F465726

General Info

Members Datasets Scaffolds Average Seq Length
578 268 1156 247

Family's Representative Sequence

Representative Sequence 3300013104|Ga0157370_10468089|Ga0157370_104680892
Length 273
Sequence MVVMDVGSWFRDAVLSGSLLLAVPVAVVAGLVSFFSPCVVPLLPGYLSYATGLSGSDLASARRGRMVLGSFLFVLGFTFVFVALGTLSGALGEWLFAYTHQISIVLGAITIVVGLAFLGFIPFLQRDVRVHRVPAVGLAAAPLLGVLFGLGWTPCIGPTLSAVQLLALHSGTAGRGALLSVFYSLGLGIPFILAGLMFRRMLGAVAWVRRHQVWVTRLGGAMLVVVGVLLVTGVWDQWVADLRSLVGGFSVVVGSLRHTALRTPVARPPHRRS

Samples

Sample ID Description Type Environment
1 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
2 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
62 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
63 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
78 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
89 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
132 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
133 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
134 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
135 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
136 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
137 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
138 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
139 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
140 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
141 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
142 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
143 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
144 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
145 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
146 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
147 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
148 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
149 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
150 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
151 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
152 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
153 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
154 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
155 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
156 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
157 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
158 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
159 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
160 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
161 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
162 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
163 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
164 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
165 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
166 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
167 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
168 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
169 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
170 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
171 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
174 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
177 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
184 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
185 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
186 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
190 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
191 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
192 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
193 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
194 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
195 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
196 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
197 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
198 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
201 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
202 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
203 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
217 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
218 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
219 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
222 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
223 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
224 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
225 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
226 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
227 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
228 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
229 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
230 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
231 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
235 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
243 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
244 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
248 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
249 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
250 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
251 2643221561 Nocardioides sp. Root151 Isolate Unclassified
252 2643221615 Nocardioides sp. Root224 Isolate Unclassified
253 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
254 2643221696 Nocardioides sp. Root140 Isolate Unclassified
255 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
256 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
257 2739367898 Nocardioides sp. CF479 Isolate Unclassified
258 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
259 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
260 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
261 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
262 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
263 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
264 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
265 2891326441 Actinokineospora pegani TRM65233 Isolate Unclassified
266 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
267 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
268 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.85
Metatranscriptomes 0.87
Isolates 3.29

