F465726
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 268 | 1156 | 247 |
Family's Representative Sequence
| Representative Sequence | 3300013104|Ga0157370_10468089|Ga0157370_104680892 |
| Length | 273 |
| Sequence | MVVMDVGSWFRDAVLSGSLLLAVPVAVVAGLVSFFSPCVVPLLPGYLSYATGLSGSDLASARRGRMVLGSFLFVLGFTFVFVALGTLSGALGEWLFAYTHQISIVLGAITIVVGLAFLGFIPFLQRDVRVHRVPAVGLAAAPLLGVLFGLGWTPCIGPTLSAVQLLALHSGTAGRGALLSVFYSLGLGIPFILAGLMFRRMLGAVAWVRRHQVWVTRLGGAMLVVVGVLLVTGVWDQWVADLRSLVGGFSVVVGSLRHTALRTPVARPPHRRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 2 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 39 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 42 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 44 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 45 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 46 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 51 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 57 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 62 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 63 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 64 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 79 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 86 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 88 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 89 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 90 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 91 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 130 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 131 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 132 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 133 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 134 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 135 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 136 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 137 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 138 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 139 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 140 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 141 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 142 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 143 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 144 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 145 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 146 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 147 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 148 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 149 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 150 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 151 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 152 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 153 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 154 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 155 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 156 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 157 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 158 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 159 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 160 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 161 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 162 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 163 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 164 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 165 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 166 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 167 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 168 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 169 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 170 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 171 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 189 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 190 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 191 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 192 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 193 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 194 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 195 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 197 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 198 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 199 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 200 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 201 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 202 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 203 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 204 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 218 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 219 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 220 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 221 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 222 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 235 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 236 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 237 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 238 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 239 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 241 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 242 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 243 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 245 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 246 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 247 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 250 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 251 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 252 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 253 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 254 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 255 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 256 | 2643221962 | Aeromicrobium sp. Root344 | Isolate | Unclassified |
| 257 | 2739367898 | Nocardioides sp. CF479 | Isolate | Unclassified |
| 258 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 259 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 260 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 261 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 262 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 263 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 264 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 265 | 2891326441 | Actinokineospora pegani TRM65233 | Isolate | Unclassified |
| 266 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 267 | 2984592036 | Aeromicrobium sp. SORGH_AS981 | Isolate | Aerial Root |
| 268 | 8054609563 | Nocardioides astragali CGMCC 4.7327 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.85 |
| Metatranscriptomes | 0.87 |
| Isolates | 3.29 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.17 |
| Bulb | 0 |
| Endosphere | 5.36 |
| Nodule | 0.17 |
| Rhizoplane | 11.94 |
| Rhizosphere | 78.03 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0157370_10468089 | 3300013104 | Bacteria | 1158 |
| 2 | LJQas_1000791 | 3300000549 | Bacteria | 5002 |
| 3 | JGI24740J21852_10036647 | 3300001979 | Bacteria | 1521 |
| 4 | JGI24739J22299_10013863 | 3300001989 | Bacteria | 2936 |
| 5 | JGI24737J22298_10025395 | 3300001990 | Bacteria | 1873 |
| 6 | JGI24743J22301_10018582 | 3300001991 | Bacteria | 1315 |
