100156076 | |||
| 619 | Ga0070713_100001239 | |||
| 620 | Ga0070713_100041160 | |||
| 621 | Ga0070713_100069063 | |||
| 622 | Ga0070713_100177508 | |||
| 623 | Ga0070713_100211533 | |||
| 624 | Ga0070710_10804174 | |||
| 625 | Ga0070711_100011107 | |||
| 626 | Ga0070711_101038225 | |||
| 627 | Ga0070705_100682896 | |||
| 628 | Ga0070700_101364060 | |||
| 629 | Ga0070662_100726347 | |||
| 630 | Ga0070681_10478609 | |||
| 631 | Ga0068867_100608221 | |||
| 632 | Ga0068867_100974921 | |||
| 633 | Ga0068867_101617205 | |||
| 634 | Ga0070685_10702199 | |||
| 635 | Ga0070685_11188532 | |||
| 636 | Ga0070707_101318567 | |||
| 637 | Ga0070699_101535107 | |||
| 638 | Ga0070679_100162016 | |||
| 639 | Ga0070679_100170119 | |||
| 640 | Ga0070679_100296811 | |||
| 641 | Ga0070684_100000710 | |||
| 642 | Ga0070684_100067812 | |||
| 643 | Ga0070684_100473201 | |||
| 644 | Ga0070684_100700087 | |||
| 645 | Ga0070684_100892748 | |||
| 646 | Ga0070684_101224066 | |||
| 647 | Ga0070697_100276262 | |||
| 648 | Ga0068853_100591541 | |||
| 649 | Ga0068853_100653184 | |||
| 650 | Ga0070672_100432908 | |||
| 651 | Ga0070672_101754636 | |||
| 652 | Ga0070686_101007754 | |||
| 653 | Ga0070695_100720045 | |||
| 654 | Ga0070696_100147632 | |||
| 655 | Ga0070693_101453879 | |||
| 656 | Ga0070665_100223223 | |||
| 657 | Ga0070665_100326803 | |||
| 658 | Ga0070665_100376115 | |||
| 659 | Ga0070665_100802902 | |||
| 660 | Ga0068855_100050093 | |||
| 661 | Ga0068855_100099560 | |||
| 662 | Ga0068855_100136689 | |||
| 663 | Ga0068855_100518276 | |||
| 664 | Ga0068855_101383011 | |||
| 665 | Ga0068855_101803032 | |||
| 666 | Ga0070664_102066650 | |||
| 667 | Ga0070664_102261604 | |||
| 668 | Ga0068857_100793152 | |||
| 669 | Ga0068857_100882059 | |||
| 670 | Ga0068857_101287585 | |||
| 671 | Ga0068857_101517421 | |||
| 672 | Ga0068856_101249226 | |||
| 673 | Ga0068856_101811215 | |||
| 674 | Ga0068856_102182963 | |||
| 675 | Ga0070702_101696780 | |||
| 676 | Ga0068852_100040822 | |||
| 677 | Ga0068852_100047240 | |||
| 678 | Ga0068852_100080299 | |||
| 679 | Ga0068852_101733936 | |||
| 680 | Ga0068859_101426057 | |||
| 681 | Ga0068859_101686868 | |||
| 682 | Ga0068864_101093816 | |||
| 683 | Ga0068864_101878542 | |||
| 684 | Ga0068870_10382257 | |||
| 685 | Ga0068863_100138454 | |||
| 686 | Ga0068863_101234534 | |||
| 687 | Ga0068863_101617973 | |||
| 688 | Ga0068858_100124399 | |||
| 689 | Ga0068858_100254177 | |||
| 690 | Ga0068858_100267128 | |||
| 691 | Ga0068858_100390577 | |||
| 692 | Ga0068858_100802961 | |||
| 693 | Ga0068858_101553153 | |||
| 694 | Ga0068860_100917612 | |||
| 695 | Ga0068860_100917920 | |||
| 696 | Ga0068860_101398744 | |||
| 697 | Ga0068860_102773100 | |||
| 698 | Ga0068862_101261525 | |||
| 699 | Ga0068862_102733802 | |||
