F465837

General Info

Members Datasets Scaffolds Average Seq Length
579 256 1158 82

Family's Representative Sequence

Representative Sequence 3300025920|Ga0207649_10497233|Ga0207649_104972331
Length 95
Sequence MTPLLTCKEFLQELTDYLDEKTDAELRAKLERHITECPNCWVVADTTRKTIQIYKGMEPCSIPADVEGRLMKALEAKIAAKQAHLTGAAGLFKQG

Samples

Sample ID Description Type Environment
1 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
3 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
6 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
41 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
42 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
57 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
95 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
99 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
157 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
158 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
159 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
160 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
161 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
162 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
163 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
164 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
165 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
166 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
167 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
170 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
171 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
172 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
173 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
174 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
193 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
197 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
198 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
206 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
211 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
212 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
213 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
214 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
215 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
216 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
217 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
218 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
219 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
220 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
236 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
237 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
242 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
243 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
244 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
245 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
246 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
247 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
248 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
249 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
250 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
251 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
252 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
256 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 89.98
Metatranscriptomes 10.02
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.86
Rhizosphere 97.75
Stem 0
Stem Tuber 0
Unclassified 54.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207649_10497233 3300025920 Bacteria 927
2 Ga0058859_11431176 3300004798 Unclassified 510
3 Ga0058863_10019330 3300004799 Unclassified 954
4 Ga0058863_11521521 3300004799 Unclassified 890
5 Ga0058861_11377615 3300004800 Bacteria 784
6 Ga0058861_11682296 3300004800 Unclassified 936
7 Ga0058861_11862140 3300004800 Unclassified 530
8 Ga0058860_12036233 3300004801 Unclassified 598
9 Ga0058862_12546383 3300004803 Bacteria 575
10 Ga0058862_12602623 3300004803 Unclassified 884
11 Ga0070676_10189067 3300005328 Bacteria 1343
12 Ga0070676_10228262 3300005328 Unclassified 1233
13 Ga0070683_100000106 3300005329 Bacteria 54661
14 Ga0070683_100579736 3300005329 Unclassified 1073
15 Ga0070683_101015517 3300005329 Bacteria 796
16 Ga0070683_101255622 3300005329 Unclassified 712
17 Ga0070683_101710137 3300005329 Unclassified 605
18 Ga0070666_10358888 3300005335 Unclassified 1044
19 Ga0070666_10848464 3300005335 Bacteria 674
20 Ga0070680_100006829 3300005336 Bacteria 8697
21 Ga0070682_100633258 3300005337 Bacteria 849
22 Ga0068868_100381495 3300005338 Unclassified 1213
23 Ga0068868_101470709 3300005338 Unclassified 637
24 Ga0070689_100351308 3300005340 Bacteria 1237
25 Ga0070689_100526196 3300005340 Bacteria 1016
26 Ga0070687_101294234 3300005343 Bacteria 541
27 Ga0070661_100200087 3300005344 Unclassified 1526
28 Ga0070675_100967256 3300005354 Bacteria 781
29 Ga0070674_100123799 3300005356 Unclassified 1917
30 Ga0070674_102142181 3300005356 Unclassified 510
31 Ga0070673_100332715 3300005364 Unclassified 1344
32 Ga0070688_100236190 3300005365 Bacteria 1295
33 Ga0070688_101308786 3300005365 Unclassified 585
34 Ga0070659_100143096 3300005366 Bacteria 1947
35 Ga0070667_100714070 3300005367 Unclassified 928
36 Ga0070667_100878026 3300005367 Bacteria 834
37 Ga0070667_101171697 3300005367 Unclassified 719
38 Ga0070714_100032741 3300005435 Bacteria 4341
39 Ga0070714_100156076 3300005435 Bacteria 2060
40 Ga0070713_100001239 3300005436 Bacteria 16326
41 Ga0070713_100041160 3300005436 Bacteria 3763
42 Ga0070713_100069063 3300005436 Bacteria 2979
43 Ga0070713_100177508 3300005436 Unclassified 1912
44 Ga0070713_100211533 3300005436 Unclassified 1756
45 Ga0070710_10804174 3300005437 Unclassified 672
46 Ga0070711_100011107 3300005439 Bacteria 5587
47 Ga0070711_101038225 3300005439 Unclassified 704