| 7 | JGI24735J21928_10014255 | 3300002067 | Bacteria | 2491 |
| 8 | JGI24738J21930_10007114 | 3300002075 | Bacteria | 2596 |
| 9 | JGI24744J21845_10018865 | 3300002077 | Bacteria | 1366 |
| 10 | rootH1_10033679 | 3300003323 | Bacteria | 1710 |
| 11 | Ga0070658_10012041 | 3300005327 | Bacteria | 6947 |
| 12 | Ga0070658_10505716 | 3300005327 | Bacteria | 1044 |
| 13 | Ga0070683_100000595 | 3300005329 | Bacteria | 25935 |
| 14 | Ga0070683_100012197 | 3300005329 | Bacteria | 7460 |
| 15 | Ga0070683_100037631 | 3300005329 | Bacteria | 4429 |
| 16 | Ga0070683_100041635 | 3300005329 | Bacteria | 4227 |
| 17 | Ga0070683_100130019 | 3300005329 | Bacteria | 2383 |
| 18 | Ga0070670_100387936 | 3300005331 | Bacteria | 1231 |
| 19 | Ga0070670_100625124 | 3300005331 | Bacteria | 965 |
| 20 | Ga0070670_100881955 | 3300005331 | Bacteria | 810 |
| 21 | Ga0068869_100171711 | 3300005334 | Bacteria | 1694 |
| 22 | Ga0070680_100118850 | 3300005336 | Bacteria | 2205 |
| 23 | Ga0070682_100015284 | 3300005337 | Bacteria | 4446 |
| 24 | Ga0070682_100029105 | 3300005337 | Bacteria | 3325 |
| 25 | Ga0070682_100607112 | 3300005337 | Bacteria | 865 |
| 26 | Ga0068868_100025987 | 3300005338 | Bacteria | 4459 |
| 27 | Ga0068868_100151465 | 3300005338 | Bacteria | 1910 |
| 28 | Ga0070660_100002926 | 3300005339 | Bacteria | 11751 |
| 29 | Ga0070660_100011911 | 3300005339 | Bacteria | 6202 |
| 30 | Ga0070660_100088149 | 3300005339 | Bacteria | 2443 |
| 31 | Ga0070689_100193700 | 3300005340 | Bacteria | 1656 |
| 32 | Ga0070689_100346052 | 3300005340 | Bacteria | 1246 |
| 33 | Ga0070689_100772468 | 3300005340 | Bacteria | 843 |
| 34 | Ga0070691_10168528 | 3300005341 | Bacteria | 1133 |
| 35 | Ga0070692_10014250 | 3300005345 | Bacteria | 3729 |
| 36 | Ga0070668_100761363 | 3300005347 | Bacteria | 858 |
| 37 | Ga0070675_100098169 | 3300005354 | Bacteria | 2463 |
| 38 | Ga0070675_100114144 | 3300005354 | Bacteria | 2289 |
| 39 | Ga0070671_100211431 | 3300005355 | Bacteria | 1645 |
| 40 | Ga0070659_100020178 | 3300005366 | Bacteria | 5060 |
| 41 | Ga0070659_100024773 | 3300005366 | Bacteria | 4602 |
| 42 | Ga0070659_100148721 | 3300005366 | Bacteria | 1910 |
| 43 | Ga0070701_10002803 | 3300005438 | Bacteria | 6777 |
| 44 | Ga0070705_100048323 | 3300005440 | Bacteria | 2464 |
| 45 | Ga0070700_100002994 | 3300005441 | Bacteria | 8672 |
| 46 | Ga0070708_100737323 | 3300005445 | Bacteria | 927 |
| 47 | Ga0070663_100024332 | 3300005455 | Bacteria | 4074 |
| 48 | Ga0070663_100119239 | 3300005455 | Bacteria | 1991 |
| 49 | Ga0070678_100096083 | 3300005456 | Bacteria | 2285 |
| 50 | Ga0070662_100195647 | 3300005457 | Bacteria | 1601 |
| 51 | Ga0068867_100017253 | 3300005459 | Bacteria | 5127 |
| 52 | Ga0070685_10069957 | 3300005466 | Bacteria | 2077 |
| 53 | Ga0070685_10605446 | 3300005466 | Bacteria | 789 |
| 54 | Ga0070698_100176599 | 3300005471 | Bacteria | 2075 |
| 55 | Ga0070679_100010575 | 3300005530 | Bacteria | 8755 |
| 56 | Ga0070679_100565992 | 3300005530 | Bacteria | 1080 |
| 57 | Ga0070684_100000974 | 3300005535 | Bacteria | 20418 |
| 58 | Ga0070684_100009885 | 3300005535 | Bacteria | 7538 |
| 59 | Ga0070684_100294162 | 3300005535 | Bacteria | 1489 |
| 60 | Ga0068853_100482372 | 3300005539 | Bacteria | 1169 |
| 61 | Ga0070672_100015637 | 3300005543 | Bacteria | 5413 |
| 62 | Ga0070672_100046394 | 3300005543 | Bacteria | 3367 |
| 63 | Ga0070665_100000516 | 3300005548 | Bacteria | 55112 |
| 64 | Ga0070665_100246302 | 3300005548 | Bacteria | 1788 |
| 65 | Ga0070665_100310459 | 3300005548 | Bacteria | 1581 |
| 66 | Ga0070665_100429596 | 3300005548 | Bacteria | 1330 |
| 67 | Ga0068855_100180464 | 3300005563 | Bacteria | 2387 |
| 68 | Ga0068855_100285540 | 3300005563 | Bacteria | 1831 |
| 69 | Ga0070664_100066246 | 3300005564 | Bacteria | 3084 |
| 70 | Ga0068857_100014792 | 3300005577 | Bacteria | 6808 |
| 71 | Ga0068857_100040714 | 3300005577 | Bacteria | 4121 |
| 72 | Ga0068857_100339275 | 3300005577 | Bacteria | 1390 |
| 73 | Ga0068854_100006406 | 3300005578 | Bacteria | 7488 |
| 74 | Ga0068854_100342829 | 3300005578 | Bacteria | 1221 |
| 75 | Ga0068856_100042280 | 3300005614 | Bacteria | 4482 |
| 76 | Ga0068856_100153878 | 3300005614 | Bacteria | 2309 |
| 77 | Ga0068856_100492075 | 3300005614 | Bacteria | 1247 |
| 78 | Ga0070702_100043945 | 3300005615 | Bacteria | 2520 |
| 79 | Ga0070702_100252106 | 3300005615 | Bacteria | 1197 |
| 80 | Ga0068852_100003904 | 3300005616 | Bacteria | 10476 |
| 81 | Ga0068852_101129532 | 3300005616 | Bacteria | 804 |
| 82 | Ga0068864_100199078 | 3300005618 | Bacteria | 1839 |
| 83 | Ga0068866_10019767 | 3300005718 | Bacteria | 3073 |
| 84 | Ga0068861_100054547 | 3300005719 | Bacteria | 3045 |
| 85 | Ga0068861_100129888 | 3300005719 | Bacteria | 2044 |
| 86 | Ga0068861_100271266 | 3300005719 | Bacteria | 1457 |
| 87 | Ga0068861_100736895 | 3300005719 | Bacteria | 919 |
| 88 | Ga0068870_10003570 | 3300005840 | Bacteria | 6593 |
| 89 | Ga0068870_10332628 | 3300005840 | Bacteria | 969 |
| 90 | Ga0068858_100196592 | 3300005842 | Bacteria | 1906 |
| 91 | Ga0068860_100042829 | 3300005843 | Bacteria | 4321 |
| 92 | Ga0081455_10058888 | 3300005937 | Bacteria | 3247 |
| 93 | Ga0075365_10007089 | 3300006038 | Bacteria | 6248 |
| 94 | Ga0075365_10039452 | 3300006038 | Bacteria | 3075 |
| 95 | Ga0075365_10041806 | 3300006038 | Bacteria | 2995 |
| 96 | Ga0075365_10057946 | 3300006038 | Bacteria | 2578 |
| 97 | Ga0075365_10065030 | 3300006038 | Bacteria | 2444 |
| 98 | Ga0075365_10108524 | 3300006038 | Bacteria | 1906 |
| 99 | Ga0075365_10125073 | 3300006038 | Bacteria | 1776 |
| 100 | Ga0075365_10425168 | 3300006038 | Bacteria | 938 |
| 101 | Ga0075363_100091457 | 3300006048 | Bacteria | 1675 |
| 102 | Ga0075363_100160136 | 3300006048 | Bacteria | 1274 |
| 103 | Ga0075364_10001229 | 3300006051 | Bacteria | 13785 |
| 104 | Ga0075364_10065945 | 3300006051 | Bacteria | 2377 |
| 105 | Ga0075367_10218376 | 3300006178 | Bacteria | 1193 |
| 106 | Ga0075367_10267550 | 3300006178 | Bacteria | 1073 |
| 107 | Ga0075367_10313692 | 3300006178 | Bacteria | 988 |
| 108 | Ga0097621_100476148 | 3300006237 | Bacteria | 1128 |
| 109 | Ga0068871_100554854 | 3300006358 | Bacteria | 1041 |
| 110 | Ga0075428_100007431 | 3300006844 | Bacteria | 12139 |
| 111 | Ga0075430_100024364 | 3300006846 | Bacteria | 5150 |
| 112 | Ga0075431_100048400 | 3300006847 | Bacteria | 4385 |
| 113 | Ga0075434_100436787 | 3300006871 | Bacteria | 1330 |
| 114 | Ga0075429_100001474 | 3300006880 | Bacteria | 19345 |
| 115 | Ga0068865_100005614 | 3300006881 | Bacteria | 7613 |
| 116 | Ga0068865_100025261 | 3300006881 | Bacteria | 3905 |
| 117 | Ga0111539_10021329 | 3300009094 | Bacteria | 7975 |
| 118 | Ga0111539_11161145 | 3300009094 | Bacteria | 897 |
| 119 | Ga0105245_10001045 | 3300009098 | Bacteria | 25060 |
| 120 | Ga0105245_10007753 | 3300009098 | Bacteria | 9401 |
| 121 | Ga0105245_10084004 | 3300009098 | Bacteria | 2916 |
| 122 | Ga0105245_10087710 | 3300009098 | Bacteria | 2856 |
| 123 | Ga0105245_10139465 | 3300009098 | Bacteria | 2282 |
| 124 | Ga0105245_10242202 | 3300009098 | Bacteria | 1749 |
| 125 | Ga0105245_10273607 | 3300009098 | Bacteria | 1648 |
| 126 | Ga0105245_10645013 | 3300009098 | Bacteria | 1089 |
| 127 | Ga0105245_10775499 | 3300009098 | Bacteria | 996 |
| 128 | Ga0105245_11076291 | 3300009098 | Bacteria | 850 |
| 129 | Ga0114129_10014918 | 3300009147 | Bacteria | 11069 |
| 130 | Ga0105243_10024814 | 3300009148 | Bacteria | 4576 |
| 131 | Ga0105243_10098791 | 3300009148 | Bacteria | 2419 |
| 132 | Ga0105243_10153711 | 3300009148 | Bacteria | 1977 |