Biome Distribution

Category Percentage (%)
Aerial Root 0.17
Bulb 0
Endosphere 5.36
Nodule 0.17
Rhizoplane 11.94
Rhizosphere 78.03
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157370_10468089 3300013104 Bacteria 1158
2 LJQas_1000791 3300000549 Bacteria 5002
3 JGI24740J21852_10036647 3300001979 Bacteria 1521
4 JGI24739J22299_10013863 3300001989 Bacteria 2936
5 JGI24737J22298_10025395 3300001990 Bacteria 1873
6 JGI24743J22301_10018582 3300001991 Bacteria 1315
7 JGI24735J21928_10014255 3300002067 Bacteria 2491
8 JGI24738J21930_10007114 3300002075 Bacteria 2596
9 JGI24744J21845_10018865 3300002077 Bacteria 1366
10 rootH1_10033679 3300003323 Bacteria 1710
11 Ga0070658_10012041 3300005327 Bacteria 6947
12 Ga0070658_10505716 3300005327 Bacteria 1044
13 Ga0070683_100000595 3300005329 Bacteria 25935
14 Ga0070683_100012197 3300005329 Bacteria 7460
15 Ga0070683_100037631 3300005329 Bacteria 4429
16 Ga0070683_100041635 3300005329 Bacteria 4227
17 Ga0070683_100130019 3300005329 Bacteria 2383
18 Ga0070670_100387936 3300005331 Bacteria 1231
19 Ga0070670_100625124 3300005331 Bacteria 965
20 Ga0070670_100881955 3300005331 Bacteria 810
21 Ga0068869_100171711 3300005334 Bacteria 1694
22 Ga0070680_100118850 3300005336 Bacteria 2205
23 Ga0070682_100015284 3300005337 Bacteria 4446
24 Ga0070682_100029105 3300005337 Bacteria 3325
25 Ga0070682_100607112 3300005337 Bacteria 865
26 Ga0068868_100025987 3300005338 Bacteria 4459
27 Ga0068868_100151465 3300005338 Bacteria 1910
28 Ga0070660_100002926 3300005339 Bacteria 11751
29 Ga0070660_100011911 3300005339 Bacteria 6202
30 Ga0070660_100088149 3300005339 Bacteria 2443
31 Ga0070689_100193700 3300005340 Bacteria 1656
32 Ga0070689_100346052 3300005340 Bacteria 1246
33 Ga0070689_100772468 3300005340 Bacteria 843
34 Ga0070691_10168528 3300005341 Bacteria 1133
35 Ga0070692_10014250 3300005345 Bacteria 3729
36 Ga0070668_100761363 3300005347 Bacteria 858
37 Ga0070675_100098169 3300005354 Bacteria 2463
38 Ga0070675_100114144 3300005354 Bacteria 2289
39 Ga0070671_100211431 3300005355 Bacteria 1645
40 Ga0070659_100020178 3300005366 Bacteria 5060
41 Ga0070659_100024773 3300005366 Bacteria 4602
42 Ga0070659_100148721 3300005366 Bacteria 1910
43 Ga0070701_10002803 3300005438 Bacteria 6777
44 Ga0070705_100048323 3300005440 Bacteria 2464
45 Ga0070700_100002994 3300005441 Bacteria 8672
46 Ga0070708_100737323 3300005445 Bacteria 927
47 Ga0070663_100024332 3300005455 Bacteria 4074
48 Ga0070663_100119239 3300005455 Bacteria 1991
49 Ga0070678_100096083 3300005456 Bacteria 2285
50 Ga0070662_100195647 3300005457 Bacteria 1601
51 Ga0068867_100017253 3300005459 Bacteria 5127
52 Ga0070685_10069957 3300005466 Bacteria 2077
53 Ga0070685_10605446 3300005466 Bacteria 789
54 Ga0070698_100176599 3300005471 Bacteria 2075
55 Ga0070679_100010575 3300005530 Bacteria 8755
56 Ga0070679_100565992 3300005530 Bacteria 1080
57 Ga0070684_100000974 3300005535 Bacteria 20418
58 Ga0070684_100009885 3300005535 Bacteria 7538
59 Ga0070684_100294162 3300005535 Bacteria 1489
60 Ga0068853_100482372 3300005539 Bacteria 1169
61 Ga0070672_100015637 3300005543 Bacteria 5413
62 Ga0070672_100046394 3300005543 Bacteria 3367
63 Ga0070665_100000516 3300005548 Bacteria 55112
64 Ga0070665_100246302 3300005548 Bacteria 1788
65 Ga0070665_100310459 3300005548 Bacteria 1581
66 Ga0070665_100429596 3300005548 Bacteria 1330
67 Ga0068855_100180464 3300005563 Bacteria 2387
68 Ga0068855_100285540 3300005563 Bacteria 1831
69 Ga0070664_100066246 3300005564 Bacteria 3084
70 Ga0068857_100014792 3300005577 Bacteria 6808
71 Ga0068857_100040714 3300005577 Bacteria 4121
72 Ga0068857_100339275 3300005577 Bacteria 1390
73 Ga0068854_100006406 3300005578 Bacteria 7488
74 Ga0068854_100342829 3300005578 Bacteria 1221
75 Ga0068856_100042280 3300005614 Bacteria 4482
76 Ga0068856_100153878 3300005614 Bacteria 2309
77 Ga0068856_100492075 3300005614 Bacteria 1247
78 Ga0070702_100043945 3300005615 Bacteria 2520
79 Ga0070702_100252106 3300005615 Bacteria 1197
80 Ga0068852_100003904 3300005616 Bacteria 10476
81 Ga0068852_101129532 3300005616 Bacteria 804
82 Ga0068864_100199078 3300005618 Bacteria 1839
83 Ga0068866_10019767 3300005718 Bacteria 3073
84 Ga0068861_100054547 3300005719 Bacteria 3045
85 Ga0068861_100129888 3300005719 Bacteria 2044
86 Ga0068861_100271266 3300005719 Bacteria 1457
87 Ga0068861_100736895 3300005719 Bacteria 919
88 Ga0068870_10003570 3300005840 Bacteria 6593
89 Ga0068870_10332628 3300005840 Bacteria 969
90 Ga0068858_100196592 3300005842 Bacteria 1906
91 Ga0068860_100042829 3300005843 Bacteria 4321
92 Ga0081455_10058888 3300005937 Bacteria 3247
93 Ga0075365_10007089 3300006038 Bacteria 6248
94 Ga0075365_10039452 3300006038 Bacteria 3075
95 Ga0075365_10041806 3300006038 Bacteria 2995
96 Ga0075365_10057946 3300006038 Bacteria 2578
97 Ga0075365_10065030 3300006038 Bacteria 2444
98 Ga0075365_10108524 3300006038 Bacteria 1906
99 Ga0075365_10125073 3300006038 Bacteria 1776
100 Ga0075365_10425168 3300006038 Bacteria 938
101 Ga0075363_100091457 3300006048 Bacteria 1675
102 Ga0075363_100160136 3300006048 Bacteria 1274
103 Ga0075364_10001229 3300006051 Bacteria 13785
104 Ga0075364_10065945 3300006051 Bacteria 2377
105 Ga0075367_10218376 3300006178 Bacteria 1193
106 Ga0075367_10267550 3300006178 Bacteria 1073
107 Ga0075367_10313692 3300006178 Bacteria 988
108 Ga0097621_100476148 3300006237 Bacteria 1128
109 Ga0068871_100554854 3300006358 Bacteria 1041
110 Ga0075428_100007431 3300006844 Bacteria 12139
111 Ga0075430_100024364 3300006846 Bacteria 5150
112 Ga0075431_100048400 3300006847 Bacteria 4385
113 Ga0075434_100436787 3300006871 Bacteria 1330
114 Ga0075429_100001474 3300006880 Bacteria 19345
115 Ga0068865_100005614 3300006881 Bacteria 7613
116 Ga0068865_100025261 3300006881 Bacteria 3905
117 Ga0111539_10021329 3300009094 Bacteria 7975
118 Ga0111539_11161145 3300009094 Bacteria 897
