F465622

General Info

Members Datasets Scaffolds Average Seq Length
577 266 577 243

Family's Representative Sequence

Representative Sequence 3300025908|Ga0207643_10075020|Ga0207643_100750203
Length 281
Sequence MKAPMTLAPQSSAPSQNRQIGALRNAFCHCSPSVARDAETPPWTQGSHALRNSRGGHSPDVLDAVRVCVEAGAPGITVHPRADRRHITPEDVRAIATYLRANASGVEYNIEGDPRPELLALVDEVRPDQVTLVPVVPGEITSQAGWQPGPATESLPSVIARCHDRKIRVSLFVDAVGDPIRWAASVGADRVELYTEPFARAFDRGPDLGRRAFAPYADAARLAHSLGLGVNAGHDLDLSNLTIFRDLPHLDEVSIGHAIMSRALFVGLSTVVREYLEVLAG

Samples

Sample ID Description Type Environment
1 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
77 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
78 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
79 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
112 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
179 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
180 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
181 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
182 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
183 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
184 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
185 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
186 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
187 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
188 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
189 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
193 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
194 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
195 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
203 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
204 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
205 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
206 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
207 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
210 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
217 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
220 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
224 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
225 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
226 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
227 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
228 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
229 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
230 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
238 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
239 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
240 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
245 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
246 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
247 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
248 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
249 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
250 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
264 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
265 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.35
Nodule 0
Rhizoplane 2.08
Rhizosphere 96.01
Stem 0
Stem Tuber 0
Unclassified 1.56