48 Ga0070705_100682896 3300005440 Unclassified 804
49 Ga0070700_101364060 3300005441 Unclassified 598
50 Ga0070662_100726347 3300005457 Bacteria 841
51 Ga0070681_10478609 3300005458 Bacteria 1158
52 Ga0068867_100608221 3300005459 Bacteria 954
53 Ga0068867_100974921 3300005459 Unclassified 767
54 Ga0068867_101617205 3300005459 Unclassified 606
55 Ga0070685_10702199 3300005466 Bacteria 738
56 Ga0070685_11188532 3300005466 Unclassified 579
57 Ga0070707_101318567 3300005468 Unclassified 688
58 Ga0070699_101535107 3300005518 Viruses 610
59 Ga0070679_100162016 3300005530 Bacteria 2211
60 Ga0070679_100170119 3300005530 Bacteria 2152
61 Ga0070679_100296811 3300005530 Unclassified 1567
62 Ga0070684_100000710 3300005535 Bacteria 23047
63 Ga0070684_100067812 3300005535 Bacteria 3135
64 Ga0070684_100473201 3300005535 Bacteria 1159
65 Ga0070684_100700087 3300005535 Unclassified 944
66 Ga0070684_100892748 3300005535 Bacteria 833
67 Ga0070684_101224066 3300005535 Unclassified 706
68 Ga0070697_100276262 3300005536 Bacteria 1441
69 Ga0068853_100591541 3300005539 Unclassified 1053
70 Ga0068853_100653184 3300005539 Bacteria 1001
71 Ga0070672_100432908 3300005543 Bacteria 1131
72 Ga0070672_101754636 3300005543 Unclassified 558
73 Ga0070686_101007754 3300005544 Bacteria 683
74 Ga0070695_100720045 3300005545 Bacteria 793
75 Ga0070696_100147632 3300005546 Bacteria 1723
76 Ga0070693_101453879 3300005547 Unclassified 534
77 Ga0070665_100223223 3300005548 Unclassified 1885
78 Ga0070665_100326803 3300005548 Bacteria 1538
79 Ga0070665_100376115 3300005548 Unclassified 1427
80 Ga0070665_100802902 3300005548 Unclassified 954
81 Ga0068855_100050093 3300005563 Bacteria 4923
82 Ga0068855_100099560 3300005563 Bacteria 3348
83 Ga0068855_100136689 3300005563 Unclassified 2796
84 Ga0068855_100518276 3300005563 Unclassified 1294
85 Ga0068855_101383011 3300005563 Bacteria 726
86 Ga0068855_101803032 3300005563 Unclassified 622
87 Ga0070664_102066650 3300005564 Unclassified 541
88 Ga0070664_102261604 3300005564 Unclassified 516
89 Ga0068857_100793152 3300005577 Unclassified 904
90 Ga0068857_100882059 3300005577 Bacteria 857
91 Ga0068857_101287585 3300005577 Unclassified 709
92 Ga0068857_101517421 3300005577 Unclassified 653
93 Ga0068856_101249226 3300005614 Unclassified 759
94 Ga0068856_101811215 3300005614 Unclassified 622
95 Ga0068856_102182963 3300005614 Unclassified 563
96 Ga0070702_101696780 3300005615 Bacteria 525
97 Ga0068852_100040822 3300005616 Unclassified 3918
98 Ga0068852_100047240 3300005616 Bacteria 3672
99 Ga0068852_100080299 3300005616 Unclassified 2891
100 Ga0068852_101733936 3300005616 Unclassified 647
101 Ga0068859_101426057 3300005617 Unclassified 764
102 Ga0068859_101686868 3300005617 Unclassified 700
103 Ga0068864_101093816 3300005618 Unclassified 793
104 Ga0068864_101878542 3300005618 Bacteria 604
105 Ga0068870_10382257 3300005840 Unclassified 912
106 Ga0068863_100138454 3300005841 Bacteria 2326
107 Ga0068863_101234534 3300005841 Unclassified 754
108 Ga0068863_101617973 3300005841 Bacteria 657
109 Ga0068858_100124399 3300005842 Bacteria 2414
110 Ga0068858_100254177 3300005842 Unclassified 1669
111 Ga0068858_100267128 3300005842 Bacteria 1627
112 Ga0068858_100390577 3300005842 Unclassified 1336
113 Ga0068858_100802961 3300005842 Bacteria 918
114 Ga0068858_101553153 3300005842 Unclassified 653
115 Ga0068860_100917612 3300005843 Unclassified 892
116 Ga0068860_100917920 3300005843 Unclassified 892
117 Ga0068860_101398744 3300005843 Unclassified 721
118 Ga0068860_102773100 3300005843 Unclassified 508
119 Ga0068862_101261525 3300005844 Unclassified 739
120 Ga0068862_102733802 3300005844 Unclassified 505
121 Ga0070717_10019244 3300006028 Bacteria 5352
122 Ga0070717_10042408 3300006028 Bacteria 3711
123 Ga0070717_10253191 3300006028 Bacteria 1556
124 Ga0070717_10672511 3300006028 Unclassified 940
125 Ga0070717_11188915 3300006028 Bacteria 694
126 Ga0070717_11294096 3300006028 Unclassified 663
127 Ga0070716_100142131 3300006173 Bacteria 1532
128 Ga0070716_100357575 3300006173 Unclassified 1036
129 Ga0070716_100659873 3300006173 Unclassified 794
130 Ga0070716_100766372 3300006173 Unclassified 744
131 Ga0070712_100347073 3300006175 Unclassified 1214
132 Ga0070712_100551649 3300006175 Unclassified 971
133 Ga0097621_100126945 3300006237 Bacteria 2168
134 Ga0097621_100184569 3300006237 Bacteria 1804
135 Ga0097621_100491797 3300006237 Bacteria 1110
136 Ga0097621_100560489 3300006237 Unclassified 1041
137 Ga0097621_101537244 3300006237 Bacteria 632
138 Ga0097621_102027559 3300006237 Unclassified 550
139 Ga0068871_100129331 3300006358 Bacteria 2140
140 Ga0068871_100285963 3300006358 Unclassified 1444
141 Ga0068871_100301413 3300006358 Unclassified 1407
142 Ga0068871_100495170 3300006358 Unclassified 1101
143 Ga0068871_101107124 3300006358 Unclassified 741
144 Ga0068871_101385729 3300006358 Bacteria 663
145 Ga0068871_102335754 3300006358 Unclassified 510
146 Ga0075428_101839331 3300006844 Unclassified 630
147 Ga0075431_100007713 3300006847 Bacteria 10716
148 Ga0075431_100293428 3300006847 Unclassified 1644
149 Ga0075431_100990850 3300006847 Unclassified 807
150 Ga0068865_100752953 3300006881 Unclassified 837
151 Ga0068865_100800782 3300006881 Bacteria 813
152 Ga0075436_100725721 3300006914 Unclassified 737
153 Ga0097620_101425623 3300006931 Unclassified 764
154 Ga0097620_101662453 3300006931 Unclassified 705
155 Ga0097620_101686633 3300006931 Unclassified 700
156 Ga0075435_100855082 3300007076 Bacteria 793
157 Ga0105240_10002103 3300009093 Bacteria 32584
158 Ga0105240_10356355 3300009093 Unclassified 1658
159 Ga0105240_10959364 3300009093 Unclassified 917
160 Ga0111539_11572424 3300009094 Unclassified 763
161 Ga0105245_10413250 3300009098 Unclassified 1351
162 Ga0105245_11066098 3300009098 Unclassified 854
163 Ga0105245_11106840 3300009098 Bacteria 838
164 Ga0105245_11774794 3300009098 Bacteria 670