119 Ga0105245_10001045 3300009098 Bacteria 25060
120 Ga0105245_10007753 3300009098 Bacteria 9401
121 Ga0105245_10084004 3300009098 Bacteria 2916
122 Ga0105245_10087710 3300009098 Bacteria 2856
123 Ga0105245_10139465 3300009098 Bacteria 2282
124 Ga0105245_10242202 3300009098 Bacteria 1749
125 Ga0105245_10273607 3300009098 Bacteria 1648
126 Ga0105245_10645013 3300009098 Bacteria 1089
127 Ga0105245_10775499 3300009098 Bacteria 996
128 Ga0105245_11076291 3300009098 Bacteria 850
129 Ga0114129_10014918 3300009147 Bacteria 11069
130 Ga0105243_10024814 3300009148 Bacteria 4576
131 Ga0105243_10098791 3300009148 Bacteria 2419
132 Ga0105243_10153711 3300009148 Bacteria 1977
133 Ga0105243_10388028 3300009148 Bacteria 1294
134 Ga0105242_10032078 3300009176 Bacteria 4200
135 Ga0105248_10022398 3300009177 Bacteria 7009
136 Ga0105248_10303636 3300009177 Bacteria 1797
137 Ga0105237_10045893 3300009545 Bacteria 4397
138 Ga0105237_10285199 3300009545 Bacteria 1654
139 Ga0105238_10427852 3300009551 Bacteria 1319
140 Ga0105249_10062657 3300009553 Bacteria 3414
141 Ga0105249_10071230 3300009553 Bacteria 3211
142 Ga0105239_10001253 3300010375 Bacteria 34499
143 Ga0105239_10047815 3300010375 Bacteria 4689
144 Ga0105239_10444357 3300010375 Bacteria 1471
145 Ga0105246_10001941 3300011119 Bacteria 12477
146 Ga0105246_10464207 3300011119 Bacteria 1067
147 Ga0157347_1005872 3300012502 Unclassified 1185
148 Ga0157369_10073863 3300013105 Bacteria 3658
149 Ga0157369_10476402 3300013105 Bacteria 1292
150 Ga0157369_10709809 3300013105 Bacteria 1035
151 Ga0163162_10008748 3300013306 Bacteria 9849
152 Ga0157372_10001487 3300013307 Bacteria 25461
153 Ga0157372_10034370 3300013307 Bacteria 5573
154 Ga0157372_10087006 3300013307 Bacteria 3545
155 Ga0157372_10250364 3300013307 Bacteria 2056
156 Ga0157375_10005304 3300013308 Bacteria 11195
157 Ga0157375_10086415 3300013308 Bacteria 3187
158 Ga0157375_10410612 3300013308 Bacteria 1520
159 Ga0157375_10584273 3300013308 Bacteria 1277
160 Ga0163163_10009412 3300014325 Bacteria 8723
161 Ga0163163_10045024 3300014325 Bacteria 4330
162 Ga0163163_10522754 3300014325 Bacteria 1249
163 Ga0163163_10551117 3300014325 Bacteria 1216
164 Ga0157380_10016669 3300014326 Bacteria 5423
165 Ga0157380_10247126 3300014326 Bacteria 1612
166 Ga0182008_10097869 3300014497 Bacteria 1448
167 Ga0157377_10143626 3300014745 Bacteria 1469
168 Ga0206356_11077315 3300020070 Bacteria 1283
169 Ga0206354_10439127 3300020081 Bacteria 1048
170 Ga0206354_10538880 3300020081 Bacteria 1523
171 Ga0206353_11317060 3300020082 Bacteria 2021
172 Ga0206353_11372022 3300020082 Bacteria 1907
173 Ga0213875_10087306 3300021388 Bacteria 1455
174 Ga0207688_10014383 3300025901 Bacteria 4304
175 Ga0207688_10035351 3300025901 Bacteria 2768
176 Ga0207688_10053836 3300025901 Bacteria 2257
177 Ga0207647_10008168 3300025904 Bacteria 7522
178 Ga0207647_10008361 3300025904 Bacteria 7423
179 Ga0207647_10012175 3300025904 Bacteria 5999
180 Ga0207647_10072862 3300025904 Bacteria 2071
181 Ga0207643_10008822 3300025908 Bacteria 5411
182 Ga0207643_10262587 3300025908 Bacteria 1066
183 Ga0207705_10023738 3300025909 Bacteria 4375
184 Ga0207705_10056034 3300025909 Bacteria 2842
185 Ga0207705_10107277 3300025909 Bacteria 2060
186 Ga0207707_10292551 3300025912 Bacteria 1409
187 Ga0207660_10087023 3300025917 Bacteria 2308
188 Ga0207660_10282300 3300025917 Bacteria 1318
189 Ga0207662_10111434 3300025918 Bacteria 1706
190 Ga0207662_10146221 3300025918 Bacteria 1500
191 Ga0207657_10013097 3300025919 Bacteria 8150
192 Ga0207657_10021223 3300025919 Bacteria 6117
193 Ga0207657_10081092 3300025919 Bacteria 2726
194 Ga0207652_10008481 3300025921 Bacteria 8271
195 Ga0207652_10441579 3300025921 Bacteria 1173
196 Ga0207650_10425177 3300025925 Bacteria 1103
197 Ga0207650_10432025 3300025925 Bacteria 1094
198 Ga0207687_10015542 3300025927 Bacteria 4992
199 Ga0207687_10022089 3300025927 Bacteria 4233
200 Ga0207687_10114603 3300025927 Bacteria 2006
201 Ga0207687_10201545 3300025927 Bacteria 1556
202 Ga0207687_10530354 3300025927 Bacteria 986
203 Ga0207664_10057761 3300025929 Bacteria 3085
204 Ga0207690_10132474 3300025932 Bacteria 1826
205 Ga0207690_10137466 3300025932 Bacteria 1796
206 Ga0207690_10223288 3300025932 Unclassified 1442
207 Ga0207706_10202620 3300025933 Bacteria 1740
208 Ga0207686_10285312 3300025934 Bacteria 1220
209 Ga0207686_10379063 3300025934 Bacteria 1072
210 Ga0207709_10011977 3300025935 Bacteria 4781
211 Ga0207709_10030469 3300025935 Bacteria 3138
212 Ga0207670_10270564 3300025936 Bacteria 1320
213 Ga0207704_10018812 3300025938 Bacteria 3615
214 Ga0207691_10000686 3300025940 Bacteria 33446
215 Ga0207691_10028755 3300025940 Bacteria 5203
216 Ga0207661_10007993 3300025944 Bacteria 7542
217 Ga0207661_10011183 3300025944 Bacteria 6492
218 Ga0207661_10141448 3300025944 Bacteria 2071
219 Ga0207661_10264137 3300025944 Bacteria 1534
220 Ga0207679_10785599 3300025945 Bacteria 867
221 Ga0207651_10043631 3300025960 Bacteria 2995
222 Ga0207668_10032799 3300025972 Bacteria 3437
223 Ga0207640_10364073 3300025981 Bacteria 1166
224 Ga0207658_10076599 3300025986 Bacteria 2549
225 Ga0207677_10158824 3300026023 Bacteria 1754
226 Ga0207677_10170227 3300026023 Bacteria 1702
227 Ga0207703_10158393 3300026035 Bacteria 1981
228 Ga0207639_10149050 3300026041 Bacteria 1957
229 Ga0207678_10038799 3300026067 Bacteria 4136
230 Ga0207678_10111013 3300026067 Bacteria 2339
231 Ga0207708_10000075 3300026075 Bacteria 78540
232 Ga0207708_10029802 3300026075 Bacteria 4137
233 Ga0207702_10405204 3300026078 Bacteria 1316
234 Ga0207641_10641209 3300026088 Bacteria 1043
235 Ga0207648_10001457 3300026089 Bacteria 26045
236 Ga0207676_10066644 3300026095 Bacteria 2873
237 Ga0207676_10279493 3300026095 Bacteria 1515
238 Ga0207674_10027968 3300026116 Bacteria 5958
239 Ga0207674_10030347 3300026116 Bacteria 5684
240 Ga0207674_10482800 3300026116 Bacteria 1198