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24751J29686_10002368 3300002459 Bacteria 3804
2 rootL2_10035444 3300003322 Bacteria 2364
3 rootL2_10274380 3300003322 Bacteria 4343
4 JGI25160J50197_1002111 3300003354 Bacteria 9446
5 Ga0065712_10084035 3300005290 Bacteria 2794
6 Ga0065715_10043379 3300005293 Bacteria 1267
7 Ga0065707_10279465 3300005295 Bacteria 1051
8 Ga0070658_10041296 3300005327 Bacteria 3721
9 Ga0070676_10002816 3300005328 Bacteria 8992
10 Ga0070676_10073669 3300005328 Bacteria 2055
11 Ga0070676_10096956 3300005328 Bacteria 1816
12 Ga0070676_10502458 3300005328 Unclassified 861
13 Ga0070683_100002966 3300005329 Bacteria 13606
14 Ga0070683_100012813 3300005329 Bacteria 7296
15 Ga0070683_100143433 3300005329 Unclassified 2263
16 Ga0070683_100182911 3300005329 Bacteria 1990
17 Ga0070683_100708431 3300005329 Bacteria 964
18 Ga0070690_100071089 3300005330 Bacteria 2261
19 Ga0070670_100067008 3300005331 Bacteria 3081
20 Ga0070670_100118519 3300005331 Bacteria 2283
21 Ga0070670_100405534 3300005331 Bacteria 1204
22 Ga0070670_100911973 3300005331 Bacteria 797
23 Ga0068869_100058530 3300005334 Bacteria 2818
24 Ga0068869_100350498 3300005334 Unclassified 1203
25 Ga0068869_100358608 3300005334 Bacteria 1190
26 Ga0070666_10047534 3300005335 Bacteria 2881
27 Ga0070666_10110598 3300005335 Unclassified 1900
28 Ga0070666_10165995 3300005335 Bacteria 1544
29 Ga0070680_100000254 3300005336 Bacteria 35204
30 Ga0070680_100428118 3300005336 Unclassified 1129
31 Ga0070682_100006080 3300005337 Bacteria 6757
32 Ga0068868_100016854 3300005338 Bacteria 5434
33 Ga0068868_100064499 3300005338 Bacteria 2908
34 Ga0068868_100100530 3300005338 Bacteria 2340
35 Ga0068868_100156497 3300005338 Bacteria 1880
36 Ga0068868_100185931 3300005338 Bacteria 1726
37 Ga0068868_100286298 3300005338 Unclassified 1396
38 Ga0070660_100001772 3300005339 Bacteria 14830
39 Ga0070660_100088915 3300005339 Bacteria 2433
40 Ga0070689_100054536 3300005340 Bacteria 3095
41 Ga0070691_10015269 3300005341 Bacteria 3528
42 Ga0070691_10016504 3300005341 Bacteria 3393
43 Ga0070687_100221673 3300005343 Bacteria 1159
44 Ga0070661_100052436 3300005344 Bacteria 2986
45 Ga0070692_10285905 3300005345 Bacteria 1001
46 Ga0070668_100024997 3300005347 Bacteria 4527
47 Ga0070669_100004492 3300005353 Bacteria 10060
48 Ga0070669_100174395 3300005353 Bacteria 1678
49 Ga0070675_100036897 3300005354 Bacteria 3979
50 Ga0070675_100082595 3300005354 Bacteria 2681
51 Ga0070675_100225845 3300005354 Bacteria 1632
52 Ga0070675_100605499 3300005354 Bacteria 994
53 Ga0070671_100014962 3300005355 Bacteria 6267
54 Ga0070671_100060627 3300005355 Bacteria 3150
55 Ga0070671_100103512 3300005355 Unclassified 2388
56 Ga0070671_100333511 3300005355 Unclassified 1293
57 Ga0070674_100003729 3300005356 Bacteria 8591
58 Ga0070674_100084615 3300005356 Bacteria 2275
59 Ga0070674_100455287 3300005356 Bacteria 1057
60 Ga0070673_100015038 3300005364 Bacteria 5417
61 Ga0070673_100046645 3300005364 Bacteria 3367
62 Ga0070673_100058295 3300005364 Bacteria 3052
63 Ga0070673_100233351 3300005364 Bacteria 1597
64 Ga0070673_100297465 3300005364 Bacteria 1420
65 Ga0070688_100012008 3300005365 Bacteria 4839
66 Ga0070688_100059486 3300005365 Bacteria 2410
67 Ga0070659_100002181 3300005366 Bacteria 13938
68 Ga0070659_100027999 3300005366 Bacteria 4347
69 Ga0070709_10027040 3300005434 Bacteria 3408
70 Ga0070713_100058942 3300005436 Bacteria 3204
71 Ga0070713_100881147 3300005436 Unclassified 860
72 Ga0070701_10127810 3300005438 Bacteria 1440
73 Ga0070711_100403212 3300005439 Bacteria 1110
74 Ga0070705_100005869 3300005440 Bacteria 6004
75 Ga0070705_100024102 3300005440 Bacteria 3279
76 Ga0070700_100001692 3300005441 Bacteria 11067
77 Ga0070708_100041425 3300005445 Bacteria 4037
78 Ga0070678_100535128 3300005456 Bacteria 1038
79 Ga0070662_100004442 3300005457 Bacteria 8869
80 Ga0070662_100093263 3300005457 Bacteria 2265
81 Ga0070662_100666902 3300005457 Bacteria 878
82 Ga0070681_10256868 3300005458 Bacteria 1659
83 Ga0070681_10366477 3300005458 Unclassified 1351
84 Ga0068867_100005839 3300005459 Bacteria 8731
85 Ga0070706_100237712 3300005467 Bacteria 1701
86 Ga0070707_100038086 3300005468 Bacteria 4592
87 Ga0070707_100110951 3300005468 Bacteria 2660
88 Ga0070707_100268227 3300005468 Bacteria 1660
89 Ga0070698_100002918 3300005471 Bacteria 18812
90 Ga0070698_100075010 3300005471 Bacteria 3387
91 Ga0070698_100310416 3300005471 Bacteria 1508
92 Ga0070699_100008796 3300005518 Bacteria 8751
93 Ga0070699_100091830 3300005518 Bacteria 2655
94 Ga0070699_100097317 3300005518 Bacteria 2578
95 Ga0070699_100144377 3300005518 Bacteria 2103
96 Ga0070699_100363363 3300005518 Bacteria 1305
97 Ga0070679_100016193 3300005530 Bacteria 7182
98 Ga0070684_100001674 3300005535 Bacteria 16106
99 Ga0070684_100116546 3300005535 Unclassified 2399
100 Ga0068853_100039206 3300005539 Bacteria 4040
101 Ga0068853_100414104 3300005539 Bacteria 1263
102 Ga0070672_100187253 3300005543 Bacteria 1727
103 Ga0070672_100329184 3300005543 Bacteria 1299
104 Ga0070672_100440642 3300005543 Bacteria 1121
105 Ga0070686_100052771 3300005544 Bacteria 2594
106 Ga0070686_100060682 3300005544 Bacteria 2441
107 Ga0070695_100006551 3300005545 Bacteria 6880
108 Ga0070695_100077779 3300005545 Bacteria 2187
109 Ga0070696_100013306 3300005546 Bacteria 5520
110 Ga0070665_100003124 3300005548 Bacteria 17837
111 Ga0070665_100006541 3300005548 Bacteria 11841
112 Ga0070665_100087579 3300005548 Unclassified 3120
113 Ga0070665_100367794 3300005548 Bacteria 1444
114 Ga0070704_100030248 3300005549 Bacteria 3627
115 Ga0070704_100115752 3300005549 Bacteria 2049
116 Ga0070704_100581553 3300005549 Bacteria 982
117 Ga0068855_100007886 3300005563 Bacteria 12858
118 Ga0070664_100086526 3300005564 Unclassified 2708
119 Ga0070664_100215797 3300005564 Bacteria 1715
120 Ga0070664_100546315 3300005564 Bacteria 1071
121 Ga0068857_100051642 3300005577 Bacteria 3649
122 Ga0068857_100134888 3300005577 Bacteria 2229
123 Ga0068857_100185418 3300005577 Unclassified 1894
124 Ga0068854_100033809 3300005578 Bacteria 3566
125 Ga0068854_100036394 3300005578 Bacteria 3450
126 Ga0068856_100041951 3300005614 Bacteria 4499
127 Ga0068856_100050346 3300005614 Bacteria 4106
128 Ga0068856_100892252 3300005614 Bacteria 908
129 Ga0070702_100009974 3300005615 Bacteria 4663
130 Ga0070702_100066009 3300005615 Bacteria 2121
131 Ga0068852_100000811 3300005616 Bacteria 20584
132 Ga0068852_100009402 3300005616 Bacteria 7260
133 Ga0068852_100373705 3300005616 Bacteria 1397
134 Ga0068859_100131882 3300005617 Bacteria 2571
135 Ga0068859_100196275 3300005617 Bacteria 2103
136 Ga0068859_100234600 3300005617 Bacteria 1923
137 Ga0068859_100281800 3300005617 Unclassified 1755
138 Ga0068859_100281977 3300005617 Bacteria 1754
139 Ga0068859_100386005 3300005617 Unclassified 1496
140 Ga0068864_100016207 3300005618 Bacteria 6204
141 Ga0068864_100073845 3300005618 Bacteria 2974
142 Ga0068864_100118824 3300005618 Bacteria 2361
143 Ga0068864_100197899 3300005618 Bacteria 1845
144 Ga0068866_10046104 3300005718 Bacteria 2190
145 Ga0068861_100002556 3300005719 Bacteria 11896
146 Ga0068861_100028165 3300005719 Bacteria 4099
147 Ga0068861_100120815 3300005719 Bacteria 2113
148 Ga0068861_100362675 3300005719 Bacteria 1275
149 Ga0068861_100526907 3300005719 Unclassified 1072
150 Ga0068851_10038483 3300005834 Unclassified 2400
151 Ga0068851_10059149 3300005834 Bacteria 1960
152 Ga0068863_100002234 3300005841 Bacteria 19218
153 Ga0068863_100296503 3300005841 Bacteria 1568
154 Ga0068858_100001888 3300005842 Bacteria 21404
155 Ga0068858_100041463 3300005842 Bacteria 4267
156 Ga0068858_100070477 3300005842 Bacteria 3241
157 Ga0068858_100105571 3300005842 Bacteria 2629
158 Ga0068858_100692206 3300005842 Unclassified 992
159 Ga0068860_100047704 3300005843 Bacteria 4082
160 Ga0068860_100052055 3300005843 Bacteria 3895
161 Ga0068862_100004461 3300005844 Bacteria 11803
162 Ga0068862_100006527 3300005844 Bacteria 9682
163 Ga0081455_10088391 3300005937 Bacteria 2518
164 Ga0081539_10000534 3300005985 Bacteria 78990
165 Ga0097621_100001463 3300006237 Bacteria 16164
166 Ga0097621_100408735 3300006237 Bacteria 1216
167 Ga0097621_100427420 3300006237 Bacteria 1190
168 Ga0068871_100011799 3300006358 Bacteria 6422
169 Ga0068871_100062999 3300006358 Bacteria 3032
170 Ga0068871_100067410 3300006358 Bacteria 2936
171 Ga0068871_100204310 3300006358 Bacteria 1707
172 Ga0068871_100253397 3300006358 Bacteria 1534
173 Ga0068871_100301949 3300006358 Bacteria 1405
174 Ga0068871_100771381 3300006358 Bacteria 885
175 Ga0075428_100035697 3300006844 Bacteria 5479
176 Ga0075428_100225461 3300006844 Bacteria 2023
177 Ga0075431_100026221 3300006847 Bacteria 5977
178 Ga0075433_10032402 3300006852 Bacteria 4476
179 Ga0075433_10080010 3300006852 Bacteria 2880
180 Ga0075433_10355845 3300006852 Bacteria 1294
181 Ga0075433_10369194 3300006852 Bacteria 1267
182 Ga0075434_100040396 3300006871 Bacteria 4619
183 Ga0075434_100051625 3300006871 Bacteria 4086
184 Ga0075434_100945325 3300006871 Bacteria 876
185 Ga0075429_100327934 3300006880 Bacteria 1340
186 Ga0068865_100009117 3300006881 Bacteria 6141
187 Ga0075436_100001580 3300006914 Bacteria 15560
188 Ga0075436_100008014 3300006914 Bacteria 7231
189 Ga0075436_100018228 3300006914 Bacteria 4807
190 Ga0075436_100036365 3300006914 Bacteria 3398
191 Ga0097620_100131882 3300006931 Bacteria 2571