| 133 | Ga0105243_10388028 | 3300009148 | Bacteria | 1294 |
| 134 | Ga0105242_10032078 | 3300009176 | Bacteria | 4200 |
| 135 | Ga0105248_10022398 | 3300009177 | Bacteria | 7009 |
| 136 | Ga0105248_10303636 | 3300009177 | Bacteria | 1797 |
| 137 | Ga0105237_10045893 | 3300009545 | Bacteria | 4397 |
| 138 | Ga0105237_10285199 | 3300009545 | Bacteria | 1654 |
| 139 | Ga0105238_10427852 | 3300009551 | Bacteria | 1319 |
| 140 | Ga0105249_10062657 | 3300009553 | Bacteria | 3414 |
| 141 | Ga0105249_10071230 | 3300009553 | Bacteria | 3211 |
| 142 | Ga0105239_10001253 | 3300010375 | Bacteria | 34499 |
| 143 | Ga0105239_10047815 | 3300010375 | Bacteria | 4689 |
| 144 | Ga0105239_10444357 | 3300010375 | Bacteria | 1471 |
| 145 | Ga0105246_10001941 | 3300011119 | Bacteria | 12477 |
| 146 | Ga0105246_10464207 | 3300011119 | Bacteria | 1067 |
| 147 | Ga0157347_1005872 | 3300012502 | Unclassified | 1185 |
| 148 | Ga0157369_10073863 | 3300013105 | Bacteria | 3658 |
| 149 | Ga0157369_10476402 | 3300013105 | Bacteria | 1292 |
| 150 | Ga0157369_10709809 | 3300013105 | Bacteria | 1035 |
| 151 | Ga0163162_10008748 | 3300013306 | Bacteria | 9849 |
| 152 | Ga0157372_10001487 | 3300013307 | Bacteria | 25461 |
| 153 | Ga0157372_10034370 | 3300013307 | Bacteria | 5573 |
| 154 | Ga0157372_10087006 | 3300013307 | Bacteria | 3545 |
| 155 | Ga0157372_10250364 | 3300013307 | Bacteria | 2056 |
| 156 | Ga0157375_10005304 | 3300013308 | Bacteria | 11195 |
| 157 | Ga0157375_10086415 | 3300013308 | Bacteria | 3187 |
| 158 | Ga0157375_10410612 | 3300013308 | Bacteria | 1520 |
| 159 | Ga0157375_10584273 | 3300013308 | Bacteria | 1277 |
| 160 | Ga0163163_10009412 | 3300014325 | Bacteria | 8723 |
| 161 | Ga0163163_10045024 | 3300014325 | Bacteria | 4330 |
| 162 | Ga0163163_10522754 | 3300014325 | Bacteria | 1249 |
| 163 | Ga0163163_10551117 | 3300014325 | Bacteria | 1216 |
| 164 | Ga0157380_10016669 | 3300014326 | Bacteria | 5423 |
| 165 | Ga0157380_10247126 | 3300014326 | Bacteria | 1612 |
| 166 | Ga0182008_10097869 | 3300014497 | Bacteria | 1448 |
| 167 | Ga0157377_10143626 | 3300014745 | Bacteria | 1469 |
| 168 | Ga0206356_11077315 | 3300020070 | Bacteria | 1283 |
| 169 | Ga0206354_10439127 | 3300020081 | Bacteria | 1048 |
| 170 | Ga0206354_10538880 | 3300020081 | Bacteria | 1523 |
| 171 | Ga0206353_11317060 | 3300020082 | Bacteria | 2021 |
| 172 | Ga0206353_11372022 | 3300020082 | Bacteria | 1907 |
| 173 | Ga0213875_10087306 | 3300021388 | Bacteria | 1455 |
| 174 | Ga0207688_10014383 | 3300025901 | Bacteria | 4304 |
| 175 | Ga0207688_10035351 | 3300025901 | Bacteria | 2768 |
| 176 | Ga0207688_10053836 | 3300025901 | Bacteria | 2257 |
| 177 | Ga0207647_10008168 | 3300025904 | Bacteria | 7522 |
| 178 | Ga0207647_10008361 | 3300025904 | Bacteria | 7423 |
| 179 | Ga0207647_10012175 | 3300025904 | Bacteria | 5999 |
| 180 | Ga0207647_10072862 | 3300025904 | Bacteria | 2071 |
| 181 | Ga0207643_10008822 | 3300025908 | Bacteria | 5411 |
| 182 | Ga0207643_10262587 | 3300025908 | Bacteria | 1066 |
| 183 | Ga0207705_10023738 | 3300025909 | Bacteria | 4375 |
| 184 | Ga0207705_10056034 | 3300025909 | Bacteria | 2842 |
| 185 | Ga0207705_10107277 | 3300025909 | Bacteria | 2060 |
| 186 | Ga0207707_10292551 | 3300025912 | Bacteria | 1409 |
| 187 | Ga0207660_10087023 | 3300025917 | Bacteria | 2308 |
| 188 | Ga0207660_10282300 | 3300025917 | Bacteria | 1318 |
| 189 | Ga0207662_10111434 | 3300025918 | Bacteria | 1706 |
| 190 | Ga0207662_10146221 | 3300025918 | Bacteria | 1500 |
| 191 | Ga0207657_10013097 | 3300025919 | Bacteria | 8150 |
| 192 | Ga0207657_10021223 | 3300025919 | Bacteria | 6117 |
| 193 | Ga0207657_10081092 | 3300025919 | Bacteria | 2726 |
| 194 | Ga0207652_10008481 | 3300025921 | Bacteria | 8271 |
| 195 | Ga0207652_10441579 | 3300025921 | Bacteria | 1173 |
| 196 | Ga0207650_10425177 | 3300025925 | Bacteria | 1103 |
| 197 | Ga0207650_10432025 | 3300025925 | Bacteria | 1094 |
| 198 | Ga0207687_10015542 | 3300025927 | Bacteria | 4992 |
| 199 | Ga0207687_10022089 | 3300025927 | Bacteria | 4233 |
| 200 | Ga0207687_10114603 | 3300025927 | Bacteria | 2006 |
| 201 | Ga0207687_10201545 | 3300025927 | Bacteria | 1556 |
| 202 | Ga0207687_10530354 | 3300025927 | Bacteria | 986 |
| 203 | Ga0207664_10057761 | 3300025929 | Bacteria | 3085 |
| 204 | Ga0207690_10132474 | 3300025932 | Bacteria | 1826 |
| 205 | Ga0207690_10137466 | 3300025932 | Bacteria | 1796 |
| 206 | Ga0207690_10223288 | 3300025932 | Unclassified | 1442 |
| 207 | Ga0207706_10202620 | 3300025933 | Bacteria | 1740 |
| 208 | Ga0207686_10285312 | 3300025934 | Bacteria | 1220 |
| 209 | Ga0207686_10379063 | 3300025934 | Bacteria | 1072 |
| 210 | Ga0207709_10011977 | 3300025935 | Bacteria | 4781 |
| 211 | Ga0207709_10030469 | 3300025935 | Bacteria | 3138 |
| 212 | Ga0207670_10270564 | 3300025936 | Bacteria | 1320 |
| 213 | Ga0207704_10018812 | 3300025938 | Bacteria | 3615 |
| 214 | Ga0207691_10000686 | 3300025940 | Bacteria | 33446 |
| 215 | Ga0207691_10028755 | 3300025940 | Bacteria | 5203 |
| 216 | Ga0207661_10007993 | 3300025944 | Bacteria | 7542 |
| 217 | Ga0207661_10011183 | 3300025944 | Bacteria | 6492 |
| 218 | Ga0207661_10141448 | 3300025944 | Bacteria | 2071 |
| 219 | Ga0207661_10264137 | 3300025944 | Bacteria | 1534 |
| 220 | Ga0207679_10785599 | 3300025945 | Bacteria | 867 |
| 221 | Ga0207651_10043631 | 3300025960 | Bacteria | 2995 |
| 222 | Ga0207668_10032799 | 3300025972 | Bacteria | 3437 |
| 223 | Ga0207640_10364073 | 3300025981 | Bacteria | 1166 |
| 224 | Ga0207658_10076599 | 3300025986 | Bacteria | 2549 |
| 225 | Ga0207677_10158824 | 3300026023 | Bacteria | 1754 |
| 226 | Ga0207677_10170227 | 3300026023 | Bacteria | 1702 |
| 227 | Ga0207703_10158393 | 3300026035 | Bacteria | 1981 |
| 228 | Ga0207639_10149050 | 3300026041 | Bacteria | 1957 |
| 229 | Ga0207678_10038799 | 3300026067 | Bacteria | 4136 |
| 230 | Ga0207678_10111013 | 3300026067 | Bacteria | 2339 |
| 231 | Ga0207708_10000075 | 3300026075 | Bacteria | 78540 |
| 232 | Ga0207708_10029802 | 3300026075 | Bacteria | 4137 |
| 233 | Ga0207702_10405204 | 3300026078 | Bacteria | 1316 |
| 234 | Ga0207641_10641209 | 3300026088 | Bacteria | 1043 |
| 235 | Ga0207648_10001457 | 3300026089 | Bacteria | 26045 |
| 236 | Ga0207676_10066644 | 3300026095 | Bacteria | 2873 |
| 237 | Ga0207676_10279493 | 3300026095 | Bacteria | 1515 |
| 238 | Ga0207674_10027968 | 3300026116 | Bacteria | 5958 |
| 239 | Ga0207674_10030347 | 3300026116 | Bacteria | 5684 |
| 240 | Ga0207674_10482800 | 3300026116 | Bacteria | 1198 |
| 241 | Ga0207675_100009073 | 3300026118 | Bacteria | 9333 |
| 242 | Ga0207675_100044193 | 3300026118 | Bacteria | 4162 |
| 243 | Ga0207675_100417073 | 3300026118 | Bacteria | 1325 |
| 244 | Ga0207675_100503640 | 3300026118 | Bacteria | 1206 |
| 245 | Ga0207683_10080639 | 3300026121 | Bacteria | 2887 |
| 246 | Ga0268266_10000509 | 3300028379 | Bacteria | 54900 |
| 247 | Ga0268266_10156872 | 3300028379 | Bacteria | 2057 |
| 248 | Ga0268266_10415023 | 3300028379 | Bacteria | 1275 |
| 249 | Ga0316181_1095490 | 3300030744 | Bacteria | 1630 |
| 250 | Ga0307408_100007224 | 3300031548 | Bacteria | 7347 |
| 251 | Ga0307508_10286375 | 3300031616 | Bacteria | 1241 |
| 252 | Ga0307405_10000853 | 3300031731 | Bacteria | 12028 |
| 253 | Ga0307413_10088322 | 3300031824 | Bacteria | 2010 |
| 254 | Ga0307413_10430331 | 3300031824 | Bacteria | 1042 |
| 255 | Ga0307410_10216131 | 3300031852 | Bacteria | 1472 |
| 256 | Ga0307410_10585046 | 3300031852 | Bacteria | 929 |
| 257 | Ga0307406_10103478 | 3300031901 | Bacteria | 1944 |
| 258 | Ga0307407_10057303 | 3300031903 | Bacteria | 2259 |
| 259 | Ga0307407_10170651 | 3300031903 | Bacteria | 1432 |