241 Ga0207675_100009073 3300026118 Bacteria 9333
242 Ga0207675_100044193 3300026118 Bacteria 4162
243 Ga0207675_100417073 3300026118 Bacteria 1325
244 Ga0207675_100503640 3300026118 Bacteria 1206
245 Ga0207683_10080639 3300026121 Bacteria 2887
246 Ga0268266_10000509 3300028379 Bacteria 54900
247 Ga0268266_10156872 3300028379 Bacteria 2057
248 Ga0268266_10415023 3300028379 Bacteria 1275
249 Ga0316181_1095490 3300030744 Bacteria 1630
250 Ga0307408_100007224 3300031548 Bacteria 7347
251 Ga0307508_10286375 3300031616 Bacteria 1241
252 Ga0307405_10000853 3300031731 Bacteria 12028
253 Ga0307413_10088322 3300031824 Bacteria 2010
254 Ga0307413_10430331 3300031824 Bacteria 1042
255 Ga0307410_10216131 3300031852 Bacteria 1472
256 Ga0307410_10585046 3300031852 Bacteria 929
257 Ga0307406_10103478 3300031901 Bacteria 1944
258 Ga0307407_10057303 3300031903 Bacteria 2259
259 Ga0307407_10170651 3300031903 Bacteria 1432
260 Ga0307412_10007210 3300031911 Bacteria 6309
261 Ga0307412_10119820 3300031911 Bacteria 1893
262 Ga0307409_100023586 3300031995 Bacteria 4268
263 Ga0307409_100074287 3300031995 Bacteria 2716
264 Ga0307409_100079690 3300031995 Bacteria 2640
265 Ga0307409_100298910 3300031995 Bacteria 1496
266 Ga0307416_100034486 3300032002 Bacteria 3852
267 Ga0307416_100049371 3300032002 Bacteria 3345
268 Ga0307416_100619996 3300032002 Bacteria 1163
269 Ga0307414_10136962 3300032004 Bacteria 1911
270 Ga0307414_10413993 3300032004 Bacteria 1174
271 Ga0307414_10581096 3300032004 Bacteria 1002
272 Ga0307411_10000384 3300032005 Bacteria 15110
273 Ga0307415_100000246 3300032126 Bacteria 23474
274 Ga0307415_100049725 3300032126 Bacteria 2836
275 Ga0307415_100397686 3300032126 Bacteria 1175
276 Ga0307507_10102394 3300033179 Bacteria 2389
277 Ga0395899_0063780 3300037312 Bacteria 2710
278 Ga0395899_0176406 3300037312 Bacteria 1502
279 Ga0395900_0124415 3300037418 Bacteria 2645
280 Ga0395898_0042111 3300037466 Bacteria 4507
281 Ga0395898_0046260 3300037466 Bacteria 4274
282 Ga0395905_0054079 3300037471 Bacteria 3757
283 Ga0395905_0210677 3300037471 Bacteria 1821
284 Ga0436364_0597294 3300037853 Bacteria 1910
285 Ga0395901_0009942 3300038443 Bacteria 9644
286 Ga0395901_0164323 3300038443 Bacteria 2331
287 Ga0395901_0568881 3300038443 Bacteria 1146
288 Ga0439438_047775 3300041405 Bacteria 1096
289 Ga0439465_0083941 3300041413 Bacteria 1083
290 Ga0451789_0306457 3300041443 Bacteria 1410
291 Ga0451791_0569766 3300041451 Bacteria 4253
292 Ga0451791_0692505 3300041451 Bacteria 3005
293 Ga0451793_1711376 3300041452 Bacteria 1709
294 Ga0451797_0187531 3300041453 Bacteria 1741
295 Ga0451800_0541020 3300041459 Bacteria 1198
296 Ga0451802_0759723 3300041460 Bacteria 1447
297 Ga0451839_0271543 3300041496 Bacteria 1306
298 Ga0451853_0892418 3300041512 Bacteria 2236
299 Ga0451853_3034603 3300041512 Bacteria 2647
300 Ga0466965_0007206 3300044683 Bacteria 5097
301 Ga0466965_0058634 3300044683 Bacteria 1920
302 Ga0466966_0097089 3300044684 Bacteria 1825
303 Ga0466966_0139451 3300044684 Bacteria 1482
304 Ga0466966_0256703 3300044684 Bacteria 1052
305 Ga0466961_0034449 3300044693 Bacteria 3251
306 Ga0466961_0051600 3300044693 Bacteria 2626
307 Ga0466961_0088817 3300044693 Bacteria 1952
308 Ga0466961_0251511 3300044693 Bacteria 1085
309 Ga0466961_0360172 3300044693 Bacteria 885
310 Ga0466963_0006461 3300044694 Bacteria 6934
311 Ga0466963_0014960 3300044694 Bacteria 4795
312 Ga0466963_0016781 3300044694 Bacteria 4557
313 Ga0466963_0026824 3300044694 Bacteria 3686
314 Ga0466963_0066345 3300044694 Bacteria 2421
315 Ga0466963_0080439 3300044694 Bacteria 2206
316 Ga0466963_0385683 3300044694 Bacteria 988
317 Ga0466964_0007394 3300044706 Bacteria 4108
318 Ga0466964_0008357 3300044706 Bacteria 3887
319 Ga0466964_0197963 3300044706 Bacteria 963
320 Ga0466971_0005487 3300044719 Bacteria 5506
321 Ga0466971_0090070 3300044719 Bacteria 1404
322 Ga0466970_0007753 3300044765 Bacteria 5386
323 Ga0466970_0012945 3300044765 Bacteria 4272
324 Ga0466970_0054582 3300044765 Bacteria 2134
325 Ga0466970_0075820 3300044765 Bacteria 1811
326 Ga0466970_0092656 3300044765 Bacteria 1641
327 Ga0466970_0109944 3300044765 Bacteria 1505
328 Ga0466970_0110815 3300044765 Bacteria 1499
329 Ga0466970_0205397 3300044765 Bacteria 1097
330 Ga0466957_0017791 3300044842 Bacteria 4169
331 Ga0466957_0019049 3300044842 Bacteria 4035
332 Ga0466957_0095174 3300044842 Bacteria 1870
333 Ga0466960_0001372 3300044901 Bacteria 8857
334 Ga0466960_0002684 3300044901 Bacteria 6720
335 Ga0466960_0019278 3300044901 Bacteria 3003
336 Ga0466960_0023568 3300044901 Bacteria 2765
337 Ga0466960_0024727 3300044901 Bacteria 2712
338 Ga0466960_0029336 3300044901 Bacteria 2524
339 Ga0466960_0045547 3300044901 Bacteria 2096
340 Ga0466960_0059116 3300044901 Bacteria 1874
341 Ga0466960_0136096 3300044901 Bacteria 1301
342 Ga0466960_0198658 3300044901 Bacteria 1094
343 Ga0466958_0077679 3300045836 Bacteria 2039
344 Ga0466958_0101733 3300045836 Bacteria 1787
345 Ga0466958_0103871 3300045836 Bacteria 1769
346 Ga0466967_0003488 3300045976 Bacteria 10275
347 Ga0466967_0028947 3300045976 Bacteria 4631
348 Ga0466967_0034192 3300045976 Bacteria 4312
349 Ga0466967_0046129 3300045976 Bacteria 3792
350 Ga0466967_0084263 3300045976 Bacteria 2876
351 Ga0466967_0085270 3300045976 Bacteria 2859
352 Ga0466967_0220877 3300045976 Bacteria 1800
353 Ga0466967_0224841 3300045976 Bacteria 1785
354 Ga0466967_0225781 3300045976 Bacteria 1781
355 Ga0466967_0388412 3300045976 Bacteria 1356
356 Ga0495603_0103390 3300046455 Bacteria 1663
357 Ga0495629_0164137 3300046459 Bacteria 1542
358 Ga0495641_0164518 3300046461 Bacteria 992
359 Ga0495641_0273060 3300046461 Bacteria 761
360 Ga0495651_0319092 3300046462 Bacteria 1036
361 Ga0495653_0017538 3300046463 Bacteria 5822
362 Ga0495664_0062303 3300046477 Bacteria 2221
363 Ga0495596_0034653 3300046500 Bacteria 2004
364 Ga0495608_0251230 3300046511 Bacteria 1103
365 Ga0495644_0039219 3300046523 Bacteria 1786
366 Ga0495657_0061722 3300046675 Bacteria 2479
367 Ga0495647_0222655 3300046681 Bacteria 833
368 Ga0495658_0084961 3300046683 Bacteria 1864
369 Ga0495671_0077118 3300046692 Bacteria 1634
370 Ga0495589_0198456 3300046794 Bacteria 948
371 Ga0495600_0107231 3300046809 Bacteria 1820
372 Ga0495581_0046769 3300047315 Bacteria 2501
373 Ga0496100_0043012 3300048903 Bacteria 2887
374 Ga0496101_0039473 3300048904 Bacteria 3358
375 Ga0496101_0149391 3300048904 Bacteria 1786
376 Ga0496101_0215556 3300048904 Bacteria 1488
377 Ga0496102_0051965 3300048905 Bacteria 3733
378 Ga0496102_0055607 3300048905 Bacteria 3608
379 Ga0496102_0086726 3300048905 Bacteria 2891
380 Ga0496102_0536791 3300048905 Bacteria 1092
381 Ga0496103_0030042 3300048906 Bacteria 3305
382 Ga0496103_0190501 3300048906 Bacteria 1319
383 Ga0496103_0268800 3300048906 Bacteria 1097
384 Ga0496104_0059290 3300048907 Bacteria 3623
385 Ga0496104_0389314 3300048907 Bacteria 1306
386 Ga0496105_0081263 3300048908 Bacteria 2677
387 Ga0496105_0103485 3300048908 Bacteria 2351
388 Ga0496106_0054783 3300048909 Bacteria 3013
389 Ga0496106_0070919 3300048909 Bacteria 2662
390 Ga0496106_0081019 3300048909 Bacteria 2493
391 Ga0496106_0321298 3300048909 Bacteria 1242
392 Ga0496107_0011346 3300048910 Bacteria 6202
393 Ga0496107_0042190 3300048910 Bacteria 3276
394 Ga0496107_0092651 3300048910 Bacteria 2209
395 Ga0496107_0093956 3300048910 Bacteria 2194
396 Ga0496107_0210502 3300048910 Bacteria 1446
397 Ga0496107_0231398 3300048910 Bacteria 1375
398 Ga0496107_0403157 3300048910 Bacteria 1017
399 Ga0496108_0019847 3300048911 Bacteria 5521
400 Ga0496108_0088959 3300048911 Bacteria 2624
401 Ga0496108_0113147 3300048911 Bacteria 2323
402 Ga0496108_0171702 3300048911 Bacteria 1876
403 Ga0496108_0305217 3300048911 Bacteria 1387
404 Ga0496109_0001848 3300048912 Bacteria 17542
405 Ga0496109_0030687 3300048912 Bacteria 4818
406 Ga0496109_0045919 3300048912 Bacteria 3966
407 Ga0496109_0076871 3300048912 Bacteria 3071
408 Ga0496109_0099082 3300048912 Bacteria 2703
409 Ga0496109_0212032 3300048912 Bacteria 1821
410 Ga0496109_0259866 3300048912 Bacteria 1636
411 Ga0496109_0273441 3300048912 Bacteria 1592
412 Ga0496110_0000438 3300048913 Bacteria 28365
413 Ga0496110_0047351 3300048913 Bacteria 3764
414 Ga0496110_0102306 3300048913 Bacteria 2569
415 Ga0496110_0146635 3300048913 Bacteria 2135
416 Ga0496110_0147503 3300048913 Bacteria 2129
417 Ga0496110_0229547 3300048913 Bacteria 1688
418 Ga0496110_0836022 3300048913 Bacteria 826
419 Ga0496111_0000246 3300048914 Bacteria 26045
420 Ga0496111_0257042 3300048914 Bacteria 1296
421 Ga0496111_0273731 3300048914 Bacteria 1252
422 Ga0496111_0284300 3300048914 Bacteria 1227
423 Ga0496111_0293385 3300048914 Bacteria 1206
424 Ga0496112_0039400 3300048915 Bacteria 4618
425 Ga0496113_0056212 3300048916 Bacteria 2953
426 Ga0496114_0018001 3300048917 Bacteria 5708
427 Ga0496114_0037405 3300048917 Bacteria 4014
428 Ga0496114_0192462 3300048917 Bacteria 1785
429 Ga0496114_0192983 3300048917 Bacteria 1782
430 Ga0496114_0212581 3300048917 Bacteria 1697
431 Ga0496114_0345240 3300048917 Bacteria 1316
432 Ga0496114_0362250 3300048917 Bacteria 1283
433 Ga0496115_0060557 3300048918 Bacteria 3051
434 Ga0496115_0137296 3300048918 Bacteria 2016
435 Ga0496124_0451983 3300048927 Bacteria 876
436 Ga0501031_0001961 3300049568 Bacteria 12980
437 Ga0501031_0149775 3300049568 Bacteria 1524
438 Ga0501031_0164917 3300049568 Bacteria 1448
439 Ga0501031_0181203 3300049568 Bacteria 1376
440 Ga0501031_0205874 3300049568 Bacteria 1283
441 Ga0501032_0045072 3300049569 Bacteria 2984
442 Ga0501032_0186680 3300049569 Bacteria 1356
443 Ga0501036_0013310 3300049572 Bacteria 6831
444 Ga0501036_0063706 3300049572 Bacteria 3121
445 Ga0501036_0119864 3300049572 Bacteria 2222
446 Ga0501036_0328493 3300049572 Bacteria 1278
447 Ga0501036_0411370 3300049572 Bacteria 1128
448 Ga0501037_0192583 3300049573 Bacteria 1443
449 Ga0501038_0007064 3300049574 Bacteria 10368
450 Ga0501038_0177431 3300049574 Bacteria 1721
451 Ga0501038_0439983 3300049574 Bacteria 1004
452 Ga0501039_0040825 3300049575 Bacteria 3581
453 Ga0501039_0157616 3300049575 Bacteria 1784
454 Ga0501039_0208392 3300049575 Bacteria 1537
455 Ga0501039_0401384 3300049575 Bacteria 1077
456 Ga0501040_0018654 3300049576 Bacteria 4607
457 Ga0501040_0041916 3300049576 Bacteria 3118
458 Ga0501040_0168679 3300049576 Bacteria 1549
459 Ga0501040_0207100 3300049576 Bacteria 1394
460 Ga0501041_0040923 3300049577 Bacteria 2814
461 Ga0501041_0076312 3300049577 Bacteria 2062
462 Ga0501041_0116133 3300049577 Bacteria 1662
463 Ga0501041_0130438 3300049577 Bacteria 1566
464 Ga0501042_0010304 3300049578 Bacteria 6258
465 Ga0501042_0053350 3300049578 Bacteria 2885
466 Ga0501042_0326546 3300049578 Bacteria 1109
467 Ga0501042_0331142 3300049578 Bacteria 1101
468 Ga0501046_0391267 3300049580 Bacteria 1005
469 Ga0501047_0198292 3300049581 Bacteria 1869
470 Ga0501048_0007429 3300049582 Bacteria 8308
471 Ga0501048_0201750 3300049582 Bacteria 1410
472 Ga0501067_0003422 3300049583 Bacteria 8733
473 Ga0501067_0008354 3300049583 Bacteria 5749
474 Ga0501067_0027357 3300049583 Bacteria 3159
475 Ga0501067_0027542 3300049583 Bacteria 3149
476 Ga0501067_0066762 3300049583 Bacteria 1991
477 Ga0501067_0191062 3300049583 Bacteria 1140
478 Ga0501068_0026468 3300049584 Bacteria 3417
479 Ga0501068_0082125 3300049584 Bacteria 1979
480 Ga0501068_0114980 3300049584 Bacteria 1675
481 Ga0501069_0010830 3300049585 Bacteria 4833
482 Ga0501069_0017617 3300049585 Bacteria 3848
483 Ga0501069_0024402 3300049585 Bacteria 3298
484 Ga0501069_0037769 3300049585 Bacteria 2665
485 Ga0501069_0043649 3300049585 Bacteria 2482
486 Ga0501069_0064897 3300049585 Bacteria 2041
487 Ga0501069_0150117 3300049585 Bacteria 1339
488 Ga0501070_0016018 3300049586 Bacteria 6300
489 Ga0501070_0023600 3300049586 Bacteria 5153
490 Ga0501070_0083816 3300049586 Bacteria 2639
491 Ga0501070_0162560 3300049586 Bacteria 1840
492 Ga0501070_0288987 3300049586 Bacteria 1336
493 Ga0501070_0511145 3300049586 Bacteria 964
494 Ga0501071_0000648 3300049587 Bacteria 18142
495 Ga0501071_0019342 3300049587 Bacteria 4725
496 Ga0501071_0058680 3300049587 Bacteria 2783
497 Ga0501071_0110243 3300049587 Bacteria 2034
498 Ga0501071_0242285 3300049587 Bacteria 1360
499 Ga0501072_0031175 3300049588 Bacteria 4172
500 Ga0501072_0052093 3300049588 Bacteria 3222
501 Ga0501072_0073951 3300049588 Bacteria 2694
502 Ga0501072_0163235 3300049588 Bacteria 1777
503 Ga0501072_0233339 3300049588 Bacteria 1466
504 Ga0501072_0505897 3300049588 Bacteria 955
505 Ga0501073_0028245 3300049589 Bacteria 4008
506 Ga0501074_0017320 3300049590 Bacteria 5227
507 Ga0501074_0025864 3300049590 Bacteria 4258
508 Ga0501075_0036912 3300049591 Bacteria 3648
509 Ga0501075_0086217 3300049591 Bacteria 2379
510 Ga0501075_0328266 3300049591 Bacteria 1166
511 Ga0501076_0133424 3300049592 Bacteria 2015
512 Ga0501076_0137478 3300049592 Bacteria 1984
513 Ga0501076_0302535 3300049592 Bacteria 1311
514 Ga0501077_0019583 3300049593 Bacteria 4279
515 Ga0501079_0096833 3300049741 Bacteria 2287
516 Ga0501079_0111593 3300049741 Bacteria 2125
517 Ga0501079_0260094 3300049741 Bacteria 1356
518 Ga0501080_0019670 3300049742 Bacteria 6254
519 Ga0501080_0038093 3300049742 Bacteria 4490
520 Ga0501081_0017290 3300049743 Bacteria 4771
521 Ga0501083_0061607 3300049744 Bacteria 2504
522 Ga0501035_0409583 3300049822 Bacteria 1127
523 Ga0501044_0177300 3300049823 Bacteria 2100
524 Ga0501045_0014555 3300049824 Bacteria 5576
525 Ga0501045_0064402 3300049824 Bacteria 2691
526 Ga0501045_0512735 3300049824 Bacteria 890
527 nmdc:mga03n38_122626_c1 3300050490 Bacteria 1279
528 nmdc:mga00v17_42417_c1 3300050491 Bacteria 2736
529 nmdc:mga00v17_872_c1 3300050491 Bacteria 16296
530 nmdc:mga0yw44_117146_c1 3300050492 Bacteria 1712
531 nmdc:mga0yw44_238984_c1 3300050492 Bacteria 1207
532 nmdc:mga0yw44_310496_c1 3300050492 Bacteria 1058
533 nmdc:mga0yw44_626200_c1 3300050492 Bacteria 731
534 nmdc:mga0yw44_64207_c1 3300050492 Bacteria 2259
535 nmdc:mga0yw44_75681_c1 3300050492 Bacteria 2099
536 nmdc:mga0yw44_85625_c1 3300050492 Bacteria 1983
537 nmdc:mga06z11_144666_c1 3300050494 Bacteria 1346
538 nmdc:mga06z11_248722_c1 3300050494 Bacteria 1046
539 nmdc:mga05p37_54461_c1 3300050507 Bacteria 4922
540 nmdc:mga09592_142579_c1 3300050508 Bacteria 2066
541 nmdc:mga0qj67_76471_c1 3300050509 Bacteria 2678
542 nmdc:mga06r32_11037_c1 3300050510 Bacteria 8132
543 nmdc:mga0n895_432851_c1 3300050512 Bacteria 1329
544 Ga0495595_0029296 3300053084 Bacteria 2463
545 Ga0500556_0001381 3300053104 Bacteria 10603
546 Ga0500559_0000108 3300053136 Bacteria 65474
547 Ga0500573_0008453 3300053140 Bacteria 5669
548 Ga0500573_0182036 3300053140 Bacteria 1129
549 Ga0501084_0099312 3300054114 Bacteria 2444
550 Ga0501084_0205572 3300054114 Bacteria 1662
551 Ga0501084_0293123 3300054114 Bacteria 1374
552 Ga0501082_0084393 3300060353 Bacteria 2739
553 Ga0501082_0171559 3300060353 Bacteria 1886
554 Ga0501082_0318346 3300060353 Bacteria 1355
555 Ga0466962_0167589 3300061719 Bacteria 1069
556 Ga0530510_0039616 3300061734 Bacteria 3402
557 Ga0530510_0058178 3300061734 Bacteria 2795
558 Ga0530510_0353399 3300061734 Bacteria 1104
559 Ga0530510_0425818 3300061734 Bacteria 1002
560 2643824707 2643221561 Bacteria 4984412
561 2644093123 2643221615 Bacteria 5487866
562 2644322734 2643221657 Bacteria 5490246
563 2644535959 2643221696 Bacteria 5431823
564 2645721006 2643221961 Bacteria 3919167
565 2645723992 2643221962 Bacteria 3874254
566 2740168299 2739367898 Bacteria 4367674
567 2774395002 2773857762 Bacteria 5971770
568 2809194150 2808606439 Bacteria 5952208
569 2812348899 2811994878 Bacteria 5992952
570 2816421383 2816332119 Bacteria 8120218
571 2855388103 2855386786 Bacteria 4752232
572 2857484848 2857481737 Bacteria 4761446
573 2857713050 2857710386 Bacteria 3186771
574 2857713224 2857710386 Bacteria 3186771
575 2891331623 2891326441 Bacteria 6439512
576 2891973355 2891968417 Bacteria 5821697
577 2984593795 2984592036 Bacteria 3670284
578 8054614299 8054609563 Bacteria 5170090
579 Ga0157370_10468089
580 LJQas_1000791
581 JGI24740J21852_10036647
582 JGI24739J22299_10013863
583 JGI24737J22298_10025395
584 JGI24743J22301_10018582
585 JGI24735J21928_10014255
586 JGI24738J21930_10007114
587 JGI24744J21845_10018865
588 rootH1_10033679
589 Ga0070658_10012041
590 Ga0070658_10505716
591 Ga0070683_100000595
592 Ga0070683_100012197
593 Ga0070683_100037631
594 Ga0070683_100041635
595 Ga0070683_100130019
596 Ga0070670_100387936
597 Ga0070670_100625124
598 Ga0070670_100881955
599 Ga0068869_100171711
600 Ga0070680_100118850
601 Ga0070682_100015284
602 Ga0070682_100029105
603 Ga0070682_100607112
604 Ga0068868_100025987
605 Ga0068868_100151465
606 Ga0070660_100002926
607 Ga0070660_100011911
608 Ga0070660_100088149
609 Ga0070689_100193700
610 Ga0070689_100346052
611 Ga0070689_100772468
612 Ga0070691_10168528
613 Ga0070692_10014250
614 Ga0070668_100761363
615 Ga0070675_100098169
616 Ga0070675_100114144
617 Ga0070671_100211431
618 Ga0070659_100020178
619 Ga0070659_100024773
620 Ga0070659_100148721
621 Ga0070701_10002803
622 Ga0070705_100048323
623 Ga0070700_100002994
624 Ga0070708_100737323
625 Ga0070663_100024332
626 Ga0070663_100119239
627 Ga0070678_100096083
628 Ga0070662_100195647
629 Ga0068867_100017253
630 Ga0070685_10069957
631 Ga0070685_10605446
632 Ga0070698_100176599
633 Ga0070679_100010575
634 Ga0070679_100565992
635 Ga0070684_100000974
636 Ga0070684_100009885
637 Ga0070684_100294162
638 Ga0068853_100482372
639 Ga0070672_100015637
640 Ga0070672_100046394
641 Ga0070665_100000516
642 Ga0070665_100246302
643 Ga0070665_100310459
644 Ga0070665_100429596
645 Ga0068855_100180464
646 Ga0068855_100285540
647 Ga0070664_100066246
648 Ga0068857_100014792
649 Ga0068857_100040714
650 Ga0068857_100339275
651 Ga0068854_100006406
652 Ga0068854_100342829
653 Ga0068856_100042280
654 Ga0068856_100153878
655 Ga0068856_100492075
656 Ga0070702_100043945
657 Ga0070702_100252106
658 Ga0068852_100003904
659 Ga0068852_101129532
660 Ga0068864_100199078
661 Ga0068866_10019767
662 Ga0068861_100054547
663 Ga0068861_100129888
664 Ga0068861_100271266
665 Ga0068861_100736895
666 Ga0068870_10003570
667 Ga0068870_10332628
668 Ga0068858_100196592
669 Ga0068860_100042829
670 Ga0081455_10058888
671 Ga0075365_10007089
672 Ga0075365_10039452
673 Ga0075365_10041806
674 Ga0075365_10057946
675 Ga0075365_10065030
676 Ga0075365_10108524
677 Ga0075365_10125073
678 Ga0075365_10425168
679 Ga0075363_100091457
680 Ga0075363_100160136
681 Ga0075364_10001229
682 Ga0075364_10065945
683 Ga0075367_10218376
684 Ga0075367_10267550
685 Ga0075367_10313692
686 Ga0097621_100476148
687 Ga0068871_100554854
688 Ga0075428_100007431
689 Ga0075430_100024364
690 Ga0075431_100048400
691 Ga0075434_100436787
692 Ga0075429_100001474
693 Ga0068865_100005614
694 Ga0068865_100025261
695 Ga0111539_10021329
696 Ga0111539_11161145
697 Ga0105245_10001045
698 Ga0105245_10007753
699 Ga0105245_10084004
700 Ga0105245_10087710
701 Ga0105245_10139465
702 Ga0105245_10242202
703 Ga0105245_10273607
704 Ga0105245_10645013
705 Ga0105245_10775499
706 Ga0105245_11076291
707 Ga0114129_10014918
708 Ga0105243_10024814
709 Ga0105243_10098791
710 Ga0105243_10153711
711 Ga0105243_10388028
712 Ga0105242_10032078
713 Ga0105248_10022398
714 Ga0105248_10303636
715 Ga0105237_10045893
716 Ga0105237_10285199
717 Ga0105238_10427852
718 Ga0105249_10062657
719 Ga0105249_10071230
720 Ga0105239_10001253
721 Ga0105239_10047815
722 Ga0105239_10444357
723 Ga0105246_10001941
724 Ga0105246_10464207
725 Ga0157347_1005872
726 Ga0157369_10073863
727 Ga0157369_10476402
728 Ga0157369_10709809
729 Ga0163162_10008748
730 Ga0157372_10001487
731 Ga0157372_10034370
732 Ga0157372_10087006
733 Ga0157372_10250364
734 Ga0157375_10005304
735 Ga0157375_10086415
736 Ga0157375_10410612
737 Ga0157375_10584273
738 Ga0163163_10009412
739 Ga0163163_10045024
740 Ga0163163_10522754
741 Ga0163163_10551117
742 Ga0157380_10016669
743 Ga0157380_10247126
744 Ga0182008_10097869
745 Ga0157377_10143626
746 Ga0206356_11077315
747 Ga0206354_10439127
748 Ga0206354_10538880
749 Ga0206353_11317060
750 Ga0206353_11372022
751 Ga0213875_10087306
752 Ga0207688_10014383
753 Ga0207688_10035351
754 Ga0207688_10053836
755 Ga0207647_10008168
756 Ga0207647_10008361
757 Ga0207647_10012175
758 Ga0207647_10072862
759 Ga0207643_10008822
760 Ga0207643_10262587
761 Ga0207705_10023738
762 Ga0207705_10056034
763 Ga0207705_10107277
764 Ga0207707_10292551
765 Ga0207660_10087023
766 Ga0207660_10282300
767 Ga0207662_10111434
768 Ga0207662_10146221
769 Ga0207657_10013097
770 Ga0207657_10021223
771 Ga0207657_10081092
772 Ga0207652_10008481
773 Ga0207652_10441579
774 Ga0207650_10425177
775 Ga0207650_10432025
776 Ga0207687_10015542
777 Ga0207687_10022089
778 Ga0207687_10114603
779 Ga0207687_10201545
780 Ga0207687_10530354
781 Ga0207664_10057761
782 Ga0207690_10132474
783 Ga0207690_10137466
784 Ga0207690_10223288
785 Ga0207706_10202620
786 Ga0207686_10285312
787 Ga0207686_10379063
788 Ga0207709_10011977
789 Ga0207709_10030469
790 Ga0207670_10270564
791 Ga0207704_10018812
792 Ga0207691_10000686
793 Ga0207691_10028755
794 Ga0207661_10007993
795 Ga0207661_10011183
796 Ga0207661_10141448
797 Ga0207661_10264137
798 Ga0207679_10785599
799 Ga0207651_10043631
800 Ga0207668_10032799
801 Ga0207640_10364073
802 Ga0207658_10076599
803 Ga0207677_10158824
804 Ga0207677_10170227
805 Ga0207703_10158393
806 Ga0207639_10149050
807 Ga0207678_10038799
808 Ga0207678_10111013
809 Ga0207708_10000075
810 Ga0207708_10029802
811 Ga0207702_10405204
812 Ga0207641_10641209
813 Ga0207648_10001457
814 Ga0207676_10066644
815 Ga0207676_10279493
816 Ga0207674_10027968
817 Ga0207674_10030347
818 Ga0207674_10482800
819 Ga0207675_100009073
820 Ga0207675_100044193
821 Ga0207675_100417073
822 Ga0207675_100503640
823 Ga0207683_10080639
824 Ga0268266_10000509
825 Ga0268266_10156872
826 Ga0268266_10415023
827 Ga0316181_1095490
828 Ga0307408_100007224
829 Ga0307508_10286375
830 Ga0307405_10000853
831 Ga0307413_10088322
832 Ga0307413_10430331
833 Ga0307410_10216131
834 Ga0307410_10585046
835 Ga0307406_10103478
836 Ga0307407_10057303
837 Ga0307407_10170651
838 Ga0307412_10007210
839 Ga0307412_10119820
840 Ga0307409_100023586
841 Ga0307409_100074287
842 Ga0307409_100079690
843 Ga0307409_100298910
844 Ga0307416_100034486
845 Ga0307416_100049371
846 Ga0307416_100619996
847 Ga0307414_10136962
848 Ga0307414_10413993
849 Ga0307414_10581096
850 Ga0307411_10000384
851 Ga0307415_100000246
852 Ga0307415_100049725
853 Ga0307415_100397686
854 Ga0307507_10102394
855 Ga0395899_0063780
856 Ga0395899_0176406
857 Ga0395900_0124415
858 Ga0395898_0042111
859 Ga0395898_0046260
860 Ga0395905_0054079
861 Ga0395905_0210677
862 Ga0436364_0597294
863 Ga0395901_0009942
864 Ga0395901_0164323
865 Ga0395901_0568881
866 Ga0439438_047775
867 Ga0439465_0083941
868 Ga0451789_0306457
869 Ga0451791_0569766
870 Ga0451791_0692505
871 Ga0451793_1711376
872 Ga0451797_0187531
873 Ga0451800_0541020
874 Ga0451802_0759723
875 Ga0451839_0271543
876 Ga0451853_0892418
877 Ga0451853_3034603
878 Ga0466965_0007206
879 Ga0466965_0058634
880 Ga0466966_0097089
881 Ga0466966_0139451
882 Ga0466966_0256703
883 Ga0466961_0034449
884 Ga0466961_0051600
885 Ga0466961_0088817
886 Ga0466961_0251511
887 Ga0466961_0360172
888 Ga0466963_0006461
889 Ga0466963_0014960
890 Ga0466963_0016781
891 Ga0466963_0026824
892 Ga0466963_0066345
893 Ga0466963_0080439
894 Ga0466963_0385683
895 Ga0466964_0007394
896 Ga0466964_0008357
897 Ga0466964_0197963
898 Ga0466971_0005487
899 Ga0466971_0090070
900 Ga0466970_0007753
901 Ga0466970_0012945