165 Ga0105245_12357607 3300009098 Unclassified 586
166 Ga0105247_10193279 3300009101 Bacteria 1364
167 Ga0105247_10747752 3300009101 Bacteria 741
168 Ga0114129_10182862 3300009147 Bacteria 2851
169 Ga0105241_11307874 3300009174 Unclassified 691
170 Ga0105241_11458766 3300009174 Bacteria 657
171 Ga0105241_12161896 3300009174 Unclassified 551
172 Ga0105242_10699898 3300009176 Bacteria 991
173 Ga0105242_12021016 3300009176 Bacteria 619
174 Ga0105242_13298595 3300009176 Unclassified 502
175 Ga0105248_10084525 3300009177 Unclassified 3570
176 Ga0105248_10380699 3300009177 Bacteria 1589
177 Ga0105248_10554766 3300009177 Bacteria 1296
178 Ga0105248_11270983 3300009177 Unclassified 832
179 Ga0105248_13168694 3300009177 Bacteria 523
180 Ga0105237_10014239 3300009545 Bacteria 8327
181 Ga0105237_10076594 3300009545 Bacteria 3335
182 Ga0105237_11163799 3300009545 Unclassified 778
183 Ga0105237_11269098 3300009545 Unclassified 743
184 Ga0105238_10171633 3300009551 Bacteria 2145
185 Ga0105238_10428539 3300009551 Unclassified 1318
186 Ga0105238_12788119 3300009551 Unclassified 525
187 Ga0105249_10828171 3300009553 Unclassified 990
188 Ga0105249_11787751 3300009553 Bacteria 687
189 Ga0105249_11973742 3300009553 Unclassified 656
190 Ga0105239_10032817 3300010375 Bacteria 5705
191 Ga0105239_11972442 3300010375 Bacteria 677
192 Ga0105239_12819467 3300010375 Unclassified 567
193 Ga0105246_10259631 3300011119 Bacteria 1383
194 Ga0105246_10797203 3300011119 Unclassified 838
195 Ga0157370_10001006 3300013104 Bacteria 35575
196 Ga0157369_10020452 3300013105 Bacteria 7398
197 Ga0157369_10767910 3300013105 Unclassified 991
198 Ga0157374_10647625 3300013296 Bacteria 1068
199 Ga0157374_10904888 3300013296 Unclassified 900
200 Ga0157374_11497039 3300013296 Unclassified 698
201 Ga0157374_11505227 3300013296 Unclassified 696
202 Ga0157374_12263576 3300013296 Unclassified 571
203 Ga0157378_10457355 3300013297 Bacteria 1268
204 Ga0157378_10821493 3300013297 Bacteria 956
205 Ga0157378_11771784 3300013297 Unclassified 665
206 Ga0157378_12378962 3300013297 Unclassified 581
207 Ga0163162_10432417 3300013306 Bacteria 1448
208 Ga0163162_10497018 3300013306 Unclassified 1350
209 Ga0163162_10801368 3300013306 Unclassified 1059
210 Ga0163162_10899535 3300013306 Bacteria 998
211 Ga0163162_11076062 3300013306 Bacteria 911
212 Ga0157372_10047703 3300013307 Bacteria 4760
213 Ga0157372_11180634 3300013307 Unclassified 885
214 Ga0157372_12771247 3300013307 Unclassified 562
215 Ga0157375_10141906 3300013308 Bacteria 2530
216 Ga0157375_10728593 3300013308 Unclassified 1144
217 Ga0163163_10007638 3300014325 Bacteria 9550
218 Ga0163163_10680404 3300014325 Bacteria 1092
219 Ga0163163_11204843 3300014325 Unclassified 820
220 Ga0163163_13305527 3300014325 Unclassified 503
221 Ga0157380_10214656 3300014326 Bacteria 1717
222 Ga0157377_11454484 3300014745 Unclassified 543
223 Ga0157379_11989210 3300014968 Unclassified 574
224 Ga0157379_12377725 3300014968 Unclassified 529
225 Ga0157376_10096378 3300014969 Bacteria 2574
226 Ga0157376_10181148 3300014969 Bacteria 1926
227 Ga0157376_10516620 3300014969 Unclassified 1176
228 Ga0157376_10793321 3300014969 Unclassified 959
229 Ga0157376_11261800 3300014969 Unclassified 768
230 Ga0157376_11786894 3300014969 Unclassified 651
231 Ga0163161_11173828 3300017792 Bacteria 663
232 Ga0163161_11518333 3300017792 Unclassified 588
233 Ga0163161_11944847 3300017792 Unclassified 523
234 Ga0184594_105567 3300019181 Unclassified 542
235 Ga0197907_10671103 3300020069 Bacteria 1025
236 Ga0197907_10677688 3300020069 Unclassified 980
237 Ga0197907_11172313 3300020069 Unclassified 1304
238 Ga0206356_10632151 3300020070 Unclassified 1047
239 Ga0206356_10896598 3300020070 Unclassified 746
240 Ga0206356_11136904 3300020070 Unclassified 639
241 Ga0206349_1226731 3300020075 Unclassified 1020
242 Ga0206355_1074272 3300020076 Unclassified 1296
243 Ga0206355_1650620 3300020076 Unclassified 923
244 Ga0206352_10009959 3300020078 Unclassified 518
245 Ga0206352_10514620 3300020078 Unclassified 1021
246 Ga0206352_10534455 3300020078 Bacteria 1149
247 Ga0206352_10655281 3300020078 Bacteria 1064
248 Ga0206350_10520751 3300020080 Unclassified 1257
249 Ga0206354_10031776 3300020081 Unclassified 920
250 Ga0206354_11247450 3300020081 Bacteria 1140
251 Ga0206353_10597002 3300020082 Unclassified 977
252 Ga0206353_11219566 3300020082 Unclassified 1001
253 Ga0206353_11547426 3300020082 Bacteria 938
254 Ga0213876_10027352 3300021384 Bacteria 3010
255 Ga0213875_10137840 3300021388 Bacteria 1141
256 Ga0213875_10372084 3300021388 Unclassified 680
257 Ga0224712_10115543 3300022467 Bacteria 1156
258 Ga0224712_10192405 3300022467 Unclassified 924
259 Ga0224712_10551295 3300022467 Unclassified 560
260 Ga0207682_10273661 3300025893 Unclassified 789
261 Ga0207692_10612186 3300025898 Bacteria 701
262 Ga0207710_10777109 3300025900 Unclassified 503
263 Ga0207680_10063596 3300025903 Unclassified 2259
264 Ga0207680_10198249 3300025903 Bacteria 1367
265 Ga0207685_10122388 3300025905 Bacteria 1144
266 Ga0207645_10775792 3300025907 Unclassified 652
267 Ga0207645_11046269 3300025907 Unclassified 552
268 Ga0207705_10526724 3300025909 Unclassified 918
269 Ga0207654_10346407 3300025911 Unclassified 1022
270 Ga0207654_11262478 3300025911 Unclassified 538
271 Ga0207707_10392075 3300025912 Bacteria 1193
272 Ga0207695_10070246 3300025913 Unclassified 3581
273 Ga0207695_10152574 3300025913 Bacteria 2248
274 Ga0207695_10835679 3300025913 Unclassified 801
275 Ga0207671_10014158 3300025914 Bacteria 6316
276 Ga0207671_10176366 3300025914 Bacteria 1661
277 Ga0207671_10368149 3300025914 Unclassified 1141
278 Ga0207671_10380694 3300025914 Unclassified 1121
279 Ga0207671_10438108 3300025914 Unclassified 1040
280 Ga0207671_10610337 3300025914 Bacteria 869
281 Ga0207671_11333452 3300025914 Unclassified 558
282 Ga0207693_10126903 3300025915 Unclassified 2005
283 Ga0207663_10012618 3300025916 Bacteria 4574
284 Ga0207663_10216258 3300025916 Bacteria 1392
285 Ga0207663_10632276 3300025916 Bacteria 843
286 Ga0207660_10015229 3300025917 Bacteria 5073
287 Ga0207660_11444253 3300025917 Unclassified 557
288 Ga0207649_10231755 3300025920 Bacteria 1321
289 Ga0207652_10134010 3300025921 Bacteria 2211
290 Ga0207652_10477068 3300025921 Bacteria 1124
291 Ga0207681_10927563 3300025923 Unclassified 730
292 Ga0207694_10150957 3300025924 Bacteria 1872
293 Ga0207694_10655649 3300025924 Bacteria 884
294 Ga0207694_10659818 3300025924 Unclassified 881
295 Ga0207650_10541444 3300025925 Bacteria 975
296 Ga0207650_10911888 3300025925 Bacteria 746
297 Ga0207659_10993653 3300025926 Bacteria 722
298 Ga0207687_10443587 3300025927 Bacteria 1075
299 Ga0207687_10736097 3300025927 Bacteria 838
300 Ga0207687_10853081 3300025927 Unclassified 778
301 Ga0207700_10002779 3300025928 Bacteria 10081
302 Ga0207700_10054918 3300025928 Bacteria 2992
303 Ga0207700_10474732 3300025928 Bacteria 1104
304 Ga0207700_11893657 3300025928 Unclassified 523
305 Ga0207664_10019610 3300025929 Bacteria 5001
306 Ga0207664_10178458 3300025929 Bacteria 1822
307 Ga0207644_10192586 3300025931 Bacteria 1604
308 Ga0207690_10162284 3300025932 Bacteria 1667
309 Ga0207686_10667267 3300025934 Unclassified 824
310 Ga0207686_11609528 3300025934 Unclassified 536
311 Ga0207670_10233680 3300025936 Bacteria 1413
312 Ga0207670_10263815 3300025936 Bacteria 1336
313 Ga0207704_10847736 3300025938 Unclassified 766
314 Ga0207704_10990590 3300025938 Bacteria 710
315 Ga0207704_11207801 3300025938 Unclassified 645
316 Ga0207665_10136076 3300025939 Bacteria 1748
317 Ga0207691_10608302 3300025940 Bacteria 925
318 Ga0207691_10860376 3300025940 Unclassified 760
319 Ga0207711_10101279 3300025941 Unclassified 2549
320 Ga0207711_10344085 3300025941 Unclassified 1380
321 Ga0207711_10465203 3300025941 Unclassified 1178
322 Ga0207711_10662397 3300025941 Bacteria 974
323 Ga0207711_11505867 3300025941 Unclassified 616
324 Ga0207711_12067822 3300025941 Bacteria 512
325 Ga0207689_10704792 3300025942 Bacteria 851
326 Ga0207689_11033664 3300025942 Unclassified 693
327 Ga0207661_10000054 3300025944 Bacteria 88056
328 Ga0207661_10265432 3300025944 Unclassified 1530
329 Ga0207661_10417013 3300025944 Bacteria 1219
330 Ga0207661_10493624 3300025944 Unclassified 1118
331 Ga0207661_10887787 3300025944 Bacteria 821
332 Ga0207661_12007447 3300025944 Bacteria 524
333 Ga0207679_12204691 3300025945 Unclassified 500
334 Ga0207667_10113338 3300025949 Unclassified 2796
335 Ga0207667_10176642 3300025949 Bacteria 2193
336 Ga0207667_10235657 3300025949 Bacteria 1873
337 Ga0207651_10312202 3300025960 Unclassified 1311
338 Ga0207651_11984228 3300025960 Unclassified 523
339 Ga0207658_10313923 3300025986 Unclassified 1355
340 Ga0207658_10734022 3300025986 Unclassified 894
341 Ga0207658_11228608 3300025986 Unclassified 685
342 Ga0207677_10366541 3300026023 Unclassified 1212
343 Ga0207677_11316655 3300026023 Unclassified 664
344 Ga0207677_11647808 3300026023 Unclassified 594
345 Ga0207703_10144338 3300026035 Bacteria 2069
346 Ga0207703_10216821 3300026035 Bacteria 1709
347 Ga0207703_10683395 3300026035 Unclassified 975
348 Ga0207703_10875007 3300026035 Bacteria 860
349 Ga0207703_11852053 3300026035 Unclassified 579
350 Ga0207703_11951225 3300026035 Unclassified 563
351 Ga0207639_10156484 3300026041 Bacteria 1915
352 Ga0207639_11628669 3300026041 Unclassified 605
353 Ga0207702_11284625 3300026078 Unclassified 726
354 Ga0207702_11412787 3300026078 Unclassified 690
355 Ga0207641_10025690 3300026088 Bacteria 4856
356 Ga0207641_10150987 3300026088 Unclassified 2104
357 Ga0207641_11072626 3300026088 Bacteria 804
358 Ga0207648_10500580 3300026089 Unclassified 1112
359 Ga0207648_10510778 3300026089 Bacteria 1100
360 Ga0207676_11061922 3300026095 Bacteria 800
361 Ga0207676_11365219 3300026095 Unclassified 704
362 Ga0207674_10288418 3300026116 Bacteria 1590
363 Ga0207674_11050426 3300026116 Unclassified 784
364 Ga0207683_11146901 3300026121 Bacteria 721
365 Ga0207698_10028061 3300026142 Bacteria 4007
366 Ga0207698_10088836 3300026142 Bacteria 2522
367 Ga0207428_10841026 3300027907 Unclassified 650
368 Ga0268266_10056752 3300028379 Bacteria 3369
369 Ga0268266_10178896 3300028379 Bacteria 1930
370 Ga0268266_10234265 3300028379 Unclassified 1692
371 Ga0268266_11281790 3300028379 Unclassified 708
372 Ga0268265_11103858 3300028380 Bacteria 788
373 Ga0268264_10453639 3300028381 Unclassified 1243
374 Ga0268264_10677792 3300028381 Unclassified 1022
375 Ga0268264_10687989 3300028381 Unclassified 1015
376 Ga0268264_10738469 3300028381 Unclassified 980
377 Ga0265336_10258919 3300028666 Unclassified 517
378 Ga0265338_10631489 3300028800 Unclassified 744
379 Ga0265338_11058457 3300028800 Unclassified 548
380 Ga0265777_124749 3300030877 Bacteria 511
381 Ga0265776_102212 3300030880 Unclassified 883
382 Ga0265760_10041399 3300031090 Unclassified 1373
383 Ga0265760_10373122 3300031090 Unclassified 513
384 Ga0265330_10091818 3300031235 Unclassified 1303
385 Ga0265330_10137509 3300031235 Bacteria 1039
386 Ga0265332_10259334 3300031238 Unclassified 719
387 Ga0265325_10038744 3300031241 Bacteria 2514
388 Ga0265339_10104153 3300031249 Bacteria 1474
389 Ga0265331_10079620 3300031250 Bacteria 1524
390 Ga0265331_10138809 3300031250 Bacteria 1106
391 Ga0265331_10287382 3300031250 Unclassified 737
392 Ga0265316_10003102 3300031344 Bacteria 16928
393 Ga0265316_10003615 3300031344 Bacteria 15593
394 Ga0265316_10027311 3300031344 Bacteria 4729
395 Ga0265316_10029107 3300031344 Bacteria 4547
396 Ga0265316_10178799 3300031344 Bacteria 1580
397 Ga0265316_10193856 3300031344 Unclassified 1508
398 Ga0265316_10402064 3300031344 Bacteria 986
399 Ga0265316_10403899 3300031344 Unclassified 984
400 Ga0265316_10771680 3300031344 Unclassified 675
401 Ga0265316_10960437 3300031344 Unclassified 595
402 Ga0265314_10326877 3300031711 Unclassified 851
403 Ga0265342_10226840 3300031712 Unclassified 1005
404 Ga0265342_10343157 3300031712 Bacteria 779
405 Ga0373926_0160074 3300035083 Bacteria 859
406 Ga0373934_0254451 3300035086 Bacteria 726
407 Ga0373936_0549991 3300035113 Bacteria 540
408 Ga0373953_0032882 3300035117 Bacteria 2026
409 Ga0373953_0142838 3300035117 Bacteria 1024
410 Ga0373954_0007705 3300035118 Bacteria 4713
411 Ga0373954_0111184 3300035118 Unclassified 1325
412 Ga0373956_0112020 3300035119 Bacteria 1271
413 Ga0373957_0223411 3300035120 Unclassified 789
414 Ga0373943_0051742 3300035170 Bacteria 2023
415 Ga0373943_0117718 3300035170 Bacteria 1409
416 Ga0373943_0726284 3300035170 Unclassified 589
417 Ga0373946_0038149 3300035171 Bacteria 1956
418 Ga0373955_0519805 3300035172 Unclassified 727
419 Ga0373955_0598546 3300035172 Unclassified 675
420 Ga0373924_0132121 3300035410 Bacteria 1086
421 Ga0373924_0237049 3300035410 Unclassified 807
422 Ga0373924_0457978 3300035410 Bacteria 572
423 Ga0373935_0045276 3300035692 Bacteria 2776
424 Ga0373935_0086266 3300035692 Bacteria 2048
425 Ga0373935_0245558 3300035692 Bacteria 1251
426 Ga0373935_0444167 3300035692 Unclassified 936
427 Ga0373935_0753073 3300035692 Unclassified 718
428 Ga0373927_0000205 3300035695 Bacteria 47428
429 Ga0373927_0015195 3300035695 Bacteria 5089
430 Ga0373927_0051502 3300035695 Bacteria 2662
431 Ga0373927_0309339 3300035695 Bacteria 1040
432 Ga0373927_0573069 3300035695 Bacteria 746
433 Ga0373927_0850675 3300035695 Bacteria 602
434 Ga0373933_0046015 3300035724 Bacteria 2589
435 Ga0373933_0068882 3300035724 Bacteria 2150
436 Ga0373933_0350889 3300035724 Bacteria 958
437 Ga0373947_0001580 3300035725 Bacteria 13954
438 Ga0373947_0211261 3300035725 Bacteria 1273
439 Ga0373947_0399581 3300035725 Bacteria 927
440 Ga0373947_0456341 3300035725 Unclassified 866
441 Ga0373947_0654134 3300035725 Unclassified 717
442 Ga0373937_0059162 3300036401 Bacteria 3521
443 Ga0373937_0110033 3300036401 Bacteria 2562
444 Ga0373925_0001066 3300037068 Bacteria 24764
445 Ga0373925_0134949 3300037068 Unclassified 1928
446 Ga0373925_0213405 3300037068 Bacteria 1538
447 Ga0373925_0221597 3300037068 Bacteria 1510
448 Ga0373925_0343958 3300037068 Bacteria 1210
449 Ga0373925_0892025 3300037068 Unclassified 733
450 Ga0373925_1059814 3300037068 Unclassified 667
451 Ga0395900_0492029 3300037418 Unclassified 1178
452 Ga0436364_0390292 3300037853 Bacteria 6240
453 Ga0436365_0109023 3300039437 Bacteria 4449
454 Ga0436360_0450429 3300039438 Unclassified 557
455 Ga0436363_0925775 3300039450 Unclassified 848
456 Ga0439448_0319431 3300042005 Unclassified 552
457 Ga0451577_0971297 3300042876 Unclassified 763
458 Ga0466961_0532012 3300044693 Unclassified 708
459 Ga0466963_0314021 3300044694 Unclassified 1103
460 Ga0466959_0252507 3300045049 Unclassified 1216
461 Ga0466959_0377458 3300045049 Unclassified 965
462 Ga0451576_0393799 3300045051 Bacteria 1452
463 Ga0451576_0704674 3300045051 Bacteria 1061
464 Ga0451576_1404302 3300045051 Unclassified 726
465 Ga0451576_1902309 3300045051 Unclassified 614
466 Ga0466958_0429728 3300045836 Unclassified 854
467 Ga0466967_1705860 3300045976 Unclassified 627
468 Ga0495592_0397782 3300046454 Bacteria 873
469 Ga0495592_0805452 3300046454 Unclassified 558
470 Ga0495603_0649133 3300046455 Unclassified 604
471 Ga0495651_0793273 3300046462 Unclassified 585
472 Ga0495651_0837851 3300046462 Unclassified 565
473 Ga0495651_0945578 3300046462 Unclassified 525
474 Ga0495651_1002594 3300046462 Unclassified 507
475 Ga0495580_0000494 3300046472 Bacteria 32970
476 Ga0495580_0002781 3300046472 Bacteria 15060
477 Ga0495580_0033981 3300046472 Unclassified 3672
478 Ga0495580_0123083 3300046472 Bacteria 1800
479 Ga0495580_0128432 3300046472 Bacteria 1759
480 Ga0495580_0137202 3300046472 Bacteria 1696
481 Ga0495580_0363097 3300046472 Unclassified 980
482 Ga0495580_0423058 3300046472 Unclassified 896
483 Ga0495580_0755836 3300046472 Unclassified 633
484 Ga0495580_0891386 3300046472 Unclassified 572
485 Ga0495639_0168746 3300046475 Bacteria 1062
486 Ga0495639_0426678 3300046475 Unclassified 672
487 Ga0495662_0153072 3300046476 Bacteria 1136
488 Ga0495662_0587185 3300046476 Unclassified 545
489 Ga0495664_0059287 3300046477 Unclassified 2278
490 Ga0495594_0761801 3300046499 Unclassified 546
491 Ga0495608_0132832 3300046511 Bacteria 1592
492 Ga0495618_0829239 3300046514 Unclassified 537
493 Ga0495628_0187484 3300046516 Bacteria 1563
494 Ga0495628_0349378 3300046516 Bacteria 1087
495 Ga0495628_0383564 3300046516 Bacteria 1029
496 Ga0495630_0250977 3300046517 Unclassified 1352
497 Ga0495630_0507163 3300046517 Bacteria 925
498 Ga0495666_0093084 3300046526 Bacteria 1422
499 Ga0495642_0465063 3300046528 Unclassified 559
500 Ga0495652_0130546 3300046529 Bacteria 1990
501 Ga0495665_0015366 3300046531 Bacteria 4123
502 Ga0495665_0063186 3300046531 Unclassified 1955
503 Ga0495665_0212638 3300046531 Bacteria 1001
504 Ga0495640_0232630 3300046533 Unclassified 1159
505 Ga0495587_0145242 3300046536 Unclassified 1353
506 Ga0495587_0634421 3300046536 Unclassified 587
507 Ga0495645_0070580 3300046543 Unclassified 2521
508 Ga0495645_0103378 3300046543 Unclassified 2024
509 Ga0495645_0109365 3300046543 Bacteria 1957
510 Ga0495645_0142561 3300046543 Bacteria 1671
511 Ga0495645_0600903 3300046543 Unclassified 677
512 Ga0495645_0925477 3300046543 Unclassified 516
513 Ga0495667_0002646 3300046559 Bacteria 11954
514 Ga0495667_0111420 3300046559 Bacteria 1768
515 Ga0495667_0179393 3300046559 Unclassified 1360
516 Ga0495635_0041715 3300046663 Bacteria 3170
517 Ga0495635_0212145 3300046663 Bacteria 1311
518 Ga0495635_0307809 3300046663 Unclassified 1062
519 Ga0495635_0580974 3300046663 Bacteria 733
520 Ga0495588_0178013 3300046674 Unclassified 1124
521 Ga0495599_0230850 3300046678 Bacteria 1130
522 Ga0495599_0498539 3300046678 Unclassified 717