| 260 | Ga0307412_10007210 | 3300031911 | Bacteria | 6309 |
| 261 | Ga0307412_10119820 | 3300031911 | Bacteria | 1893 |
| 262 | Ga0307409_100023586 | 3300031995 | Bacteria | 4268 |
| 263 | Ga0307409_100074287 | 3300031995 | Bacteria | 2716 |
| 264 | Ga0307409_100079690 | 3300031995 | Bacteria | 2640 |
| 265 | Ga0307409_100298910 | 3300031995 | Bacteria | 1496 |
| 266 | Ga0307416_100034486 | 3300032002 | Bacteria | 3852 |
| 267 | Ga0307416_100049371 | 3300032002 | Bacteria | 3345 |
| 268 | Ga0307416_100619996 | 3300032002 | Bacteria | 1163 |
| 269 | Ga0307414_10136962 | 3300032004 | Bacteria | 1911 |
| 270 | Ga0307414_10413993 | 3300032004 | Bacteria | 1174 |
| 271 | Ga0307414_10581096 | 3300032004 | Bacteria | 1002 |
| 272 | Ga0307411_10000384 | 3300032005 | Bacteria | 15110 |
| 273 | Ga0307415_100000246 | 3300032126 | Bacteria | 23474 |
| 274 | Ga0307415_100049725 | 3300032126 | Bacteria | 2836 |
| 275 | Ga0307415_100397686 | 3300032126 | Bacteria | 1175 |
| 276 | Ga0307507_10102394 | 3300033179 | Bacteria | 2389 |
| 277 | Ga0395899_0063780 | 3300037312 | Bacteria | 2710 |
| 278 | Ga0395899_0176406 | 3300037312 | Bacteria | 1502 |
| 279 | Ga0395900_0124415 | 3300037418 | Bacteria | 2645 |
| 280 | Ga0395898_0042111 | 3300037466 | Bacteria | 4507 |
| 281 | Ga0395898_0046260 | 3300037466 | Bacteria | 4274 |
| 282 | Ga0395905_0054079 | 3300037471 | Bacteria | 3757 |
| 283 | Ga0395905_0210677 | 3300037471 | Bacteria | 1821 |
| 284 | Ga0436364_0597294 | 3300037853 | Bacteria | 1910 |
| 285 | Ga0395901_0009942 | 3300038443 | Bacteria | 9644 |
| 286 | Ga0395901_0164323 | 3300038443 | Bacteria | 2331 |
| 287 | Ga0395901_0568881 | 3300038443 | Bacteria | 1146 |
| 288 | Ga0439438_047775 | 3300041405 | Bacteria | 1096 |
| 289 | Ga0439465_0083941 | 3300041413 | Bacteria | 1083 |
| 290 | Ga0451789_0306457 | 3300041443 | Bacteria | 1410 |
| 291 | Ga0451791_0569766 | 3300041451 | Bacteria | 4253 |
| 292 | Ga0451791_0692505 | 3300041451 | Bacteria | 3005 |
| 293 | Ga0451793_1711376 | 3300041452 | Bacteria | 1709 |
| 294 | Ga0451797_0187531 | 3300041453 | Bacteria | 1741 |
| 295 | Ga0451800_0541020 | 3300041459 | Bacteria | 1198 |
| 296 | Ga0451802_0759723 | 3300041460 | Bacteria | 1447 |
| 297 | Ga0451839_0271543 | 3300041496 | Bacteria | 1306 |
| 298 | Ga0451853_0892418 | 3300041512 | Bacteria | 2236 |
| 299 | Ga0451853_3034603 | 3300041512 | Bacteria | 2647 |
| 300 | Ga0466965_0007206 | 3300044683 | Bacteria | 5097 |
| 301 | Ga0466965_0058634 | 3300044683 | Bacteria | 1920 |
| 302 | Ga0466966_0097089 | 3300044684 | Bacteria | 1825 |
| 303 | Ga0466966_0139451 | 3300044684 | Bacteria | 1482 |
| 304 | Ga0466966_0256703 | 3300044684 | Bacteria | 1052 |
| 305 | Ga0466961_0034449 | 3300044693 | Bacteria | 3251 |
| 306 | Ga0466961_0051600 | 3300044693 | Bacteria | 2626 |
| 307 | Ga0466961_0088817 | 3300044693 | Bacteria | 1952 |
| 308 | Ga0466961_0251511 | 3300044693 | Bacteria | 1085 |
| 309 | Ga0466961_0360172 | 3300044693 | Bacteria | 885 |
| 310 | Ga0466963_0006461 | 3300044694 | Bacteria | 6934 |
| 311 | Ga0466963_0014960 | 3300044694 | Bacteria | 4795 |
| 312 | Ga0466963_0016781 | 3300044694 | Bacteria | 4557 |
| 313 | Ga0466963_0026824 | 3300044694 | Bacteria | 3686 |
| 314 | Ga0466963_0066345 | 3300044694 | Bacteria | 2421 |
| 315 | Ga0466963_0080439 | 3300044694 | Bacteria | 2206 |
| 316 | Ga0466963_0385683 | 3300044694 | Bacteria | 988 |
| 317 | Ga0466964_0007394 | 3300044706 | Bacteria | 4108 |
| 318 | Ga0466964_0008357 | 3300044706 | Bacteria | 3887 |
| 319 | Ga0466964_0197963 | 3300044706 | Bacteria | 963 |
| 320 | Ga0466971_0005487 | 3300044719 | Bacteria | 5506 |
| 321 | Ga0466971_0090070 | 3300044719 | Bacteria | 1404 |
| 322 | Ga0466970_0007753 | 3300044765 | Bacteria | 5386 |
| 323 | Ga0466970_0012945 | 3300044765 | Bacteria | 4272 |
| 324 | Ga0466970_0054582 | 3300044765 | Bacteria | 2134 |
| 325 | Ga0466970_0075820 | 3300044765 | Bacteria | 1811 |
| 326 | Ga0466970_0092656 | 3300044765 | Bacteria | 1641 |
| 327 | Ga0466970_0109944 | 3300044765 | Bacteria | 1505 |
| 328 | Ga0466970_0110815 | 3300044765 | Bacteria | 1499 |
| 329 | Ga0466970_0205397 | 3300044765 | Bacteria | 1097 |
| 330 | Ga0466957_0017791 | 3300044842 | Bacteria | 4169 |
| 331 | Ga0466957_0019049 | 3300044842 | Bacteria | 4035 |
| 332 | Ga0466957_0095174 | 3300044842 | Bacteria | 1870 |
| 333 | Ga0466960_0001372 | 3300044901 | Bacteria | 8857 |
| 334 | Ga0466960_0002684 | 3300044901 | Bacteria | 6720 |
| 335 | Ga0466960_0019278 | 3300044901 | Bacteria | 3003 |
| 336 | Ga0466960_0023568 | 3300044901 | Bacteria | 2765 |
| 337 | Ga0466960_0024727 | 3300044901 | Bacteria | 2712 |
| 338 | Ga0466960_0029336 | 3300044901 | Bacteria | 2524 |
| 339 | Ga0466960_0045547 | 3300044901 | Bacteria | 2096 |
| 340 | Ga0466960_0059116 | 3300044901 | Bacteria | 1874 |
| 341 | Ga0466960_0136096 | 3300044901 | Bacteria | 1301 |
| 342 | Ga0466960_0198658 | 3300044901 | Bacteria | 1094 |
| 343 | Ga0466958_0077679 | 3300045836 | Bacteria | 2039 |
| 344 | Ga0466958_0101733 | 3300045836 | Bacteria | 1787 |
| 345 | Ga0466958_0103871 | 3300045836 | Bacteria | 1769 |
| 346 | Ga0466967_0003488 | 3300045976 | Bacteria | 10275 |
| 347 | Ga0466967_0028947 | 3300045976 | Bacteria | 4631 |
| 348 | Ga0466967_0034192 | 3300045976 | Bacteria | 4312 |
| 349 | Ga0466967_0046129 | 3300045976 | Bacteria | 3792 |
| 350 | Ga0466967_0084263 | 3300045976 | Bacteria | 2876 |
| 351 | Ga0466967_0085270 | 3300045976 | Bacteria | 2859 |
| 352 | Ga0466967_0220877 | 3300045976 | Bacteria | 1800 |
| 353 | Ga0466967_0224841 | 3300045976 | Bacteria | 1785 |
| 354 | Ga0466967_0225781 | 3300045976 | Bacteria | 1781 |
| 355 | Ga0466967_0388412 | 3300045976 | Bacteria | 1356 |
| 356 | Ga0495603_0103390 | 3300046455 | Bacteria | 1663 |
| 357 | Ga0495629_0164137 | 3300046459 | Bacteria | 1542 |
| 358 | Ga0495641_0164518 | 3300046461 | Bacteria | 992 |
| 359 | Ga0495641_0273060 | 3300046461 | Bacteria | 761 |
| 360 | Ga0495651_0319092 | 3300046462 | Bacteria | 1036 |
| 361 | Ga0495653_0017538 | 3300046463 | Bacteria | 5822 |
| 362 | Ga0495664_0062303 | 3300046477 | Bacteria | 2221 |
| 363 | Ga0495596_0034653 | 3300046500 | Bacteria | 2004 |
| 364 | Ga0495608_0251230 | 3300046511 | Bacteria | 1103 |
| 365 | Ga0495644_0039219 | 3300046523 | Bacteria | 1786 |
| 366 | Ga0495657_0061722 | 3300046675 | Bacteria | 2479 |
| 367 | Ga0495647_0222655 | 3300046681 | Bacteria | 833 |
| 368 | Ga0495658_0084961 | 3300046683 | Bacteria | 1864 |
| 369 | Ga0495671_0077118 | 3300046692 | Bacteria | 1634 |
| 370 | Ga0495589_0198456 | 3300046794 | Bacteria | 948 |
| 371 | Ga0495600_0107231 | 3300046809 | Bacteria | 1820 |
| 372 | Ga0495581_0046769 | 3300047315 | Bacteria | 2501 |
| 373 | Ga0496100_0043012 | 3300048903 | Bacteria | 2887 |
| 374 | Ga0496101_0039473 | 3300048904 | Bacteria | 3358 |
| 375 | Ga0496101_0149391 | 3300048904 | Bacteria | 1786 |
| 376 | Ga0496101_0215556 | 3300048904 | Bacteria | 1488 |
| 377 | Ga0496102_0051965 | 3300048905 | Bacteria | 3733 |
| 378 | Ga0496102_0055607 | 3300048905 | Bacteria | 3608 |
| 379 | Ga0496102_0086726 | 3300048905 | Bacteria | 2891 |
| 380 | Ga0496102_0536791 | 3300048905 | Bacteria | 1092 |
| 381 | Ga0496103_0030042 | 3300048906 | Bacteria | 3305 |
| 382 | Ga0496103_0190501 | 3300048906 | Bacteria | 1319 |
| 383 | Ga0496103_0268800 | 3300048906 | Bacteria | 1097 |
| 384 | Ga0496104_0059290 | 3300048907 | Bacteria | 3623 |
| 385 | Ga0496104_0389314 | 3300048907 | Bacteria | 1306 |
| 386 | Ga0496105_0081263 | 3300048908 | Bacteria | 2677 |
| 387 | Ga0496105_0103485 | 3300048908 | Bacteria | 2351 |