902 Ga0466970_0054582
903 Ga0466970_0075820
904 Ga0466970_0092656
905 Ga0466970_0109944
906 Ga0466970_0110815
907 Ga0466970_0205397
908 Ga0466957_0017791
909 Ga0466957_0019049
910 Ga0466957_0095174
911 Ga0466960_0001372
912 Ga0466960_0002684
913 Ga0466960_0019278
914 Ga0466960_0023568
915 Ga0466960_0024727
916 Ga0466960_0029336
917 Ga0466960_0045547
918 Ga0466960_0059116
919 Ga0466960_0136096
920 Ga0466960_0198658
921 Ga0466958_0077679
922 Ga0466958_0101733
923 Ga0466958_0103871
924 Ga0466967_0003488
925 Ga0466967_0028947
926 Ga0466967_0034192
927 Ga0466967_0046129
928 Ga0466967_0084263
929 Ga0466967_0085270
930 Ga0466967_0220877
931 Ga0466967_0224841
932 Ga0466967_0225781
933 Ga0466967_0388412
934 Ga0495603_0103390
935 Ga0495629_0164137
936 Ga0495641_0164518
937 Ga0495641_0273060
938 Ga0495651_0319092
939 Ga0495653_0017538
940 Ga0495664_0062303
941 Ga0495596_0034653
942 Ga0495608_0251230
943 Ga0495644_0039219
944 Ga0495657_0061722
945 Ga0495647_0222655
946 Ga0495658_0084961
947 Ga0495671_0077118
948 Ga0495589_0198456
949 Ga0495600_0107231
950 Ga0495581_0046769
951 Ga0496100_0043012
952 Ga0496101_0039473
953 Ga0496101_0149391
954 Ga0496101_0215556
955 Ga0496102_0051965
956 Ga0496102_0055607
957 Ga0496102_0086726
958 Ga0496102_0536791
959 Ga0496103_0030042
960 Ga0496103_0190501
961 Ga0496103_0268800
962 Ga0496104_0059290
963 Ga0496104_0389314
964 Ga0496105_0081263
965 Ga0496105_0103485
966 Ga0496106_0054783
967 Ga0496106_0070919
968 Ga0496106_0081019
969 Ga0496106_0321298
970 Ga0496107_0011346
971 Ga0496107_0042190
972 Ga0496107_0092651
973 Ga0496107_0093956
974 Ga0496107_0210502
975 Ga0496107_0231398
976 Ga0496107_0403157
977 Ga0496108_0019847
978 Ga0496108_0088959
979 Ga0496108_0113147
980 Ga0496108_0171702
981 Ga0496108_0305217
982 Ga0496109_0001848
983 Ga0496109_0030687
984 Ga0496109_0045919
985 Ga0496109_0076871
986 Ga0496109_0099082
987 Ga0496109_0212032
988 Ga0496109_0259866
989 Ga0496109_0273441
990 Ga0496110_0000438
991 Ga0496110_0047351
992 Ga0496110_0102306
993 Ga0496110_0146635
994 Ga0496110_0147503
995 Ga0496110_0229547
996 Ga0496110_0836022
997 Ga0496111_0000246
998 Ga0496111_0257042
999 Ga0496111_0273731
1000 Ga0496111_0284300
1001 Ga0496111_0293385
1002 Ga0496112_0039400
1003 Ga0496113_0056212
1004 Ga0496114_0018001
1005 Ga0496114_0037405
1006 Ga0496114_0192462
1007 Ga0496114_0192983
1008 Ga0496114_0212581
1009 Ga0496114_0345240
1010 Ga0496114_0362250
1011 Ga0496115_0060557
1012 Ga0496115_0137296
1013 Ga0496124_0451983
1014 Ga0501031_0001961
1015 Ga0501031_0149775
1016 Ga0501031_0164917
1017 Ga0501031_0181203
1018 Ga0501031_0205874
1019 Ga0501032_0045072
1020 Ga0501032_0186680
1021 Ga0501036_0013310
1022 Ga0501036_0063706
1023 Ga0501036_0119864
1024 Ga0501036_0328493
1025 Ga0501036_0411370
1026 Ga0501037_0192583
1027 Ga0501038_0007064
1028 Ga0501038_0177431
1029 Ga0501038_0439983
1030 Ga0501039_0040825
1031 Ga0501039_0157616
1032 Ga0501039_0208392
1033 Ga0501039_0401384
1034 Ga0501040_0018654
1035 Ga0501040_0041916
1036 Ga0501040_0168679
1037 Ga0501040_0207100
1038 Ga0501041_0040923
1039 Ga0501041_0076312
1040 Ga0501041_0116133
1041 Ga0501041_0130438
1042 Ga0501042_0010304
1043 Ga0501042_0053350
1044 Ga0501042_0326546
1045 Ga0501042_0331142
1046 Ga0501046_0391267
1047 Ga0501047_0198292
1048 Ga0501048_0007429
1049 Ga0501048_0201750
1050 Ga0501067_0003422
1051 Ga0501067_0008354
1052 Ga0501067_0027357
1053 Ga0501067_0027542
1054 Ga0501067_0066762
1055 Ga0501067_0191062
1056 Ga0501068_0026468
1057 Ga0501068_0082125
1058 Ga0501068_0114980
1059 Ga0501069_0010830
1060 Ga0501069_0017617
1061 Ga0501069_0024402
1062 Ga0501069_0037769
1063 Ga0501069_0043649
1064 Ga0501069_0064897
1065 Ga0501069_0150117
1066 Ga0501070_0016018
1067 Ga0501070_0023600
1068 Ga0501070_0083816
1069 Ga0501070_0162560
1070 Ga0501070_0288987
1071 Ga0501070_0511145
1072 Ga0501071_0000648
1073 Ga0501071_0019342
1074 Ga0501071_0058680
1075 Ga0501071_0110243
1076 Ga0501071_0242285
1077 Ga0501072_0031175
1078 Ga0501072_0052093
1079 Ga0501072_0073951
1080 Ga0501072_0163235
1081 Ga0501072_0233339
1082 Ga0501072_0505897
1083 Ga0501073_0028245
1084 Ga0501074_0017320
1085 Ga0501074_0025864
1086 Ga0501075_0036912
1087 Ga0501075_0086217
1088 Ga0501075_0328266
1089 Ga0501076_0133424
1090 Ga0501076_0137478
1091 Ga0501076_0302535
1092 Ga0501077_0019583
1093 Ga0501079_0096833
1094 Ga0501079_0111593
1095 Ga0501079_0260094
1096 Ga0501080_0019670
1097 Ga0501080_0038093
1098 Ga0501081_0017290
1099 Ga0501083_0061607
1100 Ga0501035_0409583
1101 Ga0501044_0177300
1102 Ga0501045_0014555
1103 Ga0501045_0064402
1104 Ga0501045_0512735
1105 nmdc:mga03n38_122626_c1
1106 nmdc:mga00v17_42417_c1
1107 nmdc:mga00v17_872_c1
1108 nmdc:mga0yw44_117146_c1
1109 nmdc:mga0yw44_238984_c1
1110 nmdc:mga0yw44_310496_c1
1111 nmdc:mga0yw44_626200_c1
1112 nmdc:mga0yw44_64207_c1
1113 nmdc:mga0yw44_75681_c1
1114 nmdc:mga0yw44_85625_c1
1115 nmdc:mga06z11_144666_c1
1116 nmdc:mga06z11_248722_c1
1117 nmdc:mga05p37_54461_c1
1118 nmdc:mga09592_142579_c1
1119 nmdc:mga0qj67_76471_c1
1120 nmdc:mga06r32_11037_c1
1121 nmdc:mga0n895_432851_c1
1122 Ga0495595_0029296
1123 Ga0500556_0001381
1124 Ga0500559_0000108
1125 Ga0500573_0008453
1126 Ga0500573_0182036
1127 Ga0501084_0099312
1128 Ga0501084_0205572
1129 Ga0501084_0293123
1130 Ga0501082_0084393
1131 Ga0501082_0171559
1132 Ga0501082_0318346
1133 Ga0466962_0167589
1134 Ga0530510_0039616
1135 Ga0530510_0058178
1136 Ga0530510_0353399
1137 Ga0530510_0425818
1138 2643824707
1139 2644093123
1140 2644322734
1141 2644535959
1142 2645721006
1143 2645723992
1144 2740168299
1145 2774395002
1146 2809194150
1147 2812348899
1148 2816421383
1149 2855388103
1150 2857484848
1151 2857713050
1152 2857713224
1153 2891331623
1154 2891973355
1155 2984593795
1156 8054614299

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02683

DsbD

Cytochrome C biogenesis protein transmembrane region

26

232

0.95

Map