523 Ga0495599_0512808 3300046678 Viruses 705
524 Ga0495623_0104474 3300046679 Bacteria 1723
525 Ga0495623_0274358 3300046679 Bacteria 940
526 Ga0495623_0493212 3300046679 Unclassified 647
527 Ga0495646_0202404 3300046680 Unclassified 1081
528 Ga0495646_0643096 3300046680 Unclassified 536
529 Ga0495581_0278441 3300047315 Unclassified 978
530 Ga0495604_0360172 3300047317 Unclassified 965
531 Ga0495674_0023966 3300047319 Bacteria 5615
532 Ga0495674_0042806 3300047319 Bacteria 4036
533 Ga0495674_0079456 3300047319 Bacteria 2817
534 Ga0495674_0277566 3300047319 Unclassified 1374
535 Ga0495680_0726568 3300047322 Unclassified 654
536 Ga0495675_0152661 3300047444 Bacteria 1426
537 Ga0495675_0155211 3300047444 Unclassified 1412
538 Ga0495684_0008355 3300047471 Bacteria 8021
539 Ga0495684_0014424 3300047471 Bacteria 6080
540 Ga0495684_0324188 3300047471 Bacteria 1100
541 Ga0495684_0504947 3300047471 Unclassified 831
542 Ga0495684_0934151 3300047471 Unclassified 556
543 Ga0495602_0099475 3300048088 Unclassified 2390
544 Ga0495602_0182395 3300048088 Bacteria 1618
545 Ga0495602_0831957 3300048088 Unclassified 618
546 Ga0496108_1391232 3300048911 Bacteria 587
547 Ga0496109_0665574 3300048912 Unclassified 978
548 Ga0496112_1525931 3300048915 Unclassified 582
549 Ga0496115_0587472 3300048918 Unclassified 887
550 Ga0496115_0910389 3300048918 Unclassified 678
551 nmdc:mga05p37_585428_c1 3300050507 Bacteria 1263
552 nmdc:mga09592_964751_c1 3300050508 Bacteria 714
553 nmdc:mga06r32_16978_c1 3300050510 Bacteria 6641
554 Ga0495601_0842000 3300053077 Unclassified 581
555 Ga0495601_1013153 3300053077 Unclassified 522
556 Ga0587070_111023 3300059491 Unclassified 644
557 Ga0587070_210095 3300059491 Unclassified 522
558 Ga0587073_0291043 3300059492 Unclassified 528
559 Ga0587080_037088 3300059503 Unclassified 874
560 Ga0587080_124910 3300059503 Unclassified 574
561 Ga0587083_0118786 3300059505 Unclassified 680
562 Ga0587083_0128521 3300059505 Unclassified 662
563 Ga0587083_0131585 3300059505 Bacteria 657
564 Ga0587085_079699 3300059506 Unclassified 657
565 Ga0587089_074734 3300059509 Unclassified 581
566 Ga0587091_032820 3300059511 Bacteria 984
567 Ga0587106_071828 3300059605 Unclassified 657
568 Ga0587109_171705 3300059624 Unclassified 549
569 Ga0587128_054959 3300059630 Unclassified 737
570 Ga0587128_055924 3300059630 Unclassified 733
571 Ga0587075_023240 3300059644 Unclassified 937
572 Ga0587075_089386 3300059644 Unclassified 600
573 Ga0587076_212925 3300059645 Unclassified 503
574 Ga0587079_034329 3300059647 Bacteria 992
575 Ga0587100_037224 3300059648 Unclassified 537
576 Ga0587071_160299 3300060344 Unclassified 565
577 Ga0587111_0034022 3300060346 Bacteria 1056
578 Ga0501082_0000581 3300060353 Bacteria 32431
579 Ga0466962_0320197 3300061719 Unclassified 769
580 Ga0207649_10497233
581 Ga0058859_11431176
582 Ga0058863_10019330
583 Ga0058863_11521521
584 Ga0058861_11377615
585 Ga0058861_11682296
586 Ga0058861_11862140
587 Ga0058860_12036233
588 Ga0058862_12546383
589 Ga0058862_12602623
590 Ga0070676_10189067
591 Ga0070676_10228262
592 Ga0070683_100000106
593 Ga0070683_100579736
594 Ga0070683_101015517
595 Ga0070683_101255622
596 Ga0070683_101710137
597 Ga0070666_10358888
598 Ga0070666_10848464
599 Ga0070680_100006829
600 Ga0070682_100633258
601 Ga0068868_100381495
602 Ga0068868_101470709
603 Ga0070689_100351308
604 Ga0070689_100526196
605 Ga0070687_101294234
606 Ga0070661_100200087
607 Ga0070675_100967256
608 Ga0070674_100123799
609 Ga0070674_102142181
610 Ga0070673_100332715
611 Ga0070688_100236190
612 Ga0070688_101308786
613 Ga0070659_100143096
614 Ga0070667_100714070
615 Ga0070667_100878026
616 Ga0070667_101171697
617 Ga0070714_100032741
618 Ga0070714_100156076
619 Ga0070713_100001239
620 Ga0070713_100041160
621 Ga0070713_100069063
622 Ga0070713_100177508
623 Ga0070713_100211533
624 Ga0070710_10804174
625 Ga0070711_100011107
626 Ga0070711_101038225
627 Ga0070705_100682896
628 Ga0070700_101364060
629 Ga0070662_100726347
630 Ga0070681_10478609
631 Ga0068867_100608221
632 Ga0068867_100974921
633 Ga0068867_101617205
634 Ga0070685_10702199
635 Ga0070685_11188532
636 Ga0070707_101318567
637 Ga0070699_101535107
638 Ga0070679_100162016
639 Ga0070679_100170119
640 Ga0070679_100296811
641 Ga0070684_100000710
642 Ga0070684_100067812
643 Ga0070684_100473201
644 Ga0070684_100700087
645 Ga0070684_100892748
646 Ga0070684_101224066
647 Ga0070697_100276262
648 Ga0068853_100591541
649 Ga0068853_100653184
650 Ga0070672_100432908
651 Ga0070672_101754636
652 Ga0070686_101007754
653 Ga0070695_100720045
654 Ga0070696_100147632
655 Ga0070693_101453879
656 Ga0070665_100223223
657 Ga0070665_100326803
658 Ga0070665_100376115
659 Ga0070665_100802902
660 Ga0068855_100050093
661 Ga0068855_100099560
662 Ga0068855_100136689
663 Ga0068855_100518276
664 Ga0068855_101383011
665 Ga0068855_101803032
666 Ga0070664_102066650
667 Ga0070664_102261604
668 Ga0068857_100793152
669 Ga0068857_100882059
670 Ga0068857_101287585
671 Ga0068857_101517421
672 Ga0068856_101249226
673 Ga0068856_101811215
674 Ga0068856_102182963
675 Ga0070702_101696780
676 Ga0068852_100040822
677 Ga0068852_100047240
678 Ga0068852_100080299
679 Ga0068852_101733936
680 Ga0068859_101426057
681 Ga0068859_101686868
682 Ga0068864_101093816
683 Ga0068864_101878542
684 Ga0068870_10382257
685 Ga0068863_100138454
686 Ga0068863_101234534
687 Ga0068863_101617973
688 Ga0068858_100124399
689 Ga0068858_100254177
690 Ga0068858_100267128
691 Ga0068858_100390577
692 Ga0068858_100802961
693 Ga0068858_101553153
694 Ga0068860_100917612
695 Ga0068860_100917920
696 Ga0068860_101398744
697 Ga0068860_102773100
698 Ga0068862_101261525
699 Ga0068862_102733802
700 Ga0070717_10019244
701 Ga0070717_10042408
702 Ga0070717_10253191
703 Ga0070717_10672511
704 Ga0070717_11188915
705 Ga0070717_11294096
706 Ga0070716_100142131
707 Ga0070716_100357575
708 Ga0070716_100659873
709 Ga0070716_100766372
710 Ga0070712_100347073