| 388 | Ga0496106_0054783 | 3300048909 | Bacteria | 3013 |
| 389 | Ga0496106_0070919 | 3300048909 | Bacteria | 2662 |
| 390 | Ga0496106_0081019 | 3300048909 | Bacteria | 2493 |
| 391 | Ga0496106_0321298 | 3300048909 | Bacteria | 1242 |
| 392 | Ga0496107_0011346 | 3300048910 | Bacteria | 6202 |
| 393 | Ga0496107_0042190 | 3300048910 | Bacteria | 3276 |
| 394 | Ga0496107_0092651 | 3300048910 | Bacteria | 2209 |
| 395 | Ga0496107_0093956 | 3300048910 | Bacteria | 2194 |
| 396 | Ga0496107_0210502 | 3300048910 | Bacteria | 1446 |
| 397 | Ga0496107_0231398 | 3300048910 | Bacteria | 1375 |
| 398 | Ga0496107_0403157 | 3300048910 | Bacteria | 1017 |
| 399 | Ga0496108_0019847 | 3300048911 | Bacteria | 5521 |
| 400 | Ga0496108_0088959 | 3300048911 | Bacteria | 2624 |
| 401 | Ga0496108_0113147 | 3300048911 | Bacteria | 2323 |
| 402 | Ga0496108_0171702 | 3300048911 | Bacteria | 1876 |
| 403 | Ga0496108_0305217 | 3300048911 | Bacteria | 1387 |
| 404 | Ga0496109_0001848 | 3300048912 | Bacteria | 17542 |
| 405 | Ga0496109_0030687 | 3300048912 | Bacteria | 4818 |
| 406 | Ga0496109_0045919 | 3300048912 | Bacteria | 3966 |
| 407 | Ga0496109_0076871 | 3300048912 | Bacteria | 3071 |
| 408 | Ga0496109_0099082 | 3300048912 | Bacteria | 2703 |
| 409 | Ga0496109_0212032 | 3300048912 | Bacteria | 1821 |
| 410 | Ga0496109_0259866 | 3300048912 | Bacteria | 1636 |
| 411 | Ga0496109_0273441 | 3300048912 | Bacteria | 1592 |
| 412 | Ga0496110_0000438 | 3300048913 | Bacteria | 28365 |
| 413 | Ga0496110_0047351 | 3300048913 | Bacteria | 3764 |
| 414 | Ga0496110_0102306 | 3300048913 | Bacteria | 2569 |
| 415 | Ga0496110_0146635 | 3300048913 | Bacteria | 2135 |
| 416 | Ga0496110_0147503 | 3300048913 | Bacteria | 2129 |
| 417 | Ga0496110_0229547 | 3300048913 | Bacteria | 1688 |
| 418 | Ga0496110_0836022 | 3300048913 | Bacteria | 826 |
| 419 | Ga0496111_0000246 | 3300048914 | Bacteria | 26045 |
| 420 | Ga0496111_0257042 | 3300048914 | Bacteria | 1296 |
| 421 | Ga0496111_0273731 | 3300048914 | Bacteria | 1252 |
| 422 | Ga0496111_0284300 | 3300048914 | Bacteria | 1227 |
| 423 | Ga0496111_0293385 | 3300048914 | Bacteria | 1206 |
| 424 | Ga0496112_0039400 | 3300048915 | Bacteria | 4618 |
| 425 | Ga0496113_0056212 | 3300048916 | Bacteria | 2953 |
| 426 | Ga0496114_0018001 | 3300048917 | Bacteria | 5708 |
| 427 | Ga0496114_0037405 | 3300048917 | Bacteria | 4014 |
| 428 | Ga0496114_0192462 | 3300048917 | Bacteria | 1785 |
| 429 | Ga0496114_0192983 | 3300048917 | Bacteria | 1782 |
| 430 | Ga0496114_0212581 | 3300048917 | Bacteria | 1697 |
| 431 | Ga0496114_0345240 | 3300048917 | Bacteria | 1316 |
| 432 | Ga0496114_0362250 | 3300048917 | Bacteria | 1283 |
| 433 | Ga0496115_0060557 | 3300048918 | Bacteria | 3051 |
| 434 | Ga0496115_0137296 | 3300048918 | Bacteria | 2016 |
| 435 | Ga0496124_0451983 | 3300048927 | Bacteria | 876 |
| 436 | Ga0501031_0001961 | 3300049568 | Bacteria | 12980 |
| 437 | Ga0501031_0149775 | 3300049568 | Bacteria | 1524 |
| 438 | Ga0501031_0164917 | 3300049568 | Bacteria | 1448 |
| 439 | Ga0501031_0181203 | 3300049568 | Bacteria | 1376 |
| 440 | Ga0501031_0205874 | 3300049568 | Bacteria | 1283 |
| 441 | Ga0501032_0045072 | 3300049569 | Bacteria | 2984 |
| 442 | Ga0501032_0186680 | 3300049569 | Bacteria | 1356 |
| 443 | Ga0501036_0013310 | 3300049572 | Bacteria | 6831 |
| 444 | Ga0501036_0063706 | 3300049572 | Bacteria | 3121 |
| 445 | Ga0501036_0119864 | 3300049572 | Bacteria | 2222 |
| 446 | Ga0501036_0328493 | 3300049572 | Bacteria | 1278 |
| 447 | Ga0501036_0411370 | 3300049572 | Bacteria | 1128 |
| 448 | Ga0501037_0192583 | 3300049573 | Bacteria | 1443 |
| 449 | Ga0501038_0007064 | 3300049574 | Bacteria | 10368 |
| 450 | Ga0501038_0177431 | 3300049574 | Bacteria | 1721 |
| 451 | Ga0501038_0439983 | 3300049574 | Bacteria | 1004 |
| 452 | Ga0501039_0040825 | 3300049575 | Bacteria | 3581 |
| 453 | Ga0501039_0157616 | 3300049575 | Bacteria | 1784 |
| 454 | Ga0501039_0208392 | 3300049575 | Bacteria | 1537 |
| 455 | Ga0501039_0401384 | 3300049575 | Bacteria | 1077 |
| 456 | Ga0501040_0018654 | 3300049576 | Bacteria | 4607 |
| 457 | Ga0501040_0041916 | 3300049576 | Bacteria | 3118 |
| 458 | Ga0501040_0168679 | 3300049576 | Bacteria | 1549 |
| 459 | Ga0501040_0207100 | 3300049576 | Bacteria | 1394 |
| 460 | Ga0501041_0040923 | 3300049577 | Bacteria | 2814 |
| 461 | Ga0501041_0076312 | 3300049577 | Bacteria | 2062 |
| 462 | Ga0501041_0116133 | 3300049577 | Bacteria | 1662 |
| 463 | Ga0501041_0130438 | 3300049577 | Bacteria | 1566 |
| 464 | Ga0501042_0010304 | 3300049578 | Bacteria | 6258 |
| 465 | Ga0501042_0053350 | 3300049578 | Bacteria | 2885 |
| 466 | Ga0501042_0326546 | 3300049578 | Bacteria | 1109 |
| 467 | Ga0501042_0331142 | 3300049578 | Bacteria | 1101 |
| 468 | Ga0501046_0391267 | 3300049580 | Bacteria | 1005 |
| 469 | Ga0501047_0198292 | 3300049581 | Bacteria | 1869 |
| 470 | Ga0501048_0007429 | 3300049582 | Bacteria | 8308 |
| 471 | Ga0501048_0201750 | 3300049582 | Bacteria | 1410 |
| 472 | Ga0501067_0003422 | 3300049583 | Bacteria | 8733 |
| 473 | Ga0501067_0008354 | 3300049583 | Bacteria | 5749 |
| 474 | Ga0501067_0027357 | 3300049583 | Bacteria | 3159 |
| 475 | Ga0501067_0027542 | 3300049583 | Bacteria | 3149 |
| 476 | Ga0501067_0066762 | 3300049583 | Bacteria | 1991 |
| 477 | Ga0501067_0191062 | 3300049583 | Bacteria | 1140 |
| 478 | Ga0501068_0026468 | 3300049584 | Bacteria | 3417 |
| 479 | Ga0501068_0082125 | 3300049584 | Bacteria | 1979 |
| 480 | Ga0501068_0114980 | 3300049584 | Bacteria | 1675 |
| 481 | Ga0501069_0010830 | 3300049585 | Bacteria | 4833 |
| 482 | Ga0501069_0017617 | 3300049585 | Bacteria | 3848 |
| 483 | Ga0501069_0024402 | 3300049585 | Bacteria | 3298 |
| 484 | Ga0501069_0037769 | 3300049585 | Bacteria | 2665 |
| 485 | Ga0501069_0043649 | 3300049585 | Bacteria | 2482 |
| 486 | Ga0501069_0064897 | 3300049585 | Bacteria | 2041 |
| 487 | Ga0501069_0150117 | 3300049585 | Bacteria | 1339 |
| 488 | Ga0501070_0016018 | 3300049586 | Bacteria | 6300 |
| 489 | Ga0501070_0023600 | 3300049586 | Bacteria | 5153 |
| 490 | Ga0501070_0083816 | 3300049586 | Bacteria | 2639 |
| 491 | Ga0501070_0162560 | 3300049586 | Bacteria | 1840 |
| 492 | Ga0501070_0288987 | 3300049586 | Bacteria | 1336 |
| 493 | Ga0501070_0511145 | 3300049586 | Bacteria | 964 |
| 494 | Ga0501071_0000648 | 3300049587 | Bacteria | 18142 |
| 495 | Ga0501071_0019342 | 3300049587 | Bacteria | 4725 |
| 496 | Ga0501071_0058680 | 3300049587 | Bacteria | 2783 |
| 497 | Ga0501071_0110243 | 3300049587 | Bacteria | 2034 |
| 498 | Ga0501071_0242285 | 3300049587 | Bacteria | 1360 |
| 499 | Ga0501072_0031175 | 3300049588 | Bacteria | 4172 |
| 500 | Ga0501072_0052093 | 3300049588 | Bacteria | 3222 |
| 501 | Ga0501072_0073951 | 3300049588 | Bacteria | 2694 |
| 502 | Ga0501072_0163235 | 3300049588 | Bacteria | 1777 |
| 503 | Ga0501072_0233339 | 3300049588 | Bacteria | 1466 |
| 504 | Ga0501072_0505897 | 3300049588 | Bacteria | 955 |
| 505 | Ga0501073_0028245 | 3300049589 | Bacteria | 4008 |
| 506 | Ga0501074_0017320 | 3300049590 | Bacteria | 5227 |
| 507 | Ga0501074_0025864 | 3300049590 | Bacteria | 4258 |
| 508 | Ga0501075_0036912 | 3300049591 | Bacteria | 3648 |
| 509 | Ga0501075_0086217 | 3300049591 | Bacteria | 2379 |
| 510 | Ga0501075_0328266 | 3300049591 | Bacteria | 1166 |
| 511 | Ga0501076_0133424 | 3300049592 | Bacteria | 2015 |
| 512 | Ga0501076_0137478 | 3300049592 | Bacteria | 1984 |
| 513 | Ga0501076_0302535 | 3300049592 | Bacteria | 1311 |
| 514 | Ga0501077_0019583 | 3300049593 | Bacteria | 4279 |
| 515 | Ga0501079_0096833 | 3300049741 | Bacteria | 2287 |