192 Ga0097620_100196271 3300006931 Bacteria 2103
193 Ga0097620_100234604 3300006931 Bacteria 1923
194 Ga0097620_100281804 3300006931 Unclassified 1755
195 Ga0097620_100281965 3300006931 Bacteria 1754
196 Ga0097620_100385974 3300006931 Unclassified 1496
197 Ga0075435_100000353 3300007076 Bacteria 28240
198 Ga0075435_100007512 3300007076 Bacteria 7778
199 Ga0075435_100017947 3300007076 Bacteria 5365
200 Ga0105240_10004476 3300009093 Bacteria 21284
201 Ga0105240_10006658 3300009093 Bacteria 16939
202 Ga0111539_10002313 3300009094 Bacteria 25348
203 Ga0111539_10023493 3300009094 Bacteria 7575
204 Ga0111539_10025833 3300009094 Bacteria 7191
205 Ga0111539_10090615 3300009094 Bacteria 3593
206 Ga0111539_10125383 3300009094 Bacteria 3009
207 Ga0111539_10412951 3300009094 Bacteria 1572
208 Ga0111539_11099734 3300009094 Bacteria 924
209 Ga0105245_10077955 3300009098 Bacteria 3023
210 Ga0105245_10395249 3300009098 Bacteria 1380
211 Ga0105247_10244762 3300009101 Bacteria 1223
212 Ga0114129_10002862 3300009147 Bacteria 24132
213 Ga0114129_10003979 3300009147 Bacteria 20871
214 Ga0114129_10006531 3300009147 Bacteria 16547
215 Ga0114129_10006748 3300009147 Bacteria 16297
216 Ga0114129_10034199 3300009147 Bacteria 7176
217 Ga0114129_10036412 3300009147 Bacteria 6949
218 Ga0114129_10064682 3300009147 Bacteria 5104
219 Ga0114129_10105972 3300009147 Bacteria 3884
220 Ga0114129_10119743 3300009147 Bacteria 3625
221 Ga0114129_10132018 3300009147 Bacteria 3428
222 Ga0114129_10596900 3300009147 Bacteria 1431
223 Ga0114129_10935731 3300009147 Bacteria 1096
224 Ga0105243_10017822 3300009148 Bacteria 5372
225 Ga0105243_10133079 3300009148 Bacteria 2112
226 Ga0105243_10248348 3300009148 Bacteria 1587
227 Ga0105241_10029497 3300009174 Bacteria 4094
228 Ga0105241_10433845 3300009174 Unclassified 1159
229 Ga0105242_10009216 3300009176 Bacteria 7573
230 Ga0105242_10056533 3300009176 Bacteria 3211
231 Ga0105242_10109545 3300009176 Bacteria 2352
232 Ga0105242_10325329 3300009176 Bacteria 1412
233 Ga0105242_10399957 3300009176 Unclassified 1282
234 Ga0105248_10022402 3300009177 Bacteria 7008
235 Ga0105248_10034954 3300009177 Bacteria 5623
236 Ga0105248_10111618 3300009177 Bacteria 3084
237 Ga0105248_10113807 3300009177 Bacteria 3051
238 Ga0105248_10293872 3300009177 Bacteria 1830
239 Ga0105248_10420113 3300009177 Bacteria 1506
240 Ga0105248_10667104 3300009177 Bacteria 1173
241 Ga0105237_10013798 3300009545 Bacteria 8456
242 Ga0105237_10056599 3300009545 Bacteria 3925
243 Ga0105249_10267951 3300009553 Bacteria 1700
244 Ga0105239_10005425 3300010375 Bacteria 14965
245 Ga0105239_10065838 3300010375 Bacteria 3981
246 Ga0157373_10051177 3300013100 Bacteria 2942
247 Ga0157373_10067375 3300013100 Bacteria 2531
248 Ga0157371_10058685 3300013102 Bacteria 2729
249 Ga0157371_10165248 3300013102 Bacteria 1581
250 Ga0157370_10009537 3300013104 Bacteria 10354
251 Ga0157370_10021715 3300013104 Bacteria 6395
252 Ga0157370_11012093 3300013104 Unclassified 752
253 Ga0157369_10006572 3300013105 Bacteria 13453
254 Ga0157369_10012301 3300013105 Bacteria 9720
255 Ga0157369_10082698 3300013105 Bacteria 3435
256 Ga0157369_10141083 3300013105 Bacteria 2550
257 Ga0157374_10012888 3300013296 Bacteria 7283
258 Ga0157374_10358967 3300013296 Unclassified 1449
259 Ga0157378_10008237 3300013297 Bacteria 9090
260 Ga0157378_10024810 3300013297 Bacteria 5280
261 Ga0157378_10192631 3300013297 Bacteria 1924
262 Ga0157378_10214263 3300013297 Bacteria 1828
263 Ga0163162_10049743 3300013306 Bacteria 4202
264 Ga0163162_10190344 3300013306 Unclassified 2179
265 Ga0157372_10015680 3300013307 Bacteria 8127
266 Ga0157372_10044650 3300013307 Bacteria 4911
267 Ga0157372_10229275 3300013307 Bacteria 2153
268 Ga0157372_10294157 3300013307 Bacteria 1888
269 Ga0157372_10318262 3300013307 Bacteria 1811
270 Ga0157372_10573709 3300013307 Unclassified 1315
271 Ga0157375_10108867 3300013308 Bacteria 2866
272 Ga0157375_10160089 3300013308 Bacteria 2392
273 Ga0157375_10271431 3300013308 Bacteria 1858
274 Ga0157375_11105775 3300013308 Unclassified 928
275 Ga0163163_10003243 3300014325 Bacteria 13792
276 Ga0163163_10015169 3300014325 Bacteria 7115
277 Ga0163163_10064222 3300014325 Bacteria 3642
278 Ga0163163_10174186 3300014325 Bacteria 2198
279 Ga0163163_10300775 3300014325 Unclassified 1657
280 Ga0157380_10084360 3300014326 Bacteria 2605
281 Ga0157380_10194588 3300014326 Bacteria 1793
282 Ga0157380_10307228 3300014326 Unclassified 1464
283 Ga0157380_10330001 3300014326 Bacteria 1418
284 Ga0157377_10040237 3300014745 Bacteria 2587
285 Ga0157379_10004956 3300014968 Bacteria 11421
286 Ga0157379_10009749 3300014968 Bacteria 8369
287 Ga0157379_10129098 3300014968 Bacteria 2274
288 Ga0157376_10037091 3300014969 Bacteria 3953
289 Ga0157376_10052705 3300014969 Bacteria 3384
290 Ga0157376_10077761 3300014969 Bacteria 2839
291 Ga0157376_10263457 3300014969 Unclassified 1616
292 Ga0163161_10168409 3300017792 Bacteria 1674
293 Ga0163161_10332439 3300017792 Bacteria 1204
294 Ga0163161_10358050 3300017792 Bacteria 1161
295 Ga0207426_1000089 3300025302 Bacteria 281224
296 Ga0207653_10070638 3300025885 Bacteria 1193
297 Ga0207682_10025184 3300025893 Bacteria 2359
298 Ga0207642_10186045 3300025899 Bacteria 1136
299 Ga0207710_10202688 3300025900 Bacteria 980
300 Ga0207688_10072286 3300025901 Bacteria 1959
301 Ga0207647_10006657 3300025904 Bacteria 8398
302 Ga0207647_10031783 3300025904 Bacteria 3395
303 Ga0207699_10159345 3300025906 Bacteria 1501
304 Ga0207699_10214285 3300025906 Bacteria 1311
305 Ga0207645_10000374 3300025907 Bacteria 37092
306 Ga0207645_10100516 3300025907 Unclassified 1866
307 Ga0207645_10297452 3300025907 Unclassified 1074
308 Ga0207643_10075020 3300025908 Bacteria 1951
309 Ga0207684_10327640 3300025910 Bacteria 1320
310 Ga0207707_10049874 3300025912 Bacteria 3647
311 Ga0207695_10000071 3300025913 Bacteria 315568
312 Ga0207695_10141413 3300025913 Bacteria 2354
313 Ga0207671_10000248 3300025914 Bacteria 80829
314 Ga0207663_10347754 3300025916 Unclassified 1122
315 Ga0207662_10012080 3300025918 Bacteria 4805
316 Ga0207662_10140620 3300025918 Bacteria 1529
317 Ga0207657_10000998 3300025919 Bacteria 30073
318 Ga0207649_10002826 3300025920 Bacteria 9571
319 Ga0207649_10214364 3300025920 Bacteria 1368
320 Ga0207646_10009032 3300025922 Bacteria 9905
321 Ga0207646_10034432 3300025922 Bacteria 4577
322 Ga0207646_10156736 3300025922 Bacteria 2054
323 Ga0207646_10186446 3300025922 Bacteria 1874
324 Ga0207681_10049360 3300025923 Bacteria 2844
325 Ga0207681_10149928 3300025923 Bacteria 1746
326 Ga0207681_10343052 3300025923 Bacteria 1194
327 Ga0207650_10028461 3300025925 Bacteria 4007
328 Ga0207650_10127560 3300025925 Bacteria 1987
329 Ga0207650_10329947 3300025925 Bacteria 1251
330 Ga0207650_10751610 3300025925 Bacteria 825
331 Ga0207659_10160636 3300025926 Bacteria 1764
332 Ga0207700_10023039 3300025928 Bacteria 4285
333 Ga0207644_10032025 3300025931 Bacteria 3666
334 Ga0207644_10063909 3300025931 Unclassified 2674
335 Ga0207690_10009184 3300025932 Bacteria 5869
336 Ga0207690_10028479 3300025932 Bacteria 3541
337 Ga0207690_10594526 3300025932 Bacteria 903
338 Ga0207706_10002259 3300025933 Bacteria 18812
339 Ga0207706_10264897 3300025933 Bacteria 1500
340 Ga0207706_10440228 3300025933 Bacteria 1128
341 Ga0207706_10498022 3300025933 Bacteria 1052
342 Ga0207686_10097190 3300025934 Bacteria 1958
343 Ga0207686_10111726 3300025934 Bacteria 1844
344 Ga0207686_10222620 3300025934 Bacteria 1363
345 Ga0207686_10454574 3300025934 Unclassified 986
346 Ga0207709_10109805 3300025935 Bacteria 1842
347 Ga0207670_10032843 3300025936 Bacteria 3340
348 Ga0207669_10039470 3300025937 Bacteria 2729
349 Ga0207704_10006504 3300025938 Bacteria 5454
350 Ga0207704_10078860 3300025938 Bacteria 2120
351 Ga0207704_10203351 3300025938 Bacteria 1451
352 Ga0207665_10032458 3300025939 Bacteria 3458
353 Ga0207691_10078013 3300025940 Bacteria 2982
354 Ga0207691_10128166 3300025940 Bacteria 2243
355 Ga0207691_10253516 3300025940 Bacteria 1518
356 Ga0207691_10341327 3300025940 Bacteria 1282
357 Ga0207691_10419493 3300025940 Bacteria 1140
358 Ga0207691_10478135 3300025940 Bacteria 1059
359 Ga0207711_10106934 3300025941 Bacteria 2483
360 Ga0207711_10149577 3300025941 Unclassified 2106
361 Ga0207711_10313527 3300025941 Bacteria 1448
362 Ga0207711_10474564 3300025941 Bacteria 1165
363 Ga0207661_10020085 3300025944 Bacteria 4989
364 Ga0207661_10039286 3300025944 Bacteria 3714
365 Ga0207679_10048879 3300025945 Bacteria 3082
366 Ga0207667_10000177 3300025949 Bacteria 92852
367 Ga0207667_10843384 3300025949 Bacteria 911
368 Ga0207651_10017985 3300025960 Bacteria 4193
369 Ga0207651_10022466 3300025960 Bacteria 3858
370 Ga0207651_10050546 3300025960 Bacteria 2823
371 Ga0207651_10128685 3300025960 Bacteria 1934
372 Ga0207651_10633183 3300025960 Bacteria 938
373 Ga0207712_10145889 3300025961 Bacteria 1822
374 Ga0207712_10572386 3300025961 Bacteria 974
375 Ga0207668_10040786 3300025972 Bacteria 3134
376 Ga0207640_10020664 3300025981 Bacteria 3912
377 Ga0207640_10034194 3300025981 Bacteria 3170
378 Ga0207658_10277277 3300025986 Unclassified 1436
379 Ga0207658_10413590 3300025986 Bacteria 1188
380 Ga0207677_10076506 3300026023 Bacteria 2383
381 Ga0207677_10206613 3300026023 Bacteria 1565
382 Ga0207677_10218218 3300026023 Unclassified 1528
383 Ga0207677_10383765 3300026023 Unclassified 1186
384 Ga0207703_10081024 3300026035 Bacteria 2705