711 Ga0070712_100551649
712 Ga0097621_100126945
713 Ga0097621_100184569
714 Ga0097621_100491797
715 Ga0097621_100560489
716 Ga0097621_101537244
717 Ga0097621_102027559
718 Ga0068871_100129331
719 Ga0068871_100285963
720 Ga0068871_100301413
721 Ga0068871_100495170
722 Ga0068871_101107124
723 Ga0068871_101385729
724 Ga0068871_102335754
725 Ga0075428_101839331
726 Ga0075431_100007713
727 Ga0075431_100293428
728 Ga0075431_100990850
729 Ga0068865_100752953
730 Ga0068865_100800782
731 Ga0075436_100725721
732 Ga0097620_101425623
733 Ga0097620_101662453
734 Ga0097620_101686633
735 Ga0075435_100855082
736 Ga0105240_10002103
737 Ga0105240_10356355
738 Ga0105240_10959364
739 Ga0111539_11572424
740 Ga0105245_10413250
741 Ga0105245_11066098
742 Ga0105245_11106840
743 Ga0105245_11774794
744 Ga0105245_12357607
745 Ga0105247_10193279
746 Ga0105247_10747752
747 Ga0114129_10182862
748 Ga0105241_11307874
749 Ga0105241_11458766
750 Ga0105241_12161896
751 Ga0105242_10699898
752 Ga0105242_12021016
753 Ga0105242_13298595
754 Ga0105248_10084525
755 Ga0105248_10380699
756 Ga0105248_10554766
757 Ga0105248_11270983
758 Ga0105248_13168694
759 Ga0105237_10014239
760 Ga0105237_10076594
761 Ga0105237_11163799
762 Ga0105237_11269098
763 Ga0105238_10171633
764 Ga0105238_10428539
765 Ga0105238_12788119
766 Ga0105249_10828171
767 Ga0105249_11787751
768 Ga0105249_11973742
769 Ga0105239_10032817
770 Ga0105239_11972442
771 Ga0105239_12819467
772 Ga0105246_10259631
773 Ga0105246_10797203
774 Ga0157370_10001006
775 Ga0157369_10020452
776 Ga0157369_10767910
777 Ga0157374_10647625
778 Ga0157374_10904888
779 Ga0157374_11497039
780 Ga0157374_11505227
781 Ga0157374_12263576
782 Ga0157378_10457355
783 Ga0157378_10821493
784 Ga0157378_11771784
785 Ga0157378_12378962
786 Ga0163162_10432417
787 Ga0163162_10497018
788 Ga0163162_10801368
789 Ga0163162_10899535
790 Ga0163162_11076062
791 Ga0157372_10047703
792 Ga0157372_11180634
793 Ga0157372_12771247
794 Ga0157375_10141906
795 Ga0157375_10728593
796 Ga0163163_10007638
797 Ga0163163_10680404
798 Ga0163163_11204843
799 Ga0163163_13305527
800 Ga0157380_10214656
801 Ga0157377_11454484
802 Ga0157379_11989210
803 Ga0157379_12377725
804 Ga0157376_10096378
805 Ga0157376_10181148
806 Ga0157376_10516620
807 Ga0157376_10793321
808 Ga0157376_11261800
809 Ga0157376_11786894
810 Ga0163161_11173828
811 Ga0163161_11518333
812 Ga0163161_11944847
813 Ga0184594_105567
814 Ga0197907_10671103
815 Ga0197907_10677688
816 Ga0197907_11172313
817 Ga0206356_10632151
818 Ga0206356_10896598
819 Ga0206356_11136904
820 Ga0206349_1226731
821 Ga0206355_1074272
822 Ga0206355_1650620
823 Ga0206352_10009959
824 Ga0206352_10514620
825 Ga0206352_10534455
826 Ga0206352_10655281
827 Ga0206350_10520751
828 Ga0206354_10031776
829 Ga0206354_11247450
830 Ga0206353_10597002
831 Ga0206353_11219566
832 Ga0206353_11547426
833 Ga0213876_10027352
834 Ga0213875_10137840
835 Ga0213875_10372084
836 Ga0224712_10115543
837 Ga0224712_10192405
838 Ga0224712_10551295
839 Ga0207682_10273661
840 Ga0207692_10612186
841 Ga0207710_10777109
842 Ga0207680_10063596
843 Ga0207680_10198249
844 Ga0207685_10122388
845 Ga0207645_10775792
846 Ga0207645_11046269
847 Ga0207705_10526724
848 Ga0207654_10346407
849 Ga0207654_11262478
850 Ga0207707_10392075
851 Ga0207695_10070246
852 Ga0207695_10152574
853 Ga0207695_10835679
854 Ga0207671_10014158
855 Ga0207671_10176366
856 Ga0207671_10368149
857 Ga0207671_10380694
858 Ga0207671_10438108
859 Ga0207671_10610337
860 Ga0207671_11333452
861 Ga0207693_10126903
862 Ga0207663_10012618
863 Ga0207663_10216258
864 Ga0207663_10632276
865 Ga0207660_10015229
866 Ga0207660_11444253
867 Ga0207649_10231755
868 Ga0207652_10134010
869 Ga0207652_10477068
870 Ga0207681_10927563
871 Ga0207694_10150957
872 Ga0207694_10655649
873 Ga0207694_10659818
874 Ga0207650_10541444
875 Ga0207650_10911888
876 Ga0207659_10993653
877 Ga0207687_10443587
878 Ga0207687_10736097
879 Ga0207687_10853081
880 Ga0207700_10002779
881 Ga0207700_10054918
882 Ga0207700_10474732
883 Ga0207700_11893657
884 Ga0207664_10019610
885 Ga0207664_10178458
886 Ga0207644_10192586
887 Ga0207690_10162284
888 Ga0207686_10667267
889 Ga0207686_11609528
890 Ga0207670_10233680
891 Ga0207670_10263815
892 Ga0207704_10847736
893 Ga0207704_10990590
894 Ga0207704_11207801
895 Ga0207665_10136076
896 Ga0207691_10608302
897 Ga0207691_10860376
898 Ga0207711_10101279
899 Ga0207711_10344085
900 Ga0207711_10465203
901 Ga0207711_10662397
902 Ga0207711_11505867
903 Ga0207711_12067822
904 Ga0207689_10704792
905 Ga0207689_11033664
906 Ga0207661_10000054
907 Ga0207661_10265432
908 Ga0207661_10417013
909 Ga0207661_10493624
910 Ga0207661_10887787
911 Ga0207661_12007447
912 Ga0207679_12204691
913 Ga0207667_10113338
914 Ga0207667_10176642
915 Ga0207667_10235657
916 Ga0207651_10312202
917 Ga0207651_11984228
918 Ga0207658_10313923
919 Ga0207658_10734022
920 Ga0207658_11228608
921 Ga0207677_10366541
922 Ga0207677_11316655
923 Ga0207677_11647808
924 Ga0207703_10144338
925 Ga0207703_10216821
926 Ga0207703_10683395
927 Ga0207703_10875007
928 Ga0207703_11852053
929 Ga0207703_11951225
930 Ga0207639_10156484
931 Ga0207639_11628669
932 Ga0207702_11284625
933 Ga0207702_11412787
934 Ga0207641_10025690
935 Ga0207641_10150987
936 Ga0207641_11072626
937 Ga0207648_10500580
938 Ga0207648_10510778
939 Ga0207676_11061922
940 Ga0207676_11365219
941 Ga0207674_10288418
942 Ga0207674_11050426
943 Ga0207683_11146901
944 Ga0207698_10028061
945 Ga0207698_10088836
946 Ga0207428_10841026
947 Ga0268266_10056752
948 Ga0268266_10178896
949 Ga0268266_10234265
950 Ga0268266_11281790
951 Ga0268265_11103858
952 Ga0268264_10453639
953 Ga0268264_10677792
954 Ga0268264_10687989
955 Ga0268264_10738469
956 Ga0265336_10258919
957 Ga0265338_10631489
958 Ga0265338_11058457
959 Ga0265777_124749
960 Ga0265776_102212
961 Ga0265760_10041399
962 Ga0265760_10373122
963 Ga0265330_10091818
964 Ga0265330_10137509
965 Ga0265332_10259334
966 Ga0265325_10038744
967 Ga0265339_10104153
968 Ga0265331_10079620
969 Ga0265331_10138809
970 Ga0265331_10287382
971 Ga0265316_10003102
972 Ga0265316_10003615
973 Ga0265316_10027311
974 Ga0265316_10029107
975 Ga0265316_10178799
976 Ga0265316_10193856
977 Ga0265316_10402064
978 Ga0265316_10403899
979 Ga0265316_10771680
980 Ga0265316_10960437
981 Ga0265314_10326877
982 Ga0265342_10226840
983 Ga0265342_10343157
984 Ga0373926_0160074
985 Ga0373934_0254451
986 Ga0373936_0549991
987 Ga0373953_0032882
988 Ga0373953_0142838
989 Ga0373954_0007705
990 Ga0373954_0111184
991 Ga0373956_0112020
992 Ga0373957_0223411
993 Ga0373943_0051742
994 Ga0373943_0117718
995 Ga0373943_0726284
996 Ga0373946_0038149
997 Ga0373955_0519805
998 Ga0373955_0598546
999 Ga0373924_0132121
1000 Ga0373924_0237049
1001 Ga0373924_0457978
1002 Ga0373935_0045276
1003 Ga0373935_0086266
1004 Ga0373935_0245558
1005 Ga0373935_0444167
1006 Ga0373935_0753073
1007 Ga0373927_0000205
1008 Ga0373927_0015195
1009 Ga0373927_0051502
1010 Ga0373927_0309339
1011 Ga0373927_0573069
1012 Ga0373927_0850675
1013 Ga0373933_0046015
1014 Ga0373933_0068882
1015 Ga0373933_0350889
1016 Ga0373947_0001580
1017 Ga0373947_0211261
1018 Ga0373947_0399581
1019 Ga0373947_0456341
1020 Ga0373947_0654134
1021 Ga0373937_0059162
1022 Ga0373937_0110033
1023 Ga0373925_0001066
1024 Ga0373925_0134949
1025 Ga0373925_0213405
1026 Ga0373925_0221597
1027 Ga0373925_0343958
1028 Ga0373925_0892025
1029 Ga0373925_1059814
1030 Ga0395900_0492029
1031 Ga0436364_0390292
1032 Ga0436365_0109023
1033 Ga0436360_0450429
1034 Ga0436363_0925775
1035 Ga0439448_0319431
1036 Ga0451577_0971297
1037 Ga0466961_0532012
1038 Ga0466963_0314021
1039 Ga0466959_0252507
1040 Ga0466959_0377458
1041 Ga0451576_0393799
1042 Ga0451576_0704674
1043 Ga0451576_1404302
1044 Ga0451576_1902309
1045 Ga0466958_0429728
1046 Ga0466967_1705860
1047 Ga0495592_0397782
1048 Ga0495592_0805452
1049 Ga0495603_0649133
1050 Ga0495651_0793273
1051 Ga0495651_0837851
1052 Ga0495651_0945578
1053 Ga0495651_1002594
1054 Ga0495580_0000494
1055 Ga0495580_0002781
1056 Ga0495580_0033981
1057 Ga0495580_0123083
1058 Ga0495580_0128432
1059 Ga0495580_0137202
1060 Ga0495580_0363097
1061 Ga0495580_0423058
1062 Ga0495580_0755836
1063 Ga0495580_0891386
1064 Ga0495639_0168746
1065 Ga0495639_0426678
1066 Ga0495662_0153072
1067 Ga0495662_0587185
1068 Ga0495664_0059287
1069 Ga0495594_0761801
1070 Ga0495608_0132832
1071 Ga0495618_0829239
1072 Ga0495628_0187484
1073 Ga0495628_0349378
1074 Ga0495628_0383564
1075 Ga0495630_0250977
1076 Ga0495630_0507163
1077 Ga0495666_0093084
1078 Ga0495642_0465063
1079 Ga0495652_0130546
1080 Ga0495665_0015366
1081 Ga0495665_0063186
1082 Ga0495665_0212638
1083 Ga0495640_0232630
1084 Ga0495587_0145242
1085 Ga0495587_0634421
1086 Ga0495645_0070580
1087 Ga0495645_0103378
1088 Ga0495645_0109365
1089 Ga0495645_0142561
1090 Ga0495645_0600903
1091 Ga0495645_0925477
1092 Ga0495667_0002646
1093 Ga0495667_0111420
1094 Ga0495667_0179393
1095 Ga0495635_0041715
1096 Ga0495635_0212145
1097 Ga0495635_0307809
1098 Ga0495635_0580974
1099 Ga0495588_0178013
1100 Ga0495599_0230850
1101 Ga0495599_0498539
1102 Ga0495599_0512808
1103 Ga0495623_0104474
1104 Ga0495623_0274358
1105 Ga0495623_0493212
1106 Ga0495646_0202404
1107 Ga0495646_0643096
1108 Ga0495581_0278441
1109 Ga0495604_0360172
1110 Ga0495674_0023966
1111 Ga0495674_0042806
1112 Ga0495674_0079456
1113 Ga0495674_0277566
1114 Ga0495680_0726568
1115 Ga0495675_0152661
1116 Ga0495675_0155211
1117 Ga0495684_0008355
1118 Ga0495684_0014424
1119 Ga0495684_0324188
1120 Ga0495684_0504947
1121 Ga0495684_0934151
1122 Ga0495602_0099475
1123 Ga0495602_0182395
1124 Ga0495602_0831957
1125 Ga0496108_1391232
1126 Ga0496109_0665574
1127 Ga0496112_1525931
1128 Ga0496115_0587472
1129 Ga0496115_0910389
1130 nmdc:mga05p37_585428_c1
1131 nmdc:mga09592_964751_c1
1132 nmdc:mga06r32_16978_c1
1133 Ga0495601_0842000
1134 Ga0495601_1013153
1135 Ga0587070_111023
1136 Ga0587070_210095
1137 Ga0587073_0291043
1138 Ga0587080_037088
1139 Ga0587080_124910
1140 Ga0587083_0118786
1141 Ga0587083_0128521
1142 Ga0587083_0131585
1143 Ga0587085_079699
1144 Ga0587089_074734
1145 Ga0587091_032820
1146 Ga0587106_071828
1147 Ga0587109_171705
1148 Ga0587128_054959
1149 Ga0587128_055924
1150 Ga0587075_023240
1151 Ga0587075_089386
1152 Ga0587076_212925
1153 Ga0587079_034329
1154 Ga0587100_037224
1155 Ga0587071_160299
1156 Ga0587111_0034022
1157 Ga0501082_0000581
1158 Ga0466962_0320197

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13490

zf-HC2

Putative zinc-finger

7

40

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.721 7 59
3hug-assembly6.cif.gz_P crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6885 7 67
3hug-assembly6.cif.gz_F crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6789 7 59
3hug-assembly6.cif.gz_J crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6652 7 69
3hug-assembly3.cif.gz_L crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.6514 7 70
ID Description Score Start End Superfamily
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.721 7 59 1.10.10.1320
3hugP00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6885 7 67 1.10.10.1320
3hugN00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6811 7 68 1.10.10.1320
3hugF00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6789 7 59 1.10.10.1320
3hugH00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6789 7 68 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A521X5V7-F1-model_v4 RNA polymerase sigma factor 0.8756 2 60 GO:0003677
GO:0006352
GO:0016987
AF-A0A538T1I1-F1-model_v4 Putative zinc-finger domain-containing protein 0.8359 3 56 GO:0016020
AF-A0A2V9C2P9-F1-model_v4 Putative zinc-finger domain-containing protein 0.8358 3 61
AF-A0A7C1VQV6-F1-model_v4 Zf-HC2 domain-containing protein 0.8142 3 60
AF-A0A2D6SY35-F1-model_v4 Putative zinc-finger domain-containing protein 0.8057 2 61

Map