| 516 | Ga0501079_0111593 | 3300049741 | Bacteria | 2125 |
| 517 | Ga0501079_0260094 | 3300049741 | Bacteria | 1356 |
| 518 | Ga0501080_0019670 | 3300049742 | Bacteria | 6254 |
| 519 | Ga0501080_0038093 | 3300049742 | Bacteria | 4490 |
| 520 | Ga0501081_0017290 | 3300049743 | Bacteria | 4771 |
| 521 | Ga0501083_0061607 | 3300049744 | Bacteria | 2504 |
| 522 | Ga0501035_0409583 | 3300049822 | Bacteria | 1127 |
| 523 | Ga0501044_0177300 | 3300049823 | Bacteria | 2100 |
| 524 | Ga0501045_0014555 | 3300049824 | Bacteria | 5576 |
| 525 | Ga0501045_0064402 | 3300049824 | Bacteria | 2691 |
| 526 | Ga0501045_0512735 | 3300049824 | Bacteria | 890 |
| 527 | nmdc:mga03n38_122626_c1 | 3300050490 | Bacteria | 1279 |
| 528 | nmdc:mga00v17_42417_c1 | 3300050491 | Bacteria | 2736 |
| 529 | nmdc:mga00v17_872_c1 | 3300050491 | Bacteria | 16296 |
| 530 | nmdc:mga0yw44_117146_c1 | 3300050492 | Bacteria | 1712 |
| 531 | nmdc:mga0yw44_238984_c1 | 3300050492 | Bacteria | 1207 |
| 532 | nmdc:mga0yw44_310496_c1 | 3300050492 | Bacteria | 1058 |
| 533 | nmdc:mga0yw44_626200_c1 | 3300050492 | Bacteria | 731 |
| 534 | nmdc:mga0yw44_64207_c1 | 3300050492 | Bacteria | 2259 |
| 535 | nmdc:mga0yw44_75681_c1 | 3300050492 | Bacteria | 2099 |
| 536 | nmdc:mga0yw44_85625_c1 | 3300050492 | Bacteria | 1983 |
| 537 | nmdc:mga06z11_144666_c1 | 3300050494 | Bacteria | 1346 |
| 538 | nmdc:mga06z11_248722_c1 | 3300050494 | Bacteria | 1046 |
| 539 | nmdc:mga05p37_54461_c1 | 3300050507 | Bacteria | 4922 |
| 540 | nmdc:mga09592_142579_c1 | 3300050508 | Bacteria | 2066 |
| 541 | nmdc:mga0qj67_76471_c1 | 3300050509 | Bacteria | 2678 |
| 542 | nmdc:mga06r32_11037_c1 | 3300050510 | Bacteria | 8132 |
| 543 | nmdc:mga0n895_432851_c1 | 3300050512 | Bacteria | 1329 |
| 544 | Ga0495595_0029296 | 3300053084 | Bacteria | 2463 |
| 545 | Ga0500556_0001381 | 3300053104 | Bacteria | 10603 |
| 546 | Ga0500559_0000108 | 3300053136 | Bacteria | 65474 |
| 547 | Ga0500573_0008453 | 3300053140 | Bacteria | 5669 |
| 548 | Ga0500573_0182036 | 3300053140 | Bacteria | 1129 |
| 549 | Ga0501084_0099312 | 3300054114 | Bacteria | 2444 |
| 550 | Ga0501084_0205572 | 3300054114 | Bacteria | 1662 |
| 551 | Ga0501084_0293123 | 3300054114 | Bacteria | 1374 |
| 552 | Ga0501082_0084393 | 3300060353 | Bacteria | 2739 |
| 553 | Ga0501082_0171559 | 3300060353 | Bacteria | 1886 |
| 554 | Ga0501082_0318346 | 3300060353 | Bacteria | 1355 |
| 555 | Ga0466962_0167589 | 3300061719 | Bacteria | 1069 |
| 556 | Ga0530510_0039616 | 3300061734 | Bacteria | 3402 |
| 557 | Ga0530510_0058178 | 3300061734 | Bacteria | 2795 |
| 558 | Ga0530510_0353399 | 3300061734 | Bacteria | 1104 |
| 559 | Ga0530510_0425818 | 3300061734 | Bacteria | 1002 |
| 560 | 2643824707 | 2643221561 | Bacteria | 4984412 |
| 561 | 2644093123 | 2643221615 | Bacteria | 5487866 |
| 562 | 2644322734 | 2643221657 | Bacteria | 5490246 |
| 563 | 2644535959 | 2643221696 | Bacteria | 5431823 |
| 564 | 2645721006 | 2643221961 | Bacteria | 3919167 |
| 565 | 2645723992 | 2643221962 | Bacteria | 3874254 |
| 566 | 2740168299 | 2739367898 | Bacteria | 4367674 |
| 567 | 2774395002 | 2773857762 | Bacteria | 5971770 |
| 568 | 2809194150 | 2808606439 | Bacteria | 5952208 |
| 569 | 2812348899 | 2811994878 | Bacteria | 5992952 |
| 570 | 2816421383 | 2816332119 | Bacteria | 8120218 |
| 571 | 2855388103 | 2855386786 | Bacteria | 4752232 |
| 572 | 2857484848 | 2857481737 | Bacteria | 4761446 |
| 573 | 2857713050 | 2857710386 | Bacteria | 3186771 |
| 574 | 2857713224 | 2857710386 | Bacteria | 3186771 |
| 575 | 2891331623 | 2891326441 | Bacteria | 6439512 |
| 576 | 2891973355 | 2891968417 | Bacteria | 5821697 |
| 577 | 2984593795 | 2984592036 | Bacteria | 3670284 |
| 578 | 8054614299 | 8054609563 | Bacteria | 5170090 |
| 579 | Ga0157370_10468089 | |||
| 580 | LJQas_1000791 | |||
| 581 | JGI24740J21852_10036647 | |||
| 582 | JGI24739J22299_10013863 | |||
| 583 | JGI24737J22298_10025395 | |||
| 584 | JGI24743J22301_10018582 | |||
| 585 | JGI24735J21928_10014255 | |||
| 586 | JGI24738J21930_10007114 | |||
| 587 | JGI24744J21845_10018865 | |||
| 588 | rootH1_10033679 | |||
| 589 | Ga0070658_10012041 | |||
| 590 | Ga0070658_10505716 | |||
| 591 | Ga0070683_100000595 | |||
| 592 | Ga0070683_100012197 | |||
| 593 | Ga0070683_100037631 | |||
| 594 | Ga0070683_100041635 | |||
| 595 | Ga0070683_100130019 | |||
| 596 | Ga0070670_100387936 | |||
| 597 | Ga0070670_100625124 | |||
| 598 | Ga0070670_100881955 | |||
| 599 | Ga0068869_100171711 | |||
| 600 | Ga0070680_100118850 | |||
| 601 | Ga0070682_100015284 | |||
| 602 | Ga0070682_100029105 | |||
| 603 | Ga0070682_100607112 | |||
| 604 | Ga0068868_100025987 | |||
| 605 | Ga0068868_100151465 | |||
| 606 | Ga0070660_100002926 | |||
| 607 | Ga0070660_100011911 | |||
| 608 | Ga0070660_100088149 | |||
| 609 | Ga0070689_100193700 | |||
| 610 | Ga0070689_100346052 | |||
| 611 | Ga0070689_100772468 | |||
| 612 | Ga0070691_10168528 | |||
| 613 | Ga0070692_10014250 | |||
| 614 | Ga0070668_100761363 | |||
| 615 | Ga0070675_100098169 | |||
| 616 | Ga0070675_100114144 | |||
| 617 | Ga0070671_100211431 | |||
| 618 | Ga0070659_100020178 | |||
| 619 | Ga0070659_100024773 | |||
| 620 | Ga0070659_100148721 | |||
| 621 | Ga0070701_10002803 | |||
| 622 | Ga0070705_100048323 | |||
| 623 | Ga0070700_100002994 | |||
| 624 | Ga0070708_100737323 | |||
| 625 | Ga0070663_100024332 | |||
| 626 | Ga0070663_100119239 | |||
| 627 | Ga0070678_100096083 | |||
| 628 | Ga0070662_100195647 | |||
| 629 | Ga0068867_100017253 | |||
| 630 | Ga0070685_10069957 | |||
| 631 | Ga0070685_10605446 | |||
| 632 | Ga0070698_100176599 | |||
| 633 | Ga0070679_100010575 | |||
| 634 | Ga0070679_100565992 | |||
| 635 | Ga0070684_100000974 | |||
| 636 | Ga0070684_100009885 | |||
| 637 | Ga0070684_100294162 | |||
| 638 | Ga0068853_100482372 | |||
| 639 | Ga0070672_100015637 | |||
| 640 | Ga0070672_100046394 | |||
| 641 | Ga0070665_100000516 | |||
| 642 | Ga0070665_100246302 | |||
| 643 | Ga0070665_100310459 | |||
| 644 | Ga0070665_100429596 | |||
| 645 | Ga0068855_100180464 | |||
| 646 | Ga0068855_100285540 | |||
| 647 | Ga0070664_100066246 | |||
| 648 | Ga0068857_100014792 | |||
| 649 | Ga0068857_100040714 | |||
| 650 | Ga0068857_100339275 | |||
| 651 | Ga0068854_100006406 | |||
| 652 | Ga0068854_100342829 | |||
| 653 | Ga0068856_100042280 | |||
| 654 | Ga0068856_100153878 | |||
| 655 | Ga0068856_100492075 | |||
| 656 | Ga0070702_100043945 | |||
| 657 | Ga0070702_100252106 | |||
| 658 | Ga0068852_100003904 | |||
| 659 | Ga0068852_101129532 | |||
| 660 | Ga0068864_100199078 | |||
| 661 | Ga0068866_10019767 | |||
| 662 | Ga0068861_100054547 | |||
| 663 | Ga0068861_100129888 | |||
| 664 | Ga0068861_100271266 | |||
| 665 | Ga0068861_100736895 | |||
| 666 | Ga0068870_10003570 | |||
| 667 | Ga0068870_10332628 | |||
| 668 | Ga0068858_100196592 | |||
| 669 | Ga0068860_100042829 | |||
| 670 | Ga0081455_10058888 | |||
| 671 | Ga0075365_10007089 | |||
| 672 | Ga0075365_10039452 | |||
| 673 | Ga0075365_10041806 | |||
| 674 | Ga0075365_10057946 | |||
| 675 | Ga0075365_10065030 | |||
| 676 | Ga0075365_10108524 | |||
| 677 | Ga0075365_10125073 | |||
| 678 | Ga0075365_10425168 | |||
| 679 | Ga0075363_100091457 | |||
| 680 | Ga0075363_100160136 | |||
| 681 | Ga0075364_10001229 | |||
| 682 | Ga0075364_10065945 | |||
| 683 | Ga0075367_10218376 | |||
| 684 | Ga0075367_10267550 | |||
| 685 | Ga0075367_10313692 | |||
| 686 | Ga0097621_100476148 | |||
| 687 | Ga0068871_100554854 | |||
| 688 | Ga0075428_100007431 | |||
| 689 | Ga0075430_100024364 | |||
| 690 | Ga0075431_100048400 | |||
| 691 | Ga0075434_100436787 | |||
| 692 | Ga0075429_100001474 | |||