385 Ga0207703_10170415 3300026035 Bacteria 1914
386 Ga0207703_10410143 3300026035 Bacteria 1259
387 Ga0207639_10101641 3300026041 Unclassified 2325
388 Ga0207639_10251004 3300026041 Bacteria 1543
389 Ga0207639_10443745 3300026041 Bacteria 1177
390 Ga0207708_10000853 3300026075 Bacteria 22965
391 Ga0207708_10149003 3300026075 Bacteria 1840
392 Ga0207702_10181493 3300026078 Bacteria 1939
393 Ga0207641_10007264 3300026088 Bacteria 9229
394 Ga0207641_10168349 3300026088 Bacteria 1998
395 Ga0207641_10787029 3300026088 Bacteria 940
396 Ga0207648_10019032 3300026089 Bacteria 6200
397 Ga0207648_10069106 3300026089 Bacteria 3078
398 Ga0207648_10229301 3300026089 Bacteria 1652
399 Ga0207676_10201304 3300026095 Unclassified 1760
400 Ga0207676_10210545 3300026095 Bacteria 1724
401 Ga0207674_10019213 3300026116 Bacteria 7409
402 Ga0207674_10046127 3300026116 Bacteria 4477
403 Ga0207674_10123267 3300026116 Bacteria 2557
404 Ga0207674_10484694 3300026116 Bacteria 1195
405 Ga0207675_100003224 3300026118 Bacteria 15999
406 Ga0207675_100009178 3300026118 Bacteria 9279
407 Ga0207675_100044619 3300026118 Bacteria 4143
408 Ga0207675_100075323 3300026118 Bacteria 3159
409 Ga0207675_100570583 3300026118 Bacteria 1132
410 Ga0207683_10052789 3300026121 Bacteria 3562
411 Ga0207683_10074278 3300026121 Bacteria 3008
412 Ga0207698_10001170 3300026142 Bacteria 15290
413 Ga0207698_10266803 3300026142 Bacteria 1576
414 Ga0207698_10717290 3300026142 Unclassified 996
415 Ga0209968_1015784 3300027526 Bacteria 1197
416 Ga0209999_1003586 3300027543 Unclassified 2779
417 Ga0207428_10032291 3300027907 Bacteria 4307
418 Ga0207428_10089615 3300027907 Unclassified 2390
419 Ga0207428_10097245 3300027907 Bacteria 2279
420 Ga0268266_10015800 3300028379 Bacteria 6463
421 Ga0268266_10351031 3300028379 Bacteria 1386
422 Ga0268265_10026761 3300028380 Bacteria 4106
423 Ga0268265_10027400 3300028380 Bacteria 4067
424 Ga0268265_10142816 3300028380 Bacteria 2006
425 Ga0268264_10149320 3300028381 Bacteria 2094
426 Ga0268264_10309665 3300028381 Bacteria 1490
427 Ga0268264_10434774 3300028381 Bacteria 1268
428 Ga0268264_10436279 3300028381 Unclassified 1266
429 Ga0307515_10360598 3300028794 Bacteria 1095
430 Ga0307511_10001228 3300030521 Bacteria 27171
431 Ga0307513_10066484 3300031456 Bacteria 3787
432 Ga0307509_10050879 3300031507 Bacteria 4434
433 Ga0265313_10060807 3300031595 Bacteria 1770
434 Ga0307508_10003214 3300031616 Bacteria 16703
435 Ga0307410_10060932 3300031852 Unclassified 2581
436 Ga0373930_0000418 3300034816 Bacteria 5660
437 Ga0373948_0027259 3300034817 Bacteria 1131
438 Ga0373950_0000533 3300034818 Bacteria 4668
439 Ga0373958_0001291 3300034819 Bacteria 3350
440 Ga0373959_0007441 3300034820 Bacteria 1840
441 Ga0373938_0002035 3300034957 Bacteria 3243
442 Ga0373929_0000473 3300035085 Bacteria 7704
443 Ga0373944_0033326 3300035089 Bacteria 1560
444 Ga0373949_0002000 3300035090 Bacteria 5451
445 Ga0373951_0002176 3300035091 Bacteria 4991
446 Ga0373952_0006207 3300035092 Bacteria 2202
447 Ga0373923_0136390 3300035111 Bacteria 1106
448 Ga0373932_0000622 3300035112 Bacteria 10731
449 Ga0373936_0025837 3300035113 Bacteria 2298
450 Ga0373936_0168213 3300035113 Unclassified 958
451 Ga0373939_0000792 3300035114 Bacteria 7795
452 Ga0373939_0123695 3300035114 Bacteria 915
453 Ga0373939_0124978 3300035114 Bacteria 912
454 Ga0373945_0054145 3300035116 Unclassified 1483
455 Ga0373945_0150074 3300035116 Unclassified 944
456 Ga0373954_0219593 3300035118 Bacteria 935
457 Ga0373960_0002786 3300035121 Bacteria 3958
458 Ga0373943_0001750 3300035170 Bacteria 9851
459 Ga0373943_0035463 3300035170 Unclassified 2384
460 Ga0373955_0023039 3300035172 Bacteria 3168
461 Ga0373955_0050044 3300035172 Bacteria 2271
462 Ga0373942_0002122 3300035207 Bacteria 4911
463 Ga0373961_0000583 3300035241 Bacteria 13650
464 Ga0373961_0135778 3300035241 Bacteria 827
465 Ga0373931_0037542 3300035691 Bacteria 2529
466 Ga0373935_0291720 3300035692 Unclassified 1151
467 Ga0373947_0135222 3300035725 Bacteria 1577
468 Ga0373937_0131674 3300036401 Bacteria 2336
469 Ga0373937_0145829 3300036401 Bacteria 2216
470 Ga0373937_0395414 3300036401 Bacteria 1311
471 Ga0373925_0253709 3300037068 Bacteria 1411
472 Ga0436365_0273507 3300039437 Bacteria 1140
473 Ga0436365_0744633 3300039437 Bacteria 4020
474 Ga0439449_0004613 3300042007 Bacteria 5325
475 Ga0439462_0014242 3300042015 Bacteria 2042
476 Ga0451577_0369527 3300042876 Unclassified 1301
477 Ga0466963_0057452 3300044694 Bacteria 2591
478 Ga0453684_0060657 3300044712 Bacteria 4861
479 Ga0453684_0061544 3300044712 Bacteria 4818
480 Ga0451576_0005245 3300045051 Bacteria 16359
481 Ga0451576_0449142 3300045051 Bacteria 1353
482 Ga0466967_0035685 3300045976 Bacteria 4236
483 Ga0466967_0212506 3300045976 Bacteria 1835
484 Ga0495629_0058601 3300046459 Bacteria 2693
485 Ga0495629_0115143 3300046459 Bacteria 1874
486 Ga0495629_0201525 3300046459 Unclassified 1376
487 Ga0495641_0189695 3300046461 Bacteria 921
488 Ga0495651_0415366 3300046462 Bacteria 876
489 Ga0495580_0077916 3300046472 Bacteria 2312
490 Ga0495580_0116989 3300046472 Bacteria 1851
491 Ga0495580_0483671 3300046472 Bacteria 828
492 Ga0495628_0022907 3300046516 Bacteria 5127
493 Ga0495630_0044620 3300046517 Bacteria 3313
494 Ga0495630_0080371 3300046517 Bacteria 2459
495 Ga0495652_0156822 3300046529 Bacteria 1772
496 Ga0495640_0064147 3300046533 Bacteria 2485
497 Ga0495645_0003365 3300046543 Bacteria 10837
498 Ga0495645_0032978 3300046543 Bacteria 3777
499 Ga0495634_0204985 3300046642 Bacteria 1223
500 Ga0495634_0336077 3300046642 Unclassified 907
501 Ga0495635_0023010 3300046663 Bacteria 4344
502 Ga0495599_0224182 3300046678 Bacteria 1149
503 Ga0495647_0189064 3300046681 Bacteria 899
504 Ga0495647_0200556 3300046681 Bacteria 875
505 Ga0495658_0070001 3300046683 Bacteria 2035
506 Ga0495658_0074802 3300046683 Bacteria 1975
507 Ga0495669_0003805 3300046684 Bacteria 6202
508 Ga0495613_0097221 3300046689 Bacteria 2129
509 Ga0495674_0044022 3300047319 Bacteria 3970
510 Ga0495676_0321588 3300047321 Bacteria 1039
511 Ga0495675_0130001 3300047444 Bacteria 1566
512 Ga0495684_0017270 3300047471 Bacteria 5555
513 Ga0495593_0172807 3300047673 Bacteria 1089
514 Ga0496102_0152608 3300048905 Unclassified 2171
515 Ga0496106_0237205 3300048909 Bacteria 1457
516 Ga0496106_0286633 3300048909 Bacteria 1320
517 Ga0496106_0520649 3300048909 Bacteria 955
518 Ga0496108_0298821 3300048911 Bacteria 1402
519 Ga0496108_0437625 3300048911 Bacteria 1142
520 Ga0496110_0043101 3300048913 Bacteria 3940
521 Ga0496110_0478792 3300048913 Bacteria 1134
522 Ga0496112_0405425 3300048915 Bacteria 1303
523 Ga0496114_0055436 3300048917 Bacteria 3306
524 Ga0496114_0244560 3300048917 Unclassified 1578
525 Ga0496115_0222896 3300048918 Unclassified 1556
526 Ga0501034_0157740 3300049571 Bacteria 2242
527 Ga0501038_0198630 3300049574 Bacteria 1611
528 Ga0501043_0236235 3300049579 Unclassified 1411
529 Ga0501048_0135163 3300049582 Bacteria 1743
530 Ga0501067_0028021 3300049583 Bacteria 3122
531 Ga0501069_0017098 3300049585 Bacteria 3900
532 Ga0501074_0248913 3300049590 Unclassified 1264
533 Ga0501223_077873 3300049663 Unclassified 661
534 Ga0501251_008301 3300049681 Bacteria 1173
535 Ga0501219_000027 3300049703 Bacteria 23249
536 Ga0501083_0021747 3300049744 Bacteria 4455
537 Ga0501241_011086 3300049758 Bacteria 1637
538 Ga0501044_0434713 3300049823 Bacteria 1221
539 Ga0501284_00021 3300050005 Bacteria 89729
540 nmdc:mga05p37_10708_c1 3300050507 Bacteria 10885
541 nmdc:mga05p37_11063_c1 3300050507 Bacteria 10720
542 nmdc:mga05p37_1107_c1 3300050507 Bacteria 28841
543 nmdc:mga05p37_2169_c1 3300050507 Bacteria 22888
544 nmdc:mga05p37_308028_c1 3300050507 Bacteria 1878
545 nmdc:mga05p37_36574_c1 3300050507 Bacteria 6022
546 nmdc:mga05p37_401045_c1 3300050507 Bacteria 1601
547 nmdc:mga05p37_5071_c1 3300050507 Bacteria 15438
548 nmdc:mga05p37_60313_c1 3300050507 Bacteria 4671
549 nmdc:mga05p37_6745_c1 3300050507 Bacteria 13538
550 nmdc:mga05p37_70288_c1 3300050507 Bacteria 4306
551 nmdc:mga06r32_119244_c1 3300050510 Bacteria 2601
552 nmdc:mga08y16_121168_c1 3300050511 Bacteria 2722
553 nmdc:mga08y16_1540_c1 3300050511 Bacteria 23195
554 nmdc:mga08y16_705957_c1 3300050511 Bacteria 1008
555 nmdc:mga08y16_85267_c1 3300050511 Bacteria 3292
556 nmdc:mga0n895_144855_c1 3300050512 Bacteria 2405
557 nmdc:mga0n895_433761_c1 3300050512 Bacteria 1328
558 nmdc:mga0n895_69048_c1 3300050512 Bacteria 3500
559 nmdc:mga0rr50_1053_c1 3300050513 Bacteria 15000
560 nmdc:mga0rr50_8677_c1 3300050513 Bacteria 6338
561 nmdc:mga08x19_11440_c1 3300050514 Bacteria 5340
562 nmdc:mga08x19_276705_c1 3300050514 Bacteria 1163
563 nmdc:mga08x19_38799_c1 3300050514 Bacteria 3026
564 nmdc:mga08x19_55172_c1 3300050514 Bacteria 2560
565 nmdc:mga0a205_267675_c1 3300050515 Bacteria 1586
566 nmdc:mga0a205_40441_c1 3300050515 Bacteria 4488
567 nmdc:mga0a205_55204_c1 3300050515 Bacteria 3837
568 Ga0495601_0185984 3300053077 Bacteria 1358
569 Ga0495595_0050406 3300053084 Bacteria 1928
570 Ga0495595_0057702 3300053084 Bacteria 1811
571 Ga0495619_0013263 3300053085 Bacteria 5193
572 Ga0495619_0023867 3300053085 Bacteria 3921
573 Ga0495619_0058757 3300053085 Bacteria 2554
574 Ga0495619_0144202 3300053085 Bacteria 1641
575 Ga0495619_0289156 3300053085 Bacteria 1135
576 Ga0501084_0022825 3300054114 Bacteria 5221
577 Ga0501082_0387078 3300060353 Bacteria 1220

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005331 Ga0070670_100911973 Ga0070670_1009119731 195
2 3300005354 Ga0070675_100082595 Ga0070675_1000825952 195
3 3300005356 Ga0070674_100455287 Ga0070674_1004552872 195
4 3300005364 Ga0070673_100233351 Ga0070673_1002333512 195
5 3300025893 Ga0207682_10025184 Ga0207682_100251842 195
6 3300025925 Ga0207650_10751610 Ga0207650_107516101 195
7 3300025926 Ga0207659_10160636 Ga0207659_101606363 195
8 3300006358 Ga0068871_100301949 Ga0068871_1003019492 197
9 3300005564 Ga0070664_100086526 Ga0070664_1000865263 199
10 3300025925 Ga0207650_10127560 Ga0207650_101275602 199
11 3300049663 Ga0501223_077873 Ga0501223_077873_11_613 199
12 3300005457 Ga0070662_100666902 Ga0070662_1006669021 203
13 3300005548 Ga0070665_100087579 Ga0070665_1000875792 203
14 3300005719 Ga0068861_100362675 Ga0068861_1003626751 203
15 3300025933 Ga0207706_10498022 Ga0207706_104980221 203
16 3300025940 Ga0207691_10128166 Ga0207691_101281662 203
17 3300025940 Ga0207691_10419493 Ga0207691_104194933 203
18 3300026118 Ga0207675_100570583 Ga0207675_1005705831 203
19 3300028379 Ga0268266_10351031 Ga0268266_103510312 203
20 3300005471 Ga0070698_100002918 Ga0070698_10000291822 204
21 3300005518 Ga0070699_100097317 Ga0070699_1000973172 204
22 3300013104 Ga0157370_11012093 Ga0157370_110120931 204
23 3300025922 Ga0207646_10186446 Ga0207646_101864462 204
24 3300045976 Ga0466967_0035685 Ga0466967_0035685_2535_3284 212
25 3300005842 Ga0068858_100692206 Ga0068858_1006922061 213
26 3300009177 Ga0105248_10420113 Ga0105248_104201132 213
27 3300025941 Ga0207711_10474564 Ga0207711_104745641 213
28 3300025961 Ga0207712_10572386 Ga0207712_105723861 213
29 3300026035 Ga0207703_10410143 Ga0207703_104101432 213
30 3300035111 Ga0373923_0136390 Ga0373923_0136390_58_702 214
31 3300009177 Ga0105248_10022402 Ga0105248_100224026 215
32 3300025941 Ga0207711_10149577 Ga0207711_101495771 215
33 3300048915 Ga0496112_0405425 Ga0496112_0405425_502_1254 216
34 3300006844 Ga0075428_100225461 Ga0075428_1002254612 217
35 3300009094 Ga0111539_10125383 Ga0111539_101253832 217
36 3300026121 Ga0207683_10074278 Ga0207683_100742783 217
37 3300028381 Ga0268264_10434774 Ga0268264_104347741 217
38 3300050507 nmdc:mga05p37_401045_c1 nmdc:mga05p37_401045_c1_147_914 218
39 3300047673 Ga0495593_0172807 Ga0495593_0172807_225_980 219
40 3300009147 Ga0114129_10006748 Ga0114129_100067486 221
41 3300050507 nmdc:mga05p37_10708_c1 nmdc:mga05p37_10708_c1_4705_5445 221
42 3300050515 nmdc:mga0a205_267675_c1 nmdc:mga0a205_267675_c1_704_1444 221
43 3300014325 Ga0163163_10174186 Ga0163163_101741862 222
44 3300006914 Ga0075436_100018228 Ga0075436_1000182282 223
45 3300007076 Ga0075435_100000353 Ga0075435_10000035327 223
46 3300009147 Ga0114129_10132018 Ga0114129_101320186 223
47 3300005328 Ga0070676_10073669 Ga0070676_100736691 224
48 3300005356 Ga0070674_100003729 Ga0070674_10000372914 224
49 3300005719 Ga0068861_100526907 Ga0068861_1005269072 224
50 3300009148 Ga0105243_10133079 Ga0105243_101330792 224
51 3300009176 Ga0105242_10325329 Ga0105242_103253292 224
52 3300014326 Ga0157380_10194588 Ga0157380_101945882 224
53 3300025934 Ga0207686_10454574 Ga0207686_104545741 224
54 3300025935 Ga0207709_10109805 Ga0207709_101098052 224
55 3300026075 Ga0207708_10149003 Ga0207708_101490032 224
56 3300006880 Ga0075429_100327934 Ga0075429_1003279341 227
57 3300009094 Ga0111539_11099734 Ga0111539_110997341 228
58 3300028380 Ga0268265_10027400 Ga0268265_100274001 228
59 3300005549 Ga0070704_100581553 Ga0070704_1005815531 230
60 3300044694 Ga0466963_0057452 Ga0466963_0057452_1069_1824 230
61 3300045976 Ga0466967_0212506 Ga0466967_0212506_998_1753 230
62 3300005331 Ga0070670_100405534 Ga0070670_1004055341 232
63 3300005365 Ga0070688_100012008 Ga0070688_1000120084 232
64 3300005577 Ga0068857_100051642 Ga0068857_1000516422 232
65 3300005617 Ga0068859_100131882 Ga0068859_1001318823 232
66 3300005618 Ga0068864_100016207 Ga0068864_1000162074 232
67 3300006931 Ga0097620_100131882 Ga0097620_1001318823 232
68 3300014325 Ga0163163_10003243 Ga0163163_1000324312 232
69 3300025925 Ga0207650_10329947 Ga0207650_103299471 232
70 3300026116 Ga0207674_10046127 Ga0207674_100461274 232
71 3300005335 Ga0070666_10165995 Ga0070666_101659951 233
72 3300005841 Ga0068863_100296503 Ga0068863_1002965032 233
73 3300006358 Ga0068871_100771381 Ga0068871_1007713811 233
74 3300009176 Ga0105242_10109545 Ga0105242_101095452 233
75 3300009177 Ga0105248_10113807 Ga0105248_101138075 233
76 3300013297 Ga0157378_10214263 Ga0157378_102142631 233
77 3300013308 Ga0157375_10108867 Ga0157375_101088674 233
78 3300026088 Ga0207641_10168349 Ga0207641_101683492 233
79 3300046461 Ga0495641_0189695 Ga0495641_0189695_130_888 233
80 3300046533 Ga0495640_0064147 Ga0495640_0064147_1657_2415 233
81 3300046681 Ga0495647_0189064 Ga0495647_0189064_47_805 233
82 3300046683 Ga0495658_0070001 Ga0495658_0070001_349_1107 233
83 3300053085 Ga0495619_0144202 Ga0495619_0144202_818_1576 233
84 3300005295 Ga0065707_10279465 Ga0065707_102794652 234
85 3300005440 Ga0070705_100005869 Ga0070705_1000058694 234
86 3300005445 Ga0070708_100041425 Ga0070708_1000414258 235
87 3300005471 Ga0070698_100075010 Ga0070698_1000750103 235
88 3300005518 Ga0070699_100008796 Ga0070699_10000879611 235
89 3300006914 Ga0075436_100008014 Ga0075436_1000080148 235
90 3300014326 Ga0157380_10084360 Ga0157380_100843602 235
91 3300050514 nmdc:mga08x19_38799_c1 nmdc:mga08x19_38799_c1_832_1563 235
92 3300005290 Ga0065712_10084035 Ga0065712_100840353 236
93 3300005293 Ga0065715_10043379 Ga0065715_100433792 236
94 3300005329 Ga0070683_100182911 Ga0070683_1001829112 236
95 3300005338 Ga0068868_100064499 Ga0068868_1000644994 236
96 3300005338 Ga0068868_100185931 Ga0068868_1001859313 236
97 3300005354 Ga0070675_100605499 Ga0070675_1006054991 236
98 3300005355 Ga0070671_100333511 Ga0070671_1003335112 236
99 3300005364 Ga0070673_100015038 Ga0070673_10001503810 236
100 3300005467 Ga0070706_100237712 Ga0070706_1002377122 236
101 3300005543 Ga0070672_100440642 Ga0070672_1004406421 236
102 3300005614 Ga0068856_100041951 Ga0068856_1000419512 236
103 3300005618 Ga0068864_100197899 Ga0068864_1001978992 236
104 3300006871 Ga0075434_100945325 Ga0075434_1009453252 236
105 3300006914 Ga0075436_100036365 Ga0075436_1000363656 236
106 3300009093 Ga0105240_10006658 Ga0105240_1000665815 236
107 3300009094 Ga0111539_10090615 Ga0111539_100906152 236
108 3300009147 Ga0114129_10006531 Ga0114129_100065316 236
109 3300014326 Ga0157380_10330001 Ga0157380_103300012 236
110 3300025907 Ga0207645_10297452 Ga0207645_102974522 236
111 3300025913 Ga0207695_10141413 Ga0207695_101414134 236
112 3300025940 Ga0207691_10478135 Ga0207691_104781351 236
113 3300025949 Ga0207667_10843384 Ga0207667_108433842 236
114 3300025960 Ga0207651_10017985 Ga0207651_100179852 236
115 3300026023 Ga0207677_10206613 Ga0207677_102066131 236
116 3300026078 Ga0207702_10181493 Ga0207702_101814933 236
117 3300026095 Ga0207676_10210545 Ga0207676_102105452 236
118 3300048911 Ga0496108_0298821 Ga0496108_0298821_338_1084 236
119 3300048913 Ga0496110_0043101 Ga0496110_0043101_1863_2609 236
120 3300050507 nmdc:mga05p37_5071_c1 nmdc:mga05p37_5071_c1_7796_8530 236
121 3300050511 nmdc:mga08y16_121168_c1 nmdc:mga08y16_121168_c1_1379_2200 236
122 3300050514 nmdc:mga08x19_11440_c1 nmdc:mga08x19_11440_c1_1629_2369 236
123 3300005328 Ga0070676_10002816 Ga0070676_100028162 237
124 3300005328 Ga0070676_10096956 Ga0070676_100969562 237
125 3300005328 Ga0070676_10502458 Ga0070676_105024581 237
126 3300005334 Ga0068869_100058530 Ga0068869_1000585302 237
127 3300005334 Ga0068869_100358608 Ga0068869_1003586082 237
128 3300005335 Ga0070666_10047534 Ga0070666_100475342 237
129 3300005338 Ga0068868_100100530 Ga0068868_1001005302 237
130 3300005338 Ga0068868_100286298 Ga0068868_1002862982 237
131 3300005340 Ga0070689_100054536 Ga0070689_1000545363 237
132 3300005341 Ga0070691_10015269 Ga0070691_100152693 237
133 3300005345 Ga0070692_10285905 Ga0070692_102859051 237
134 3300005347 Ga0070668_100024997 Ga0070668_1000249974 237
135 3300005353 Ga0070669_100004492 Ga0070669_10000449211 237
136 3300005353 Ga0070669_100174395 Ga0070669_1001743952 237
137 3300005354 Ga0070675_100036897 Ga0070675_1000368972 237
138 3300005355 Ga0070671_100014962 Ga0070671_10001496210 237
139 3300005356 Ga0070674_100084615 Ga0070674_1000846151 237
140 3300005364 Ga0070673_100058295 Ga0070673_1000582952 237
141 3300005364 Ga0070673_100297465 Ga0070673_1002974652 237
142 3300005365 Ga0070688_100059486 Ga0070688_1000594861 237
143 3300005434 Ga0070709_10027040 Ga0070709_100270402 237
144 3300005436 Ga0070713_100058942 Ga0070713_1000589422 237
145 3300005439 Ga0070711_100403212 Ga0070711_1004032121 237
146 3300005440 Ga0070705_100024102 Ga0070705_1000241025 237
147 3300005441 Ga0070700_100001692 Ga0070700_10000169211 237
148 3300005457 Ga0070662_100093263 Ga0070662_1000932632 237
149 3300005459 Ga0068867_100005839 Ga0068867_1000058392 237
150 3300005468 Ga0070707_100038086 Ga0070707_1000380864 237
151 3300005468 Ga0070707_100110951 Ga0070707_1001109512 237
152 3300005468 Ga0070707_100268227 Ga0070707_1002682272 237
153 3300005471 Ga0070698_100310416 Ga0070698_1003104162 237
154 3300005518 Ga0070699_100091830 Ga0070699_1000918302 237
155 3300005518 Ga0070699_100144377 Ga0070699_1001443772 237
156 3300005518 Ga0070699_100363363 Ga0070699_1003633632 237
157 3300005543 Ga0070672_100187253 Ga0070672_1001872531 237
158 3300005544 Ga0070686_100052771 Ga0070686_1000527712 237
159 3300005545 Ga0070695_100006551 Ga0070695_1000065512 237
160 3300005545 Ga0070695_100077779 Ga0070695_1000777792 237
161 3300005546 Ga0070696_100013306 Ga0070696_1000133062 237
162 3300005548 Ga0070665_100003124 Ga0070665_1000031246 237
163 3300005548 Ga0070665_100006541 Ga0070665_10000654113 237
164 3300005548 Ga0070665_100367794 Ga0070665_1003677941 237
165 3300005549 Ga0070704_100030248 Ga0070704_1000302483 237
166 3300005549 Ga0070704_100115752 Ga0070704_1001157523 237
167 3300005578 Ga0068854_100033809 Ga0068854_1000338096 237
168 3300005578 Ga0068854_100036394 Ga0068854_1000363943 237
169 3300005615 Ga0070702_100009974 Ga0070702_1000099742 237
170 3300005617 Ga0068859_100196275 Ga0068859_1001962752 237
171 3300005617 Ga0068859_100234600 Ga0068859_1002346002 237
172 3300005617 Ga0068859_100281800 Ga0068859_1002818001 237
173 3300005617 Ga0068859_100281977 Ga0068859_1002819772 237
174 3300005617 Ga0068859_100386005 Ga0068859_1003860052 237
175 3300005618 Ga0068864_100118824 Ga0068864_1001188242 237
176 3300005718 Ga0068866_10046104 Ga0068866_100461044 237
177 3300005719 Ga0068861_100002556 Ga0068861_10000255611 237
178 3300005719 Ga0068861_100028165 Ga0068861_1000281654 237
179 3300005719 Ga0068861_100120815 Ga0068861_1001208154 237
180 3300005841 Ga0068863_100002234 Ga0068863_1000022346 237
181 3300005842 Ga0068858_100001888 Ga0068858_10000188822 237
182 3300005842 Ga0068858_100041463 Ga0068858_1000414634 237
183 3300005842 Ga0068858_100070477 Ga0068858_1000704775 237
184 3300005842 Ga0068858_100105571 Ga0068858_1001055713 237
185 3300005843 Ga0068860_100047704 Ga0068860_1000477043 237
186 3300005843 Ga0068860_100052055 Ga0068860_1000520551 237
187 3300005844 Ga0068862_100004461 Ga0068862_10000446112 237
188 3300005844 Ga0068862_100006527 Ga0068862_1000065278 237
189 3300005937 Ga0081455_10088391 Ga0081455_100883911 237
190 3300006237 Ga0097621_100001463 Ga0097621_1000014639 237
191 3300006237 Ga0097621_100408735 Ga0097621_1004087352 237
192 3300006358 Ga0068871_100011799 Ga0068871_1000117992 237
193 3300006358 Ga0068871_100062999 Ga0068871_1000629992 237
194 3300006358 Ga0068871_100204310 Ga0068871_1002043103 237
195 3300006358 Ga0068871_100253397 Ga0068871_1002533972 237
196 3300006844 Ga0075428_100035697 Ga0075428_10003569710 237
197 3300006847 Ga0075431_100026221 Ga0075431_1000262216 237
198 3300006852 Ga0075433_10032402 Ga0075433_100324023 237
199 3300006852 Ga0075433_10080010 Ga0075433_100800102 237
200 3300006852 Ga0075433_10355845 Ga0075433_103558452 237
201 3300006852 Ga0075433_10369194 Ga0075433_103691942 237
202 3300006871 Ga0075434_100040396 Ga0075434_1000403965 237
203 3300006871 Ga0075434_100051625 Ga0075434_1000516252 237
204 3300006881 Ga0068865_100009117 Ga0068865_10000911711 237
205 3300006914 Ga0075436_100001580 Ga0075436_10000158019 237
206 3300006931 Ga0097620_100196271 Ga0097620_1001962712 237
207 3300006931 Ga0097620_100234604 Ga0097620_1002346042 237
208 3300006931 Ga0097620_100281804 Ga0097620_1002818041 237
209 3300006931 Ga0097620_100281965 Ga0097620_1002819652 237
210 3300006931 Ga0097620_100385974 Ga0097620_1003859742 237
211 3300007076 Ga0075435_100007512 Ga0075435_1000075126 237
212 3300007076 Ga0075435_100017947 Ga0075435_1000179474 237
213 3300009094 Ga0111539_10002313 Ga0111539_1000231314 237
214 3300009094 Ga0111539_10025833 Ga0111539_100258336 237
215 3300009094 Ga0111539_10412951 Ga0111539_104129512 237
216 3300009098 Ga0105245_10077955 Ga0105245_100779552 237
217 3300009098 Ga0105245_10395249 Ga0105245_103952492 237
218 3300009101 Ga0105247_10244762 Ga0105247_102447621 237
219 3300009147 Ga0114129_10002862 Ga0114129_100028626 237
220 3300009147 Ga0114129_10003979 Ga0114129_100039794 237
221 3300009147 Ga0114129_10034199 Ga0114129_100341996 237
222 3300009147 Ga0114129_10036412 Ga0114129_1003641211 237
223 3300009147 Ga0114129_10064682 Ga0114129_100646824 237
224 3300009147 Ga0114129_10105972 Ga0114129_101059722 237
225 3300009147 Ga0114129_10119743 Ga0114129_101197432 237
226 3300009147 Ga0114129_10596900 Ga0114129_105969002 237
227 3300009147 Ga0114129_10935731 Ga0114129_109357311 237
228 3300009148 Ga0105243_10017822 Ga0105243_100178224 237
229 3300009148 Ga0105243_10248348 Ga0105243_102483481 237
230 3300009174 Ga0105241_10433845 Ga0105241_104338452 237
231 3300009176 Ga0105242_10009216 Ga0105242_100092164 237
232 3300009176 Ga0105242_10056533 Ga0105242_100565332 237
233 3300009177 Ga0105248_10034954 Ga0105248_100349545 237
234 3300009177 Ga0105248_10111618 Ga0105248_101116181 237
235 3300009177 Ga0105248_10293872 Ga0105248_102938722 237
236 3300009553 Ga0105249_10267951 Ga0105249_102679513 237
237 3300013102 Ga0157371_10165248 Ga0157371_101652481 237
238 3300013296 Ga0157374_10358967 Ga0157374_103589672 237
239 3300013308 Ga0157375_10160089 Ga0157375_101600894 237
240 3300013308 Ga0157375_10271431 Ga0157375_102714312 237
241 3300013308 Ga0157375_11105775 Ga0157375_111057751 237
242 3300014325 Ga0163163_10064222 Ga0163163_100642223 237
243 3300014325 Ga0163163_10300775 Ga0163163_103007752 237
244 3300014968 Ga0157379_10004956 Ga0157379_100049562 237
245 3300014968 Ga0157379_10009749 Ga0157379_100097496 237
246 3300014968 Ga0157379_10129098 Ga0157379_101290983 237
247 3300014969 Ga0157376_10037091 Ga0157376_100370912 237
248 3300014969 Ga0157376_10052705 Ga0157376_100527052 237
249 3300014969 Ga0157376_10077761 Ga0157376_100777612 237
250 3300014969 Ga0157376_10263457 Ga0157376_102634572 237
251 3300017792 Ga0163161_10168409 Ga0163161_101684092 237
252 3300017792 Ga0163161_10358050 Ga0163161_103580502 237
253 3300025885 Ga0207653_10070638 Ga0207653_100706381 237
254 3300025899 Ga0207642_10186045 Ga0207642_101860452 237
255 3300025900 Ga0207710_10202688 Ga0207710_102026882 237
256 3300025901 Ga0207688_10072286 Ga0207688_100722862 237
257 3300025906 Ga0207699_10159345 Ga0207699_101593452 237
258 3300025906 Ga0207699_10214285 Ga0207699_102142852 237
259 3300025907 Ga0207645_10000374 Ga0207645_1000037420 237
260 3300025908 Ga0207643_10075020 Ga0207643_100750203 237
261 3300025910 Ga0207684_10327640 Ga0207684_103276401 237
262 3300025916 Ga0207663_10347754 Ga0207663_103477542 237
263 3300025918 Ga0207662_10140620 Ga0207662_101406202 237
264 3300025922 Ga0207646_10009032 Ga0207646_1000903213 237
265 3300025922 Ga0207646_10034432 Ga0207646_100344328 237
266 3300025922 Ga0207646_10156736 Ga0207646_101567362 237
267 3300025923 Ga0207681_10049360 Ga0207681_100493604 237
268 3300025923 Ga0207681_10149928 Ga0207681_101499281 237
269 3300025928 Ga0207700_10023039 Ga0207700_100230396 237
270 3300025931 Ga0207644_10032025 Ga0207644_100320254 237
271 3300025932 Ga0207690_10594526 Ga0207690_105945262 237
272 3300025933 Ga0207706_10264897 Ga0207706_102648971 237
273 3300025934 Ga0207686_10097190 Ga0207686_100971901 237
274 3300025934 Ga0207686_10111726 Ga0207686_101117262 237
275 3300025934 Ga0207686_10222620 Ga0207686_102226201 237
276 3300025936 Ga0207670_10032843 Ga0207670_100328434 237
277 3300025937 Ga0207669_10039470 Ga0207669_100394702 237
278 3300025938 Ga0207704_10006504 Ga0207704_100065043 237
279 3300025938 Ga0207704_10078860 Ga0207704_100788604 237
280 3300025938 Ga0207704_10203351 Ga0207704_102033512 237
281 3300025939 Ga0207665_10032458 Ga0207665_100324583 237
282 3300025940 Ga0207691_10078013 Ga0207691_100780133 237
283 3300025940 Ga0207691_10253516 Ga0207691_102535162 237
284 3300025941 Ga0207711_10106934 Ga0207711_101069341 237
285 3300025941 Ga0207711_10313527 Ga0207711_103135272 237
286 3300025944 Ga0207661_10039286 Ga0207661_100392866 237
287 3300025960 Ga0207651_10022466 Ga0207651_100224666 237
288 3300025960 Ga0207651_10128685 Ga0207651_101286851 237
289 3300025960 Ga0207651_10633183 Ga0207651_106331831 237
290 3300025972 Ga0207668_10040786 Ga0207668_100407864 237
291 3300025981 Ga0207640_10020664 Ga0207640_100206643 237
292 3300025981 Ga0207640_10034194 Ga0207640_100341944 237
293 3300025986 Ga0207658_10277277 Ga0207658_102772772 237
294 3300025986 Ga0207658_10413590 Ga0207658_104135902 237
295 3300026023 Ga0207677_10076506 Ga0207677_100765062 237
296 3300026023 Ga0207677_10218218 Ga0207677_102182183 237
297 3300026035 Ga0207703_10081024 Ga0207703_100810242 237
298 3300026035 Ga0207703_10170415 Ga0207703_101704152 237
299 3300026075 Ga0207708_10000853 Ga0207708_100008536 237
300 3300026088 Ga0207641_10007264 Ga0207641_100072645 237
301 3300026088 Ga0207641_10787029 Ga0207641_107870291 237
302 3300026089 Ga0207648_10019032 Ga0207648_100190323 237
303 3300026089 Ga0207648_10069106 Ga0207648_100691062 237
304 3300026089 Ga0207648_10229301 Ga0207648_102293012 237
305 3300026095 Ga0207676_10201304 Ga0207676_102013043 237
306 3300026116 Ga0207674_10484694 Ga0207674_104846942 237
307 3300026118 Ga0207675_100003224 Ga0207675_10000322410 237
308 3300026118 Ga0207675_100009178 Ga0207675_1000091787 237
309 3300026118 Ga0207675_100044619 Ga0207675_1000446194 237
310 3300026121 Ga0207683_10052789 Ga0207683_100527892 237
311 3300027907 Ga0207428_10032291 Ga0207428_100322912 237
312 3300027907 Ga0207428_10089615 Ga0207428_100896154 237
313 3300028379 Ga0268266_10015800 Ga0268266_100158009 237
314 3300028380 Ga0268265_10026761 Ga0268265_100267612 237
315 3300028380 Ga0268265_10142816 Ga0268265_101428162 237
316 3300028381 Ga0268264_10149320 Ga0268264_101493201 237
317 3300028381 Ga0268264_10309665 Ga0268264_103096652 237
318 3300028381 Ga0268264_10436279 Ga0268264_104362792 237
319 3300034816 Ga0373930_0000418 Ga0373930_0000418_2303_3043 237
320 3300034817 Ga0373948_0027259 Ga0373948_0027259_246_986 237
321 3300034818 Ga0373950_0000533 Ga0373950_0000533_1817_2557 237
322 3300034819 Ga0373958_0001291 Ga0373958_0001291_2145_2885 237
323 3300034820 Ga0373959_0007441 Ga0373959_0007441_825_1565 237
324 3300034957 Ga0373938_0002035 Ga0373938_0002035_280_1020 237
325 3300035085 Ga0373929_0000473 Ga0373929_0000473_5400_6140 237
326 3300035089 Ga0373944_0033326 Ga0373944_0033326_296_1036 237
327 3300035090 Ga0373949_0002000 Ga0373949_0002000_3456_4196 237
328 3300035091 Ga0373951_0002176 Ga0373951_0002176_2093_2833 237
329 3300035092 Ga0373952_0006207 Ga0373952_0006207_1422_2162 237
330 3300035112 Ga0373932_0000622 Ga0373932_0000622_172_912 237
331 3300035113 Ga0373936_0025837 Ga0373936_0025837_513_1253 237
332 3300035113 Ga0373936_0168213 Ga0373936_0168213_153_911 237
333 3300035114 Ga0373939_0000792 Ga0373939_0000792_4384_5124 237
334 3300035114 Ga0373939_0123695 Ga0373939_0123695_148_900 237
335 3300035114 Ga0373939_0124978 Ga0373939_0124978_110_853 237
336 3300035116 Ga0373945_0054145 Ga0373945_0054145_485_1240 237
337 3300035116 Ga0373945_0150074 Ga0373945_0150074_96_836 237
338 3300035118 Ga0373954_0219593 Ga0373954_0219593_161_910 237
339 3300035121 Ga0373960_0002786 Ga0373960_0002786_1924_2664 237
340 3300035170 Ga0373943_0001750 Ga0373943_0001750_7628_8368 237
341 3300035170 Ga0373943_0035463 Ga0373943_0035463_1566_2321 237
342 3300035172 Ga0373955_0023039 Ga0373955_0023039_1734_2474 237
343 3300035172 Ga0373955_0050044 Ga0373955_0050044_1460_2209 237
344 3300035207 Ga0373942_0002122 Ga0373942_0002122_3507_4247 237
345 3300035241 Ga0373961_0000583 Ga0373961_0000583_52_792 237
346 3300035241 Ga0373961_0135778 Ga0373961_0135778_47_790 237
347 3300035691 Ga0373931_0037542 Ga0373931_0037542_140_880 237
348 3300035692 Ga0373935_0291720 Ga0373935_0291720_23_841 237
349 3300035725 Ga0373947_0135222 Ga0373947_0135222_648_1406 237
350 3300036401 Ga0373937_0131674 Ga0373937_0131674_1544_2281 237
351 3300036401 Ga0373937_0145829 Ga0373937_0145829_455_1210 237
352 3300037068 Ga0373925_0253709 Ga0373925_0253709_150_902 237
353 3300039437 Ga0436365_0744633 Ga0436365_0744633_244_984 237
354 3300045051 Ga0451576_0005245 Ga0451576_0005245_4580_5320 237
355 3300045051 Ga0451576_0449142 Ga0451576_0449142_501_1253 237
356 3300046459 Ga0495629_0058601 Ga0495629_0058601_18_758 237
357 3300046459 Ga0495629_0115143 Ga0495629_0115143_1093_1833 237
358 3300046472 Ga0495580_0483671 Ga0495580_0483671_26_769 237
359 3300046516 Ga0495628_0022907 Ga0495628_0022907_181_921 237
360 3300046517 Ga0495630_0080371 Ga0495630_0080371_35_775 237
361 3300046529 Ga0495652_0156822 Ga0495652_0156822_872_1612 237
362 3300046543 Ga0495645_0003365 Ga0495645_0003365_952_1707 237
363 3300046543 Ga0495645_0032978 Ga0495645_0032978_83_823 237
364 3300046642 Ga0495634_0204985 Ga0495634_0204985_43_783 237
365 3300046642 Ga0495634_0336077 Ga0495634_0336077_152_892 237
366 3300046678 Ga0495599_0224182 Ga0495599_0224182_328_1080 237
367 3300046683 Ga0495658_0074802 Ga0495658_0074802_876_1634 237
368 3300046684 Ga0495669_0003805 Ga0495669_0003805_258_998 237
369 3300047319 Ga0495674_0044022 Ga0495674_0044022_1913_2653 237
370 3300047444 Ga0495675_0130001 Ga0495675_0130001_605_1366 237
371 3300047471 Ga0495684_0017270 Ga0495684_0017270_140_895 237
372 3300048905 Ga0496102_0152608 Ga0496102_0152608_115_855 237
373 3300048909 Ga0496106_0237205 Ga0496106_0237205_448_1191 237
374 3300048909 Ga0496106_0286633 Ga0496106_0286633_498_1238 237
375 3300048909 Ga0496106_0520649 Ga0496106_0520649_47_787 237
376 3300048911 Ga0496108_0437625 Ga0496108_0437625_358_1098 237
377 3300048913 Ga0496110_0478792 Ga0496110_0478792_58_801 237
378 3300048917 Ga0496114_0055436 Ga0496114_0055436_687_1430 237
379 3300048917 Ga0496114_0244560 Ga0496114_0244560_203_955 237
380 3300048918 Ga0496115_0222896 Ga0496115_0222896_434_1186 237
381 3300050507 nmdc:mga05p37_11063_c1 nmdc:mga05p37_11063_c1_1923_2675 237
382 3300050507 nmdc:mga05p37_1107_c1 nmdc:mga05p37_1107_c1_27383_28135 237
383 3300050507 nmdc:mga05p37_2169_c1 nmdc:mga05p37_2169_c1_1654_2421 237
384 3300050507 nmdc:mga05p37_308028_c1 nmdc:mga05p37_308028_c1_519_1271 237
385 3300050507 nmdc:mga05p37_36574_c1 nmdc:mga05p37_36574_c1_3256_3996 237
386 3300050507 nmdc:mga05p37_60313_c1 nmdc:mga05p37_60313_c1_1365_2129 237