| 700 | Ga0070717_10019244 | |||
| 701 | Ga0070717_10042408 | |||
| 702 | Ga0070717_10253191 | |||
| 703 | Ga0070717_10672511 | |||
| 704 | Ga0070717_11188915 | |||
| 705 | Ga0070717_11294096 | |||
| 706 | Ga0070716_100142131 | |||
| 707 | Ga0070716_100357575 | |||
| 708 | Ga0070716_100659873 | |||
| 709 | Ga0070716_100766372 | |||
| 710 | Ga0070712_100347073 | |||
| 711 | Ga0070712_100551649 | |||
| 712 | Ga0097621_100126945 | |||
| 713 | Ga0097621_100184569 | |||
| 714 | Ga0097621_100491797 | |||
| 715 | Ga0097621_100560489 | |||
| 716 | Ga0097621_101537244 | |||
| 717 | Ga0097621_102027559 | |||
| 718 | Ga0068871_100129331 | |||
| 719 | Ga0068871_100285963 | |||
| 720 | Ga0068871_100301413 | |||
| 721 | Ga0068871_100495170 | |||
| 722 | Ga0068871_101107124 | |||
| 723 | Ga0068871_101385729 | |||
| 724 | Ga0068871_102335754 | |||
| 725 | Ga0075428_101839331 | |||
| 726 | Ga0075431_100007713 | |||
| 727 | Ga0075431_100293428 | |||
| 728 | Ga0075431_100990850 | |||
| 729 | Ga0068865_100752953 | |||
| 730 | Ga0068865_100800782 | |||
| 731 | Ga0075436_100725721 | |||
| 732 | Ga0097620_101425623 | |||
| 733 | Ga0097620_101662453 | |||
| 734 | Ga0097620_101686633 | |||
| 735 | Ga0075435_100855082 | |||
| 736 | Ga0105240_10002103 | |||
| 737 | Ga0105240_10356355 | |||
| 738 | Ga0105240_10959364 | |||
| 739 | Ga0111539_11572424 | |||
| 740 | Ga0105245_10413250 | |||
| 741 | Ga0105245_11066098 | |||
| 742 | Ga0105245_11106840 | |||
| 743 | Ga0105245_11774794 | |||
| 744 | Ga0105245_12357607 | |||
| 745 | Ga0105247_10193279 | |||
| 746 | Ga0105247_10747752 | |||
| 747 | Ga0114129_10182862 | |||
| 748 | Ga0105241_11307874 | |||
| 749 | Ga0105241_11458766 | |||
| 750 | Ga0105241_12161896 | |||
| 751 | Ga0105242_10699898 | |||
| 752 | Ga0105242_12021016 | |||
| 753 | Ga0105242_13298595 | |||
| 754 | Ga0105248_10084525 | |||
| 755 | Ga0105248_10380699 | |||
| 756 | Ga0105248_10554766 | |||
| 757 | Ga0105248_11270983 | |||
| 758 | Ga0105248_13168694 | |||
| 759 | Ga0105237_10014239 | |||
| 760 | Ga0105237_10076594 | |||
| 761 | Ga0105237_11163799 | |||
| 762 | Ga0105237_11269098 | |||
| 763 | Ga0105238_10171633 | |||
| 764 | Ga0105238_10428539 | |||
| 765 | Ga0105238_12788119 | |||
| 766 | Ga0105249_10828171 | |||
| 767 | Ga0105249_11787751 | |||
| 768 | Ga0105249_11973742 | |||
| 769 | Ga0105239_10032817 | |||
| 770 | Ga0105239_11972442 | |||
| 771 | Ga0105239_12819467 | |||
| 772 | Ga0105246_10259631 | |||
| 773 | Ga0105246_10797203 | |||
| 774 | Ga0157370_10001006 | |||
| 775 | Ga0157369_10020452 | |||
| 776 | Ga0157369_10767910 | |||
| 777 | Ga0157374_10647625 | |||
| 778 | Ga0157374_10904888 | |||
| 779 | Ga0157374_11497039 | |||
| 780 | Ga0157374_11505227 | |||
| 781 | Ga0157374_12263576 | |||
| 782 | Ga0157378_10457355 | |||
| 783 | Ga0157378_10821493 | |||
| 784 | Ga0157378_11771784 | |||
| 785 | Ga0157378_12378962 | |||
| 786 | Ga0163162_10432417 | |||
| 787 | Ga0163162_10497018 | |||
| 788 | Ga0163162_10801368 | |||
| 789 | Ga0163162_10899535 | |||
| 790 | Ga0163162_11076062 | |||
| 791 | Ga0157372_10047703 | |||
| 792 | Ga0157372_11180634 | |||
| 793 | Ga0157372_12771247 | |||
| 794 | Ga0157375_10141906 | |||
| 795 | Ga0157375_10728593 | |||
| 796 | Ga0163163_10007638 | |||
| 797 | Ga0163163_10680404 | |||
| 798 | Ga0163163_11204843 | |||
| 799 | Ga0163163_13305527 | |||
| 800 | Ga0157380_10214656 | |||
| 801 | Ga0157377_11454484 | |||
| 802 | Ga0157379_11989210 | |||
| 803 | Ga0157379_12377725 | |||
| 804 | Ga0157376_10096378 | |||
| 805 | Ga0157376_10181148 | |||
| 806 | Ga0157376_10516620 | |||
| 807 | Ga0157376_10793321 | |||
| 808 | Ga0157376_11261800 | |||
| 809 | Ga0157376_11786894 | |||
| 810 | Ga0163161_11173828 | |||
| 811 | Ga0163161_11518333 | |||
| 812 | Ga0163161_11944847 | |||
| 813 | Ga0184594_105567 | |||
| 814 | Ga0197907_10671103 | |||
| 815 | Ga0197907_10677688 | |||
| 816 | Ga0197907_11172313 | |||
| 817 | Ga0206356_10632151 | |||
| 818 | Ga0206356_10896598 | |||
| 819 | Ga0206356_11136904 | |||
| 820 | Ga0206349_1226731 | |||
| 821 | Ga0206355_1074272 | |||
| 822 | Ga0206355_1650620 | |||
| 823 | Ga0206352_10009959 | |||
| 824 | Ga0206352_10514620 | |||
| 825 | Ga0206352_10534455 | |||
| 826 | Ga0206352_10655281 | |||
| 827 | Ga0206350_10520751 | |||
| 828 | Ga0206354_10031776 | |||
| 829 | Ga0206354_11247450 | |||
| 830 | Ga0206353_10597002 | |||
| 831 | Ga0206353_11219566 | |||
| 832 | Ga0206353_11547426 | |||
| 833 | Ga0213876_10027352 | |||
| 834 | Ga0213875_10137840 | |||
| 835 | Ga0213875_10372084 | |||
| 836 | Ga0224712_10115543 | |||
| 837 | Ga0224712_10192405 | |||
| 838 | Ga0224712_10551295 | |||
| 839 | Ga0207682_10273661 | |||
| 840 | Ga0207692_10612186 | |||
| 841 | Ga0207710_10777109 | |||
| 842 | Ga0207680_10063596 | |||
| 843 | Ga0207680_10198249 | |||
| 844 | Ga0207685_10122388 | |||
| 845 | Ga0207645_10775792 | |||
| 846 | Ga0207645_11046269 | |||
| 847 | Ga0207705_10526724 | |||
| 848 | Ga0207654_10346407 | |||
| 849 | Ga0207654_11262478 | |||
| 850 | Ga0207707_10392075 | |||
| 851 | Ga0207695_10070246 | |||
| 852 | Ga0207695_10152574 | |||
| 853 | Ga0207695_10835679 | |||
| 854 | Ga0207671_10014158 | |||
| 855 | Ga0207671_10176366 | |||
| 856 | Ga0207671_10368149 | |||
| 857 | Ga0207671_10380694 | |||
| 858 | Ga0207671_10438108 | |||
| 859 | Ga0207671_10610337 | |||
| 860 | Ga0207671_11333452 | |||
| 861 | Ga0207693_10126903 | |||
| 862 | Ga0207663_10012618 | |||
| 863 | Ga0207663_10216258 | |||
| 864 | Ga0207663_10632276 | |||
| 865 | Ga0207660_10015229 | |||
| 866 | Ga0207660_11444253 | |||
| 867 | Ga0207649_10231755 | |||
| 868 | Ga0207652_10134010 | |||
| 869 | Ga0207652_10477068 | |||
| 870 | Ga0207681_10927563 | |||
| 871 | Ga0207694_10150957 | |||
| 872 | Ga0207694_10655649 | |||
| 873 | Ga0207694_10659818 | |||
| 874 | Ga0207650_10541444 | |||
| 875 | Ga0207650_10911888 | |||
| 876 | Ga0207659_10993653 | |||
| 877 | Ga0207687_10443587 | |||
| 878 | Ga0207687_10736097 | |||
| 879 | Ga0207687_10853081 | |||
| 880 | Ga0207700_10002779 | |||
| 881 | Ga0207700_10054918 | |||
| 882 | Ga0207700_10474732 | |||
| 883 | Ga0207700_11893657 | |||
| 884 | Ga0207664_10019610 | |||
| 885 | Ga0207664_10178458 | |||
| 886 | Ga0207644_10192586 | |||
| 887 | Ga0207690_10162284 | |||
| 888 | Ga0207686_10667267 | |||
| 889 | Ga0207686_11609528 | |||
| 890 | Ga0207670_10233680 | |||
| 891 | Ga0207670_10263815 | |||
| 892 | Ga0207704_10847736 | |||
| 893 | Ga0207704_10990590 | |||
| 894 | Ga0207704_11207801 | |||
| 895 | Ga0207665_10136076 | |||
| 896 | Ga0207691_10608302 | |||
| 897 | Ga0207691_10860376 | |||
| 898 | Ga0207711_10101279 | |||
| 899 | Ga0207711_10344085 | |||
| 900 | Ga0207711_10465203 | |||
| 901 | Ga0207711_10662397 | |||
| 902 | Ga0207711_11505867 | |||
| 903 | Ga0207711_12067822 | |||
| 904 | Ga0207689_10704792 | |||
| 905 | Ga0207689_11033664 | |||
| 906 | Ga0207661_10000054 | |||
| 907 | Ga0207661_10265432 | |||
| 908 | Ga0207661_10417013 | |||
| 909 | Ga0207661_10493624 | |||
| 910 | Ga0207661_10887787 | |||
| 911 | Ga0207661_12007447 | |||
| 912 | Ga0207679_12204691 | |||
| 913 | Ga0207667_10113338 | |||
| 914 | Ga0207667_10176642 | |||
| 915 | Ga0207667_10235657 | |||
| 916 | Ga0207651_10312202 | |||
| 917 | Ga0207651_11984228 | |||
| 918 | Ga0207658_10313923 | |||
| 919 | Ga0207658_10734022 | |||
| 920 | Ga0207658_11228608 | |||
| 921 | Ga0207677_10366541 | |||
| 922 | Ga0207677_11316655 | |||
| 923 | Ga0207677_11647808 | |||
| 924 | Ga0207703_10144338 | |||
| 925 | Ga0207703_10216821 | |||
| 926 | Ga0207703_10683395 | |||
| 927 | Ga0207703_10875007 | |||
| 928 | Ga0207703_11852053 | |||
| 929 | Ga0207703_11951225 | |||
| 930 | Ga0207639_10156484 | |||
| 931 | Ga0207639_11628669 | |||
| 932 | Ga0207702_11284625 | |||
| 933 | Ga0207702_11412787 | |||
| 934 | Ga0207641_10025690 | |||
| 935 | Ga0207641_10150987 | |||
| 936 | Ga0207641_11072626 | |||
| 937 | Ga0207648_10500580 | |||
| 938 | Ga0207648_10510778 | |||
| 939 | Ga0207676_11061922 | |||
| 940 | Ga0207676_11365219 | |||
| 941 | Ga0207674_10288418 | |||
| 942 | Ga0207674_11050426 | |||
| 943 | Ga0207683_11146901 | |||
| 944 | Ga0207698_10028061 | |||
| 945 | Ga0207698_10088836 | |||
| 946 | Ga0207428_10841026 | |||
| 947 | Ga0268266_10056752 | |||
| 948 | Ga0268266_10178896 | |||
| 949 | Ga0268266_10234265 | |||
| 950 | Ga0268266_11281790 | |||
| 951 | Ga0268265_11103858 | |||
| 952 | Ga0268264_10453639 | |||
| 953 | Ga0268264_10677792 | |||
| 954 | Ga0268264_10687989 | |||
| 955 | Ga0268264_10738469 | |||
| 956 | Ga0265336_10258919 | |||
| 957 | Ga0265338_10631489 | |||
| 958 | Ga0265338_11058457 | |||
| 959 | Ga0265777_124749 | |||
| 960 | Ga0265776_102212 | |||
| 961 | Ga0265760_10041399 | |||
| 962 | Ga0265760_10373122 | |||
| 963 | Ga0265330_10091818 | |||
| 964 | Ga0265330_10137509 | |||
| 965 | Ga0265332_10259334 | |||
| 966 | Ga0265325_10038744 | |||
| 967 | Ga0265339_10104153 | |||
| 968 | Ga0265331_10079620 | |||
| 969 | Ga0265331_10138809 | |||
| 970 | Ga0265331_10287382 | |||
| 971 | Ga0265316_10003102 | |||
| 972 | Ga0265316_10003615 | |||
| 973 | Ga0265316_10027311 | |||
| 974 | Ga0265316_10029107 | |||
| 975 | Ga0265316_10178799 | |||
| 976 | Ga0265316_10193856 | |||
| 977 | Ga0265316_10402064 | |||
| 978 | Ga0265316_10403899 | |||
| 979 | Ga0265316_10771680 | |||
| 980 | Ga0265316_10960437 | |||
| 981 | Ga0265314_10326877 | |||
| 982 | Ga0265342_10226840 | |||
| 983 | Ga0265342_10343157 | |||
| 984 | Ga0373926_0160074 | |||
| 985 | Ga0373934_0254451 | |||
| 986 | Ga0373936_0549991 | |||
| 987 | Ga0373953_0032882 | |||
| 988 | Ga0373953_0142838 | |||
| 989 | Ga0373954_0007705 | |||
| 990 | Ga0373954_0111184 | |||
| 991 | Ga0373956_0112020 | |||
| 992 | Ga0373957_0223411 | |||
| 993 | Ga0373943_0051742 | |||
| 994 | Ga0373943_0117718 | |||
| 995 | Ga0373943_0726284 | |||
| 996 | Ga0373946_0038149 | |||
| 997 | Ga0373955_0519805 | |||
| 998 | Ga0373955_0598546 | |||
| 999 | Ga0373924_0132121 | |||
| 1000 | Ga0373924_0237049 | |||
| 1001 | Ga0373924_0457978 | |||
| 1002 | Ga0373935_0045276 | |||
| 1003 | Ga0373935_0086266 | |||
| 1004 | Ga0373935_0245558 | |||
| 1005 | Ga0373935_0444167 | |||
| 1006 | Ga0373935_0753073 | |||
| 1007 | Ga0373927_0000205 | |||
| 1008 | Ga0373927_0015195 | |||
| 1009 | Ga0373927_0051502 | |||
| 1010 | Ga0373927_0309339 | |||
| 1011 | Ga0373927_0573069 | |||
| 1012 | Ga0373927_0850675 | |||
| 1013 | Ga0373933_0046015 | |||
| 1014 | Ga0373933_0068882 | |||
| 1015 | Ga0373933_0350889 | |||
| 1016 | Ga0373947_0001580 | |||
| 1017 | Ga0373947_0211261 | |||
| 1018 | Ga0373947_0399581 | |||
| 1019 | Ga0373947_0456341 | |||
| 1020 | Ga0373947_0654134 | |||
| 1021 | Ga0373937_0059162 | |||
| 1022 | Ga0373937_0110033 | |||
| 1023 | Ga0373925_0001066 | |||
| 1024 | Ga0373925_0134949 | |||
| 1025 | Ga0373925_0213405 | |||
| 1026 | Ga0373925_0221597 | |||
| 1027 | Ga0373925_0343958 | |||
| 1028 | Ga0373925_0892025 | |||
| 1029 | Ga0373925_1059814 | |||
| 1030 | Ga0395900_0492029 | |||
| 1031 | Ga0436364_0390292 | |||
| 1032 | Ga0436365_0109023 | |||
| 1033 | Ga0436360_0450429 | |||
| 1034 | Ga0436363_0925775 | |||
| 1035 | Ga0439448_0319431 | |||
| 1036 | Ga0451577_0971297 | |||
| 1037 | Ga0466961_0532012 | |||
| 1038 | Ga0466963_0314021 | |||
| 1039 | Ga0466959_0252507 | |||
| 1040 | Ga0466959_0377458 | |||
| 1041 | Ga0451576_0393799 | |||
| 1042 | Ga0451576_0704674 | |||
| 1043 | Ga0451576_1404302 | |||
| 1044 | Ga0451576_1902309 | |||
| 1045 | Ga0466958_0429728 | |||
| 1046 | Ga0466967_1705860 | |||
| 1047 | Ga0495592_0397782 | |||
| 1048 | Ga0495592_0805452 | |||
| 1049 | Ga0495603_0649133 | |||
| 1050 | Ga0495651_0793273 | |||
| 1051 | Ga0495651_0837851 | |||
| 1052 | Ga0495651_0945578 | |||
| 1053 | Ga0495651_1002594 | |||
| 1054 | Ga0495580_0000494 | |||
| 1055 | Ga0495580_0002781 | |||
| 1056 | Ga0495580_0033981 | |||
| 1057 | Ga0495580_0123083 | |||
| 1058 | Ga0495580_0128432 | |||
| 1059 | Ga0495580_0137202 | |||
| 1060 | Ga0495580_0363097 | |||
| 1061 | Ga0495580_0423058 | |||
| 1062 | Ga0495580_0755836 | |||
| 1063 | Ga0495580_0891386 | |||
| 1064 | Ga0495639_0168746 | |||
| 1065 | Ga0495639_0426678 | |||
| 1066 | Ga0495662_0153072 | |||
| 1067 | Ga0495662_0587185 | |||
| 1068 | Ga0495664_0059287 | |||
| 1069 | Ga0495594_0761801 | |||
| 1070 | Ga0495608_0132832 | |||
| 1071 | Ga0495618_0829239 | |||
| 1072 | Ga0495628_0187484 | |||
| 1073 | Ga0495628_0349378 | |||
| 1074 | Ga0495628_0383564 | |||
| 1075 | Ga0495630_0250977 | |||
| 1076 | Ga0495630_0507163 | |||
| 1077 | Ga0495666_0093084 | |||
| 1078 | Ga0495642_0465063 | |||
| 1079 | Ga0495652_0130546 | |||
| 1080 | Ga0495665_0015366 | |||
| 1081 | Ga0495665_0063186 | |||
| 1082 | Ga0495665_0212638 | |||
| 1083 | Ga0495640_0232630 | |||
| 1084 | Ga0495587_0145242 | |||
| 1085 | Ga0495587_0634421 | |||
| 1086 | Ga0495645_0070580 | |||
| 1087 | Ga0495645_0103378 | |||
| 1088 | Ga0495645_0109365 | |||
| 1089 | Ga0495645_0142561 | |||
| 1090 | Ga0495645_0600903 | |||
| 1091 | Ga0495645_0925477 | |||
| 1092 | Ga0495667_0002646 | |||
| 1093 | Ga0495667_0111420 | |||
| 1094 | Ga0495667_0179393 | |||
| 1095 | Ga0495635_0041715 | |||
| 1096 | Ga0495635_0212145 | |||
| 1097 | Ga0495635_0307809 | |||
| 1098 | Ga0495635_0580974 | |||
| 1099 | Ga0495588_0178013 | |||
| 1100 | Ga0495599_0230850 | |||
| 1101 | Ga0495599_0498539 | |||
| 1102 | Ga0495599_0512808 | |||
| 1103 | Ga0495623_0104474 | |||
| 1104 | Ga0495623_0274358 | |||
| 1105 | Ga0495623_0493212 | |||
| 1106 | Ga0495646_0202404 | |||
| 1107 | Ga0495646_0643096 | |||
| 1108 | Ga0495581_0278441 | |||
| 1109 | Ga0495604_0360172 | |||
| 1110 | Ga0495674_0023966 | |||
| 1111 | Ga0495674_0042806 | |||
| 1112 | Ga0495674_0079456 | |||
| 1113 | Ga0495674_0277566 | |||
| 1114 | Ga0495680_0726568 | |||
| 1115 | Ga0495675_0152661 | |||
| 1116 | Ga0495675_0155211 | |||
| 1117 | Ga0495684_0008355 | |||
| 1118 | Ga0495684_0014424 | |||
| 1119 | Ga0495684_0324188 | |||
| 1120 | Ga0495684_0504947 | |||
| 1121 | Ga0495684_0934151 | |||
| 1122 | Ga0495602_0099475 | |||
| 1123 | Ga0495602_0182395 | |||
| 1124 | Ga0495602_0831957 | |||
| 1125 | Ga0496108_1391232 | |||
| 1126 | Ga0496109_0665574 | |||
| 1127 | Ga0496112_1525931 | |||
| 1128 | Ga0496115_0587472 | |||
| 1129 | Ga0496115_0910389 | |||
| 1130 | nmdc:mga05p37_585428_c1 | |||
| 1131 | nmdc:mga09592_964751_c1 | |||
| 1132 | nmdc:mga06r32_16978_c1 | |||
| 1133 | Ga0495601_0842000 | |||
| 1134 | Ga0495601_1013153 | |||
| 1135 | Ga0587070_111023 | |||
| 1136 | Ga0587070_210095 | |||
| 1137 | Ga0587073_0291043 | |||
| 1138 | Ga0587080_037088 | |||
| 1139 | Ga0587080_124910 | |||
| 1140 | Ga0587083_0118786 | |||
| 1141 | Ga0587083_0128521 | |||
| 1142 | Ga0587083_0131585 | |||
| 1143 | Ga0587085_079699 | |||
| 1144 | Ga0587089_074734 | |||
| 1145 | Ga0587091_032820 | |||
| 1146 | Ga0587106_071828 | |||
| 1147 | Ga0587109_171705 | |||
| 1148 | Ga0587128_054959 | |||
| 1149 | Ga0587128_055924 | |||
| 1150 | Ga0587075_023240 | |||
| 1151 | Ga0587075_089386 | |||
| 1152 | Ga0587076_212925 | |||
| 1153 | Ga0587079_034329 | |||
| 1154 | Ga0587100_037224 | |||
| 1155 | Ga0587071_160299 | |||
| 1156 | Ga0587111_0034022 | |||
| 1157 | Ga0501082_0000581 | |||
| 1158 | Ga0466962_0320197 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.721 | 7 | 59 |
| 3hug-assembly6.cif.gz_P | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6885 | 7 | 67 |
| 3hug-assembly6.cif.gz_F | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6789 | 7 | 59 |
| 3hug-assembly6.cif.gz_J | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6652 | 7 | 69 |
| 3hug-assembly3.cif.gz_L | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.6514 | 7 | 70 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.721 | 7 | 59 | 1.10.10.1320 |
| 3hugP00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6885 | 7 | 67 | 1.10.10.1320 |
| 3hugN00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6811 | 7 | 68 | 1.10.10.1320 |
| 3hugF00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6789 | 7 | 59 | 1.10.10.1320 |
| 3hugH00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6789 | 7 | 68 | 1.10.10.1320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A521X5V7-F1-model_v4 | RNA polymerase sigma factor | 0.8756 | 2 | 60 |
GO:0003677
GO:0006352 GO:0016987 |
| AF-A0A538T1I1-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.8359 | 3 | 56 |
GO:0016020
|
| AF-A0A2V9C2P9-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.8358 | 3 | 61 |
|
| AF-A0A7C1VQV6-F1-model_v4 | Zf-HC2 domain-containing protein | 0.8142 | 3 | 60 |
|
| AF-A0A2D6SY35-F1-model_v4 | Putative zinc-finger domain-containing protein | 0.8057 | 2 | 61 |
|