| 693 | Ga0068865_100005614 | |||
| 694 | Ga0068865_100025261 | |||
| 695 | Ga0111539_10021329 | |||
| 696 | Ga0111539_11161145 | |||
| 697 | Ga0105245_10001045 | |||
| 698 | Ga0105245_10007753 | |||
| 699 | Ga0105245_10084004 | |||
| 700 | Ga0105245_10087710 | |||
| 701 | Ga0105245_10139465 | |||
| 702 | Ga0105245_10242202 | |||
| 703 | Ga0105245_10273607 | |||
| 704 | Ga0105245_10645013 | |||
| 705 | Ga0105245_10775499 | |||
| 706 | Ga0105245_11076291 | |||
| 707 | Ga0114129_10014918 | |||
| 708 | Ga0105243_10024814 | |||
| 709 | Ga0105243_10098791 | |||
| 710 | Ga0105243_10153711 | |||
| 711 | Ga0105243_10388028 | |||
| 712 | Ga0105242_10032078 | |||
| 713 | Ga0105248_10022398 | |||
| 714 | Ga0105248_10303636 | |||
| 715 | Ga0105237_10045893 | |||
| 716 | Ga0105237_10285199 | |||
| 717 | Ga0105238_10427852 | |||
| 718 | Ga0105249_10062657 | |||
| 719 | Ga0105249_10071230 | |||
| 720 | Ga0105239_10001253 | |||
| 721 | Ga0105239_10047815 | |||
| 722 | Ga0105239_10444357 | |||
| 723 | Ga0105246_10001941 | |||
| 724 | Ga0105246_10464207 | |||
| 725 | Ga0157347_1005872 | |||
| 726 | Ga0157369_10073863 | |||
| 727 | Ga0157369_10476402 | |||
| 728 | Ga0157369_10709809 | |||
| 729 | Ga0163162_10008748 | |||
| 730 | Ga0157372_10001487 | |||
| 731 | Ga0157372_10034370 | |||
| 732 | Ga0157372_10087006 | |||
| 733 | Ga0157372_10250364 | |||
| 734 | Ga0157375_10005304 | |||
| 735 | Ga0157375_10086415 | |||
| 736 | Ga0157375_10410612 | |||
| 737 | Ga0157375_10584273 | |||
| 738 | Ga0163163_10009412 | |||
| 739 | Ga0163163_10045024 | |||
| 740 | Ga0163163_10522754 | |||
| 741 | Ga0163163_10551117 | |||
| 742 | Ga0157380_10016669 | |||
| 743 | Ga0157380_10247126 | |||
| 744 | Ga0182008_10097869 | |||
| 745 | Ga0157377_10143626 | |||
| 746 | Ga0206356_11077315 | |||
| 747 | Ga0206354_10439127 | |||
| 748 | Ga0206354_10538880 | |||
| 749 | Ga0206353_11317060 | |||
| 750 | Ga0206353_11372022 | |||
| 751 | Ga0213875_10087306 | |||
| 752 | Ga0207688_10014383 | |||
| 753 | Ga0207688_10035351 | |||
| 754 | Ga0207688_10053836 | |||
| 755 | Ga0207647_10008168 | |||
| 756 | Ga0207647_10008361 | |||
| 757 | Ga0207647_10012175 | |||
| 758 | Ga0207647_10072862 | |||
| 759 | Ga0207643_10008822 | |||
| 760 | Ga0207643_10262587 | |||
| 761 | Ga0207705_10023738 | |||
| 762 | Ga0207705_10056034 | |||
| 763 | Ga0207705_10107277 | |||
| 764 | Ga0207707_10292551 | |||
| 765 | Ga0207660_10087023 | |||
| 766 | Ga0207660_10282300 | |||
| 767 | Ga0207662_10111434 | |||
| 768 | Ga0207662_10146221 | |||
| 769 | Ga0207657_10013097 | |||
| 770 | Ga0207657_10021223 | |||
| 771 | Ga0207657_10081092 | |||
| 772 | Ga0207652_10008481 | |||
| 773 | Ga0207652_10441579 | |||
| 774 | Ga0207650_10425177 | |||
| 775 | Ga0207650_10432025 | |||
| 776 | Ga0207687_10015542 | |||
| 777 | Ga0207687_10022089 | |||
| 778 | Ga0207687_10114603 | |||
| 779 | Ga0207687_10201545 | |||
| 780 | Ga0207687_10530354 | |||
| 781 | Ga0207664_10057761 | |||
| 782 | Ga0207690_10132474 | |||
| 783 | Ga0207690_10137466 | |||
| 784 | Ga0207690_10223288 | |||
| 785 | Ga0207706_10202620 | |||
| 786 | Ga0207686_10285312 | |||
| 787 | Ga0207686_10379063 | |||
| 788 | Ga0207709_10011977 | |||
| 789 | Ga0207709_10030469 | |||
| 790 | Ga0207670_10270564 | |||
| 791 | Ga0207704_10018812 | |||
| 792 | Ga0207691_10000686 | |||
| 793 | Ga0207691_10028755 | |||
| 794 | Ga0207661_10007993 | |||
| 795 | Ga0207661_10011183 | |||
| 796 | Ga0207661_10141448 | |||
| 797 | Ga0207661_10264137 | |||
| 798 | Ga0207679_10785599 | |||
| 799 | Ga0207651_10043631 | |||
| 800 | Ga0207668_10032799 | |||
| 801 | Ga0207640_10364073 | |||
| 802 | Ga0207658_10076599 | |||
| 803 | Ga0207677_10158824 | |||
| 804 | Ga0207677_10170227 | |||
| 805 | Ga0207703_10158393 | |||
| 806 | Ga0207639_10149050 | |||
| 807 | Ga0207678_10038799 | |||
| 808 | Ga0207678_10111013 | |||
| 809 | Ga0207708_10000075 | |||
| 810 | Ga0207708_10029802 | |||
| 811 | Ga0207702_10405204 | |||
| 812 | Ga0207641_10641209 | |||
| 813 | Ga0207648_10001457 | |||
| 814 | Ga0207676_10066644 | |||
| 815 | Ga0207676_10279493 | |||
| 816 | Ga0207674_10027968 | |||
| 817 | Ga0207674_10030347 | |||
| 818 | Ga0207674_10482800 | |||
| 819 | Ga0207675_100009073 | |||
| 820 | Ga0207675_100044193 | |||
| 821 | Ga0207675_100417073 | |||
| 822 | Ga0207675_100503640 | |||
| 823 | Ga0207683_10080639 | |||
| 824 | Ga0268266_10000509 | |||
| 825 | Ga0268266_10156872 | |||
| 826 | Ga0268266_10415023 | |||
| 827 | Ga0316181_1095490 | |||
| 828 | Ga0307408_100007224 | |||
| 829 | Ga0307508_10286375 | |||
| 830 | Ga0307405_10000853 | |||
| 831 | Ga0307413_10088322 | |||
| 832 | Ga0307413_10430331 | |||
| 833 | Ga0307410_10216131 | |||
| 834 | Ga0307410_10585046 | |||
| 835 | Ga0307406_10103478 | |||
| 836 | Ga0307407_10057303 | |||
| 837 | Ga0307407_10170651 | |||
| 838 | Ga0307412_10007210 | |||
| 839 | Ga0307412_10119820 | |||
| 840 | Ga0307409_100023586 | |||
| 841 | Ga0307409_100074287 | |||
| 842 | Ga0307409_100079690 | |||
| 843 | Ga0307409_100298910 | |||
| 844 | Ga0307416_100034486 | |||
| 845 | Ga0307416_100049371 | |||
| 846 | Ga0307416_100619996 | |||
| 847 | Ga0307414_10136962 | |||
| 848 | Ga0307414_10413993 | |||
| 849 | Ga0307414_10581096 | |||
| 850 | Ga0307411_10000384 | |||
| 851 | Ga0307415_100000246 | |||
| 852 | Ga0307415_100049725 | |||
| 853 | Ga0307415_100397686 | |||
| 854 | Ga0307507_10102394 | |||
| 855 | Ga0395899_0063780 | |||
| 856 | Ga0395899_0176406 | |||
| 857 | Ga0395900_0124415 | |||
| 858 | Ga0395898_0042111 | |||
| 859 | Ga0395898_0046260 | |||
| 860 | Ga0395905_0054079 | |||
| 861 | Ga0395905_0210677 | |||
| 862 | Ga0436364_0597294 | |||
| 863 | Ga0395901_0009942 | |||
| 864 | Ga0395901_0164323 | |||
| 865 | Ga0395901_0568881 | |||
| 866 | Ga0439438_047775 | |||
| 867 | Ga0439465_0083941 | |||
| 868 | Ga0451789_0306457 | |||
| 869 | Ga0451791_0569766 | |||
| 870 | Ga0451791_0692505 | |||
| 871 | Ga0451793_1711376 | |||
| 872 | Ga0451797_0187531 | |||
| 873 | Ga0451800_0541020 | |||
| 874 | Ga0451802_0759723 | |||
| 875 | Ga0451839_0271543 | |||
| 876 | Ga0451853_0892418 | |||
| 877 | Ga0451853_3034603 | |||
| 878 | Ga0466965_0007206 | |||
| 879 | Ga0466965_0058634 | |||
| 880 | Ga0466966_0097089 | |||
| 881 | Ga0466966_0139451 | |||
| 882 | Ga0466966_0256703 | |||
| 883 | Ga0466961_0034449 | |||
| 884 | Ga0466961_0051600 | |||
| 885 | Ga0466961_0088817 | |||
| 886 | Ga0466961_0251511 | |||
| 887 | Ga0466961_0360172 | |||
| 888 | Ga0466963_0006461 | |||
| 889 | Ga0466963_0014960 | |||
| 890 | Ga0466963_0016781 | |||
| 891 | Ga0466963_0026824 | |||
| 892 | Ga0466963_0066345 | |||
| 893 | Ga0466963_0080439 | |||
| 894 | Ga0466963_0385683 | |||
| 895 | Ga0466964_0007394 | |||
| 896 | Ga0466964_0008357 | |||
| 897 | Ga0466964_0197963 | |||
| 898 | Ga0466971_0005487 | |||
| 899 | Ga0466971_0090070 | |||
| 900 | Ga0466970_0007753 | |||
| 901 | Ga0466970_0012945 | |||
| 902 | Ga0466970_0054582 | |||
| 903 | Ga0466970_0075820 | |||
| 904 | Ga0466970_0092656 | |||
| 905 | Ga0466970_0109944 | |||
| 906 | Ga0466970_0110815 | |||
| 907 | Ga0466970_0205397 | |||
| 908 | Ga0466957_0017791 | |||
| 909 | Ga0466957_0019049 | |||
| 910 | Ga0466957_0095174 | |||
| 911 | Ga0466960_0001372 | |||
| 912 | Ga0466960_0002684 | |||
| 913 | Ga0466960_0019278 | |||
| 914 | Ga0466960_0023568 | |||
| 915 | Ga0466960_0024727 | |||
| 916 | Ga0466960_0029336 | |||
| 917 | Ga0466960_0045547 | |||
| 918 | Ga0466960_0059116 | |||
| 919 | Ga0466960_0136096 | |||
| 920 | Ga0466960_0198658 | |||
| 921 | Ga0466958_0077679 | |||
| 922 | Ga0466958_0101733 | |||
| 923 | Ga0466958_0103871 | |||
| 924 | Ga0466967_0003488 | |||