387 3300050507 nmdc:mga05p37_6745_c1 nmdc:mga05p37_6745_c1_4282_5034 237
388 3300050507 nmdc:mga05p37_70288_c1 nmdc:mga05p37_70288_c1_1153_1905 237
389 3300050510 nmdc:mga06r32_119244_c1 nmdc:mga06r32_119244_c1_1793_2560 237
390 3300050511 nmdc:mga08y16_1540_c1 nmdc:mga08y16_1540_c1_9551_10288 237
391 3300050511 nmdc:mga08y16_705957_c1 nmdc:mga08y16_705957_c1_113_853 237
392 3300050511 nmdc:mga08y16_85267_c1 nmdc:mga08y16_85267_c1_1157_1897 237
393 3300050512 nmdc:mga0n895_144855_c1 nmdc:mga0n895_144855_c1_1611_2354 237
394 3300050512 nmdc:mga0n895_433761_c1 nmdc:mga0n895_433761_c1_24_764 237
395 3300050512 nmdc:mga0n895_69048_c1 nmdc:mga0n895_69048_c1_2268_3020 237
396 3300050513 nmdc:mga0rr50_1053_c1 nmdc:mga0rr50_1053_c1_2485_3225 237
397 3300050513 nmdc:mga0rr50_8677_c1 nmdc:mga0rr50_8677_c1_3036_3788 237
398 3300050514 nmdc:mga08x19_276705_c1 nmdc:mga08x19_276705_c1_111_863 237
399 3300050514 nmdc:mga08x19_55172_c1 nmdc:mga08x19_55172_c1_1390_2145 237
400 3300050515 nmdc:mga0a205_40441_c1 nmdc:mga0a205_40441_c1_3037_3780 237
401 3300050515 nmdc:mga0a205_55204_c1 nmdc:mga0a205_55204_c1_771_1523 237
402 3300053077 Ga0495601_0185984 Ga0495601_0185984_305_1066 237
403 3300053084 Ga0495595_0050406 Ga0495595_0050406_1131_1886 237
404 3300053084 Ga0495595_0057702 Ga0495595_0057702_685_1425 237
405 3300053085 Ga0495619_0013263 Ga0495619_0013263_121_861 237
406 3300053085 Ga0495619_0023867 Ga0495619_0023867_222_1040 237
407 3300053085 Ga0495619_0058757 Ga0495619_0058757_1702_2457 237
408 3300053085 Ga0495619_0289156 Ga0495619_0289156_126_887 237
409 3300060353 Ga0501082_0387078 Ga0501082_0387078_235_984 237
410 3300003322 rootL2_10035444 rootL2_100354443 238
411 3300003322 rootL2_10274380 rootL2_102743804 238
412 3300003354 JGI25160J50197_1002111 JGI25160J50197_10021113 238
413 3300005327 Ga0070658_10041296 Ga0070658_100412962 238
414 3300005329 Ga0070683_100002966 Ga0070683_1000029663 238
415 3300005329 Ga0070683_100012813 Ga0070683_1000128132 238
416 3300005329 Ga0070683_100143433 Ga0070683_1001434332 238
417 3300005329 Ga0070683_100708431 Ga0070683_1007084312 238
418 3300005330 Ga0070690_100071089 Ga0070690_1000710892 238
419 3300005331 Ga0070670_100067008 Ga0070670_1000670083 238
420 3300005331 Ga0070670_100118519 Ga0070670_1001185192 238
421 3300005334 Ga0068869_100350498 Ga0068869_1003504981 238
422 3300005335 Ga0070666_10110598 Ga0070666_101105981 238
423 3300005336 Ga0070680_100428118 Ga0070680_1004281181 238
424 3300005337 Ga0070682_100006080 Ga0070682_1000060805 238
425 3300005338 Ga0068868_100016854 Ga0068868_1000168542 238
426 3300005339 Ga0070660_100001772 Ga0070660_1000017722 238
427 3300005339 Ga0070660_100088915 Ga0070660_1000889152 238
428 3300005341 Ga0070691_10016504 Ga0070691_100165043 238
429 3300005344 Ga0070661_100052436 Ga0070661_1000524361 238
430 3300005354 Ga0070675_100225845 Ga0070675_1002258451 238
431 3300005355 Ga0070671_100060627 Ga0070671_1000606272 238
432 3300005364 Ga0070673_100046645 Ga0070673_1000466452 238
433 3300005366 Ga0070659_100002181 Ga0070659_1000021819 238
434 3300005366 Ga0070659_100027999 Ga0070659_1000279992 238
435 3300005456 Ga0070678_100535128 Ga0070678_1005351281 238
436 3300005457 Ga0070662_100004442 Ga0070662_1000044422 238
437 3300005458 Ga0070681_10256868 Ga0070681_102568682 238
438 3300005458 Ga0070681_10366477 Ga0070681_103664771 238
439 3300005530 Ga0070679_100016193 Ga0070679_1000161932 238
440 3300005535 Ga0070684_100001674 Ga0070684_1000016743 238
441 3300005535 Ga0070684_100116546 Ga0070684_1001165462 238
442 3300005539 Ga0068853_100039206 Ga0068853_1000392062 238
443 3300005539 Ga0068853_100414104 Ga0068853_1004141041 238
444 3300005543 Ga0070672_100329184 Ga0070672_1003291841 238
445 3300005563 Ga0068855_100007886 Ga0068855_10000788614 238
446 3300005564 Ga0070664_100215797 Ga0070664_1002157972 238
447 3300005564 Ga0070664_100546315 Ga0070664_1005463152 238
448 3300005577 Ga0068857_100134888 Ga0068857_1001348882 238
449 3300005614 Ga0068856_100050346 Ga0068856_1000503462 238
450 3300005616 Ga0068852_100000811 Ga0068852_10000081118 238
451 3300005616 Ga0068852_100009402 Ga0068852_1000094022 238
452 3300005616 Ga0068852_100373705 Ga0068852_1003737052 238
453 3300005618 Ga0068864_100073845 Ga0068864_1000738453 238
454 3300005834 Ga0068851_10038483 Ga0068851_100384833 238
455 3300005985 Ga0081539_10000534 Ga0081539_1000053473 238
456 3300006237 Ga0097621_100427420 Ga0097621_1004274201 238
457 3300006358 Ga0068871_100067410 Ga0068871_1000674102 238
458 3300009093 Ga0105240_10004476 Ga0105240_1000447619 238
459 3300009176 Ga0105242_10399957 Ga0105242_103999572 238
460 3300009545 Ga0105237_10056599 Ga0105237_100565993 238
461 3300010375 Ga0105239_10065838 Ga0105239_100658383 238
462 3300013100 Ga0157373_10051177 Ga0157373_100511772 238
463 3300013100 Ga0157373_10067375 Ga0157373_100673752 238
464 3300013102 Ga0157371_10058685 Ga0157371_100586853 238
465 3300013104 Ga0157370_10009537 Ga0157370_100095377 238
466 3300013104 Ga0157370_10021715 Ga0157370_100217152 238
467 3300013105 Ga0157369_10006572 Ga0157369_100065729 238
468 3300013105 Ga0157369_10012301 Ga0157369_100123013 238
469 3300013105 Ga0157369_10082698 Ga0157369_100826983 238
470 3300013105 Ga0157369_10141083 Ga0157369_101410831 238
471 3300013296 Ga0157374_10012888 Ga0157374_100128882 238
472 3300013297 Ga0157378_10008237 Ga0157378_100082372 238
473 3300013297 Ga0157378_10192631 Ga0157378_101926313 238
474 3300013306 Ga0163162_10049743 Ga0163162_100497432 238
475 3300013307 Ga0157372_10044650 Ga0157372_100446502 238
476 3300013307 Ga0157372_10229275 Ga0157372_102292752 238
477 3300013307 Ga0157372_10294157 Ga0157372_102941572 238
478 3300013307 Ga0157372_10318262 Ga0157372_103182621 238
479 3300014325 Ga0163163_10015169 Ga0163163_100151695 238
480 3300014326 Ga0157380_10307228 Ga0157380_103072282 238
481 3300014745 Ga0157377_10040237 Ga0157377_100402372 238
482 3300017792 Ga0163161_10332439 Ga0163161_103324392 238
483 3300025302 Ga0207426_1000089 Ga0207426_100008954 238
484 3300025904 Ga0207647_10006657 Ga0207647_100066576 238
485 3300025904 Ga0207647_10031783 Ga0207647_100317832 238
486 3300025912 Ga0207707_10049874 Ga0207707_100498742 238
487 3300025913 Ga0207695_10000071 Ga0207695_10000071250 238
488 3300025914 Ga0207671_10000248 Ga0207671_1000024811 238
489 3300025919 Ga0207657_10000998 Ga0207657_1000099821 238
490 3300025920 Ga0207649_10002826 Ga0207649_100028262 238
491 3300025920 Ga0207649_10214364 Ga0207649_102143642 238
492 3300025925 Ga0207650_10028461 Ga0207650_100284614 238
493 3300025931 Ga0207644_10063909 Ga0207644_100639094 238
494 3300025932 Ga0207690_10009184 Ga0207690_100091847 238
495 3300025932 Ga0207690_10028479 Ga0207690_100284792 238
496 3300025933 Ga0207706_10002259 Ga0207706_1000225910 238
497 3300025940 Ga0207691_10341327 Ga0207691_103413272 238
498 3300025944 Ga0207661_10020085 Ga0207661_100200854 238
499 3300025945 Ga0207679_10048879 Ga0207679_100488792 238
500 3300025949 Ga0207667_10000177 Ga0207667_100001773 238
501 3300025960 Ga0207651_10050546 Ga0207651_100505462 238
502 3300026023 Ga0207677_10383765 Ga0207677_103837651 238
503 3300026041 Ga0207639_10101641 Ga0207639_101016412 238
504 3300026041 Ga0207639_10251004 Ga0207639_102510042 238
505 3300026041 Ga0207639_10443745 Ga0207639_104437452 238
506 3300026116 Ga0207674_10019213 Ga0207674_100192138 238
507 3300026142 Ga0207698_10001170 Ga0207698_1000117012 238
508 3300026142 Ga0207698_10266803 Ga0207698_102668032 238
509 3300026142 Ga0207698_10717290 Ga0207698_107172902 238
510 3300027526 Ga0209968_1015784 Ga0209968_10157842 238
511 3300027543 Ga0209999_1003586 Ga0209999_10035862 238
512 3300031456 Ga0307513_10066484 Ga0307513_100664844 238
513 3300031616 Ga0307508_10003214 Ga0307508_100032143 238
514 3300031852 Ga0307410_10060932 Ga0307410_100609322 238
515 3300036401 Ga0373937_0395414 Ga0373937_0395414_307_1023 238
516 3300044712 Ga0453684_0060657 Ga0453684_0060657_972_1694 238
517 3300046462 Ga0495651_0415366 Ga0495651_0415366_125_841 238
518 3300046472 Ga0495580_0116989 Ga0495580_0116989_907_1623 238
519 3300046517 Ga0495630_0044620 Ga0495630_0044620_1651_2367 238
520 3300046681 Ga0495647_0200556 Ga0495647_0200556_75_791 238
521 3300046689 Ga0495613_0097221 Ga0495613_0097221_776_1492 238
522 3300047321 Ga0495676_0321588 Ga0495676_0321588_156_872 238
523 3300002459 JGI24751J29686_10002368 JGI24751J29686_100023684 239
524 3300005336 Ga0070680_100000254 Ga0070680_10000025431 239
525 3300005338 Ga0068868_100156497 Ga0068868_1001564973 239
526 3300005343 Ga0070687_100221673 Ga0070687_1002216731 239
527 3300005355 Ga0070671_100103512 Ga0070671_1001035121 239
528 3300005436 Ga0070713_100881147 Ga0070713_1008811471 239
529 3300005438 Ga0070701_10127810 Ga0070701_101278102 239
530 3300005544 Ga0070686_100060682 Ga0070686_1000606822 239
531 3300005577 Ga0068857_100185418 Ga0068857_1001854183 239
532 3300005614 Ga0068856_100892252 Ga0068856_1008922521 239
533 3300005615 Ga0070702_100066009 Ga0070702_1000660094 239
534 3300005834 Ga0068851_10059149 Ga0068851_100591492 239
535 3300009094 Ga0111539_10023493 Ga0111539_100234935 239
536 3300009174 Ga0105241_10029497 Ga0105241_100294972 239
537 3300009177 Ga0105248_10667104 Ga0105248_106671042 239
538 3300009545 Ga0105237_10013798 Ga0105237_100137986 239
539 3300010375 Ga0105239_10005425 Ga0105239_1000542511 239
540 3300013297 Ga0157378_10024810 Ga0157378_100248106 239
541 3300013306 Ga0163162_10190344 Ga0163162_101903442 239
542 3300013307 Ga0157372_10015680 Ga0157372_100156807 239
543 3300013307 Ga0157372_10573709 Ga0157372_105737091 239
544 3300025907 Ga0207645_10100516 Ga0207645_101005161 239
545 3300025918 Ga0207662_10012080 Ga0207662_100120806 239
546 3300025923 Ga0207681_10343052 Ga0207681_103430522 239
547 3300025933 Ga0207706_10440228 Ga0207706_104402282 239
548 3300025961 Ga0207712_10145889 Ga0207712_101458892 239
549 3300026116 Ga0207674_10123267 Ga0207674_101232672 239
550 3300026118 Ga0207675_100075323 Ga0207675_1000753233 239
551 3300027907 Ga0207428_10097245 Ga0207428_100972453 239
552 3300028794 Ga0307515_10360598 Ga0307515_103605982 239
553 3300030521 Ga0307511_10001228 Ga0307511_100012289 239
554 3300031507 Ga0307509_10050879 Ga0307509_100508792 239
555 3300031595 Ga0265313_10060807 Ga0265313_100608071 239
556 3300039437 Ga0436365_0273507 Ga0436365_0273507_109_837 239
557 3300042007 Ga0439449_0004613 Ga0439449_0004613_1611_2336 239
558 3300042015 Ga0439462_0014242 Ga0439462_0014242_176_901 239
559 3300042876 Ga0451577_0369527 Ga0451577_0369527_31_756 239
560 3300044712 Ga0453684_0061544 Ga0453684_0061544_2624_3349 239
561 3300046459 Ga0495629_0201525 Ga0495629_0201525_555_1274 239
562 3300046472 Ga0495580_0077916 Ga0495580_0077916_734_1456 239
563 3300046663 Ga0495635_0023010 Ga0495635_0023010_680_1399 239
564 3300049571 Ga0501034_0157740 Ga0501034_0157740_918_1640 239
565 3300049574 Ga0501038_0198630 Ga0501038_0198630_10_732 239
566 3300049579 Ga0501043_0236235 Ga0501043_0236235_317_1039 239
567 3300049582 Ga0501048_0135163 Ga0501048_0135163_372_1094 239
568 3300049583 Ga0501067_0028021 Ga0501067_0028021_895_1617 239
569 3300049585 Ga0501069_0017098 Ga0501069_0017098_280_1002 239
570 3300049590 Ga0501074_0248913 Ga0501074_0248913_216_938 239
571 3300049681 Ga0501251_008301 Ga0501251_008301_243_968 239
572 3300049703 Ga0501219_000027 Ga0501219_000027_4643_5368 239
573 3300049744 Ga0501083_0021747 Ga0501083_0021747_3596_4318 239
574 3300049758 Ga0501241_011086 Ga0501241_011086_823_1548 239
575 3300049823 Ga0501044_0434713 Ga0501044_0434713_384_1106 239
576 3300050005 Ga0501284_00021 Ga0501284_00021_44387_45112 239
577 3300054114 Ga0501084_0022825 Ga0501084_0022825_2753_3475 239

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03740

PdxJ

Pyridoxal phosphate biosynthesis protein PdxJ

48

279

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
6w6a-assembly1.cif.gz_A crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.967 1 237
1ixo-assembly3.cif.gz_A-2 enzyme-analogue substrate complex of pyridoxine 5'-phosphate synthase 0.9626 2 238
6w6a-assembly1.cif.gz_A crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.9556 1 237
3f4n-assembly5.cif.gz_B crystal structure of pyridoxal phosphate biosynthetic protein pdxj from yersinia pestis 0.9517 1 238
6w6a-assembly1.cif.gz_B crystal structure of a pyridoxine 5'-phosphate synthease from stenotrophomonas maltophilia k279a 0.9448 1 237
ID Description Score Start End Superfamily
3gk0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9374 2 238 3.20.20.70
3gk0A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.926 2 238 3.20.20.70
3o6cA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8971 1 237 3.20.20.70
3o6cA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8864 1 237 3.20.20.70
3t40A00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8256 2 233 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A4Q5YDM7-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.9969 1 161 GO:0005829
GO:0008615
GO:0033856
AF-A0A644VIA1-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.996 1 237 GO:0005829
GO:0008615
GO:0033856
AF-A0A353R880-F1-model_v4 Pyridoxine 5'-phosphate synthase (EC 2.6.99.2) 0.9958 1 237 GO:0005829
GO:0008615
GO:0033856
AF-A0A0K8R1V2-F1-model_v4 Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) 0.9957 1 237 GO:0005829
GO:0008615
GO:0033856
AF-A0A4U5TPU1-F1-model_v4 Pyridoxine 5'-phosphate synthase (PNP synthase) (EC 2.6.99.2) 0.9949 1 237 GO:0005829
GO:0008615
GO:0033856

Feature Viewer

pLDDT pTM Quality
94.73 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map