| 925 | Ga0466967_0028947 | |||
| 926 | Ga0466967_0034192 | |||
| 927 | Ga0466967_0046129 | |||
| 928 | Ga0466967_0084263 | |||
| 929 | Ga0466967_0085270 | |||
| 930 | Ga0466967_0220877 | |||
| 931 | Ga0466967_0224841 | |||
| 932 | Ga0466967_0225781 | |||
| 933 | Ga0466967_0388412 | |||
| 934 | Ga0495603_0103390 | |||
| 935 | Ga0495629_0164137 | |||
| 936 | Ga0495641_0164518 | |||
| 937 | Ga0495641_0273060 | |||
| 938 | Ga0495651_0319092 | |||
| 939 | Ga0495653_0017538 | |||
| 940 | Ga0495664_0062303 | |||
| 941 | Ga0495596_0034653 | |||
| 942 | Ga0495608_0251230 | |||
| 943 | Ga0495644_0039219 | |||
| 944 | Ga0495657_0061722 | |||
| 945 | Ga0495647_0222655 | |||
| 946 | Ga0495658_0084961 | |||
| 947 | Ga0495671_0077118 | |||
| 948 | Ga0495589_0198456 | |||
| 949 | Ga0495600_0107231 | |||
| 950 | Ga0495581_0046769 | |||
| 951 | Ga0496100_0043012 | |||
| 952 | Ga0496101_0039473 | |||
| 953 | Ga0496101_0149391 | |||
| 954 | Ga0496101_0215556 | |||
| 955 | Ga0496102_0051965 | |||
| 956 | Ga0496102_0055607 | |||
| 957 | Ga0496102_0086726 | |||
| 958 | Ga0496102_0536791 | |||
| 959 | Ga0496103_0030042 | |||
| 960 | Ga0496103_0190501 | |||
| 961 | Ga0496103_0268800 | |||
| 962 | Ga0496104_0059290 | |||
| 963 | Ga0496104_0389314 | |||
| 964 | Ga0496105_0081263 | |||
| 965 | Ga0496105_0103485 | |||
| 966 | Ga0496106_0054783 | |||
| 967 | Ga0496106_0070919 | |||
| 968 | Ga0496106_0081019 | |||
| 969 | Ga0496106_0321298 | |||
| 970 | Ga0496107_0011346 | |||
| 971 | Ga0496107_0042190 | |||
| 972 | Ga0496107_0092651 | |||
| 973 | Ga0496107_0093956 | |||
| 974 | Ga0496107_0210502 | |||
| 975 | Ga0496107_0231398 | |||
| 976 | Ga0496107_0403157 | |||
| 977 | Ga0496108_0019847 | |||
| 978 | Ga0496108_0088959 | |||
| 979 | Ga0496108_0113147 | |||
| 980 | Ga0496108_0171702 | |||
| 981 | Ga0496108_0305217 | |||
| 982 | Ga0496109_0001848 | |||
| 983 | Ga0496109_0030687 | |||
| 984 | Ga0496109_0045919 | |||
| 985 | Ga0496109_0076871 | |||
| 986 | Ga0496109_0099082 | |||
| 987 | Ga0496109_0212032 | |||
| 988 | Ga0496109_0259866 | |||
| 989 | Ga0496109_0273441 | |||
| 990 | Ga0496110_0000438 | |||
| 991 | Ga0496110_0047351 | |||
| 992 | Ga0496110_0102306 | |||
| 993 | Ga0496110_0146635 | |||
| 994 | Ga0496110_0147503 | |||
| 995 | Ga0496110_0229547 | |||
| 996 | Ga0496110_0836022 | |||
| 997 | Ga0496111_0000246 | |||
| 998 | Ga0496111_0257042 | |||
| 999 | Ga0496111_0273731 | |||
| 1000 | Ga0496111_0284300 | |||
| 1001 | Ga0496111_0293385 | |||
| 1002 | Ga0496112_0039400 | |||
| 1003 | Ga0496113_0056212 | |||
| 1004 | Ga0496114_0018001 | |||
| 1005 | Ga0496114_0037405 | |||
| 1006 | Ga0496114_0192462 | |||
| 1007 | Ga0496114_0192983 | |||
| 1008 | Ga0496114_0212581 | |||
| 1009 | Ga0496114_0345240 | |||
| 1010 | Ga0496114_0362250 | |||
| 1011 | Ga0496115_0060557 | |||
| 1012 | Ga0496115_0137296 | |||
| 1013 | Ga0496124_0451983 | |||
| 1014 | Ga0501031_0001961 | |||
| 1015 | Ga0501031_0149775 | |||
| 1016 | Ga0501031_0164917 | |||
| 1017 | Ga0501031_0181203 | |||
| 1018 | Ga0501031_0205874 | |||
| 1019 | Ga0501032_0045072 | |||
| 1020 | Ga0501032_0186680 | |||
| 1021 | Ga0501036_0013310 | |||
| 1022 | Ga0501036_0063706 | |||
| 1023 | Ga0501036_0119864 | |||
| 1024 | Ga0501036_0328493 | |||
| 1025 | Ga0501036_0411370 | |||
| 1026 | Ga0501037_0192583 | |||
| 1027 | Ga0501038_0007064 | |||
| 1028 | Ga0501038_0177431 | |||
| 1029 | Ga0501038_0439983 | |||
| 1030 | Ga0501039_0040825 | |||
| 1031 | Ga0501039_0157616 | |||
| 1032 | Ga0501039_0208392 | |||
| 1033 | Ga0501039_0401384 | |||
| 1034 | Ga0501040_0018654 | |||
| 1035 | Ga0501040_0041916 | |||
| 1036 | Ga0501040_0168679 | |||
| 1037 | Ga0501040_0207100 | |||
| 1038 | Ga0501041_0040923 | |||
| 1039 | Ga0501041_0076312 | |||
| 1040 | Ga0501041_0116133 | |||
| 1041 | Ga0501041_0130438 | |||
| 1042 | Ga0501042_0010304 | |||
| 1043 | Ga0501042_0053350 | |||
| 1044 | Ga0501042_0326546 | |||
| 1045 | Ga0501042_0331142 | |||
| 1046 | Ga0501046_0391267 | |||
| 1047 | Ga0501047_0198292 | |||
| 1048 | Ga0501048_0007429 | |||
| 1049 | Ga0501048_0201750 | |||
| 1050 | Ga0501067_0003422 | |||
| 1051 | Ga0501067_0008354 | |||
| 1052 | Ga0501067_0027357 | |||
| 1053 | Ga0501067_0027542 | |||
| 1054 | Ga0501067_0066762 | |||
| 1055 | Ga0501067_0191062 | |||
| 1056 | Ga0501068_0026468 | |||
| 1057 | Ga0501068_0082125 | |||
| 1058 | Ga0501068_0114980 | |||
| 1059 | Ga0501069_0010830 | |||
| 1060 | Ga0501069_0017617 | |||
| 1061 | Ga0501069_0024402 | |||
| 1062 | Ga0501069_0037769 | |||
| 1063 | Ga0501069_0043649 | |||
| 1064 | Ga0501069_0064897 | |||
| 1065 | Ga0501069_0150117 | |||
| 1066 | Ga0501070_0016018 | |||
| 1067 | Ga0501070_0023600 | |||
| 1068 | Ga0501070_0083816 | |||
| 1069 | Ga0501070_0162560 | |||
| 1070 | Ga0501070_0288987 | |||
| 1071 | Ga0501070_0511145 | |||
| 1072 | Ga0501071_0000648 | |||
| 1073 | Ga0501071_0019342 | |||
| 1074 | Ga0501071_0058680 | |||
| 1075 | Ga0501071_0110243 | |||
| 1076 | Ga0501071_0242285 | |||
| 1077 | Ga0501072_0031175 | |||
| 1078 | Ga0501072_0052093 | |||
| 1079 | Ga0501072_0073951 | |||
| 1080 | Ga0501072_0163235 | |||
| 1081 | Ga0501072_0233339 | |||
| 1082 | Ga0501072_0505897 | |||
| 1083 | Ga0501073_0028245 | |||
| 1084 | Ga0501074_0017320 | |||
| 1085 | Ga0501074_0025864 | |||
| 1086 | Ga0501075_0036912 | |||
| 1087 | Ga0501075_0086217 | |||
| 1088 | Ga0501075_0328266 | |||
| 1089 | Ga0501076_0133424 | |||
| 1090 | Ga0501076_0137478 | |||
| 1091 | Ga0501076_0302535 | |||
| 1092 | Ga0501077_0019583 | |||
| 1093 | Ga0501079_0096833 | |||
| 1094 | Ga0501079_0111593 | |||
| 1095 | Ga0501079_0260094 | |||
| 1096 | Ga0501080_0019670 | |||
| 1097 | Ga0501080_0038093 | |||
| 1098 | Ga0501081_0017290 | |||
| 1099 | Ga0501083_0061607 | |||
| 1100 | Ga0501035_0409583 | |||
| 1101 | Ga0501044_0177300 | |||
| 1102 | Ga0501045_0014555 | |||
| 1103 | Ga0501045_0064402 | |||
| 1104 | Ga0501045_0512735 | |||
| 1105 | nmdc:mga03n38_122626_c1 | |||
| 1106 | nmdc:mga00v17_42417_c1 | |||
| 1107 | nmdc:mga00v17_872_c1 | |||
| 1108 | nmdc:mga0yw44_117146_c1 | |||
| 1109 | nmdc:mga0yw44_238984_c1 | |||
| 1110 | nmdc:mga0yw44_310496_c1 | |||
| 1111 | nmdc:mga0yw44_626200_c1 | |||
| 1112 | nmdc:mga0yw44_64207_c1 | |||
| 1113 | nmdc:mga0yw44_75681_c1 | |||
| 1114 | nmdc:mga0yw44_85625_c1 | |||
| 1115 | nmdc:mga06z11_144666_c1 | |||
| 1116 | nmdc:mga06z11_248722_c1 | |||
| 1117 | nmdc:mga05p37_54461_c1 | |||
| 1118 | nmdc:mga09592_142579_c1 | |||
| 1119 | nmdc:mga0qj67_76471_c1 | |||
| 1120 | nmdc:mga06r32_11037_c1 | |||
| 1121 | nmdc:mga0n895_432851_c1 | |||
| 1122 | Ga0495595_0029296 | |||
| 1123 | Ga0500556_0001381 | |||
| 1124 | Ga0500559_0000108 | |||
| 1125 | Ga0500573_0008453 | |||
| 1126 | Ga0500573_0182036 | |||
| 1127 | Ga0501084_0099312 | |||
| 1128 | Ga0501084_0205572 | |||
| 1129 | Ga0501084_0293123 | |||
| 1130 | Ga0501082_0084393 | |||
| 1131 | Ga0501082_0171559 | |||
| 1132 | Ga0501082_0318346 | |||
| 1133 | Ga0466962_0167589 | |||
| 1134 | Ga0530510_0039616 | |||
| 1135 | Ga0530510_0058178 | |||
| 1136 | Ga0530510_0353399 | |||
| 1137 | Ga0530510_0425818 | |||
| 1138 | 2643824707 | |||
| 1139 | 2644093123 | |||
| 1140 | 2644322734 | |||
| 1141 | 2644535959 | |||
| 1142 | 2645721006 | |||
| 1143 | 2645723992 | |||
| 1144 | 2740168299 | |||
| 1145 | 2774395002 | |||
| 1146 | 2809194150 | |||
| 1147 | 2812348899 | |||
| 1148 | 2816421383 | |||
| 1149 | 2855388103 | |||
| 1150 | 2857484848 | |||
| 1151 | 2857713050 | |||
| 1152 | 2857713224 | |||
| 1153 | 2891331623 | |||
| 1154 | 2891973355 | |||
| 1155 | 2984593795 | |||
| 1156 | 8054614299 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy