F465610
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 577 | 253 | 1154 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300010375|Ga0105239_10391319|Ga0105239_103913193 |
| Length | 191 |
| Sequence | MCLTMTATDTAADAAPVTAAMVVPSFDTPGSVGRKLAIICSKGNLDMAYPGLILANAALGEGVETHLFFTFWGFDMITKATMGDLKFSFVGNTAMHPPGHSGMGLHHMLGALPGATAAATTMLKKQIAEQDVPEVPEFLELLSASGAHLWACRMSADMNHLTMDDLYDGVEAIISASDFIELTEGAQLLFI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 4 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 5 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 25 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 34 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 35 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 36 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 37 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 38 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 39 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 40 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 42 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 43 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 44 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 47 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 48 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 49 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 54 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 58 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 67 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 71 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 72 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 73 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 74 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 105 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 106 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 107 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 108 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 109 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 110 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 111 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 112 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 113 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 114 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 115 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 116 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 117 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 118 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 119 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 120 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 121 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 122 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 123 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 124 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 125 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 126 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 127 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 128 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 129 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 130 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 131 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 132 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 133 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 134 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 135 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 136 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 137 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 138 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 139 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 140 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 141 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 142 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 143 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 144 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 145 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 146 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 147 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 148 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 149 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 150 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 151 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 152 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 153 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 154 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 155 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 181 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 182 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 183 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 184 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 185 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 186 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 188 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 189 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 190 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 191 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 192 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 193 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 194 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 195 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 196 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 197 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 204 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 212 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 214 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 215 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 217 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 224 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 233 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 241 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 244 | 2643221641 | Nocardioides sp. Root122 | Isolate | Unclassified |
| 245 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 246 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 247 | 2643221711 | Terrabacter sp. Root85 | Isolate | Unclassified |
| 248 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 249 | 2816332119 | Kribbella amoyensis DSM 24683 | Isolate | Rhizosphere |
| 250 | 2818991458 | Terrabacter sp. 3211 | Isolate | Rhizosphere |
| 251 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 252 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 253 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 94.8 |
| Metatranscriptomes | 3.47 |
| Isolates | 1.73 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.21 |
| Nodule | 0 |
| Rhizoplane | 12.65 |
| Rhizosphere | 81.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0105239_10391319 | 3300010375 | Bacteria | 1572 |
| 2 | JGI24740J21852_10037969 | 3300001979 | Bacteria | 1482 |
| 3 | JGI24739J22299_10004236 | 3300001989 | Bacteria | 5491 |
| 4 | JGI24737J22298_10015912 | 3300001990 | Bacteria | 2430 |
| 5 | JGI24735J21928_10027814 | 3300002067 | Bacteria | 1692 |
| 6 | JGI24735J21928_10125502 | 3300002067 | Bacteria | 739 |
| 7 | rootH2_10125301 | 3300003320 | Bacteria | 3188 |
| 8 | Ga0058862_10080988 | 3300004803 | Bacteria | 1016 |
| 9 | Ga0070683_100004382 | 3300005329 | Bacteria | 11613 |
| 10 | Ga0070683_100076599 | 3300005329 | Bacteria | 3127 |
| 11 | Ga0070683_100152959 | 3300005329 | Bacteria | 2187 |
| 12 | Ga0070683_100239226 | 3300005329 | Bacteria | 1727 |
| 13 | Ga0070683_100299526 | 3300005329 | Bacteria | 1530 |
| 14 | Ga0070683_100966077 | 3300005329 | Bacteria | 818 |
| 15 | Ga0070682_100385133 | 3300005337 | Bacteria | 1056 |
| 16 | Ga0070682_101120120 | 3300005337 | Bacteria | 660 |
| 17 | Ga0070675_100290144 | 3300005354 | Bacteria | 1440 |
| 18 | Ga0070671_100802121 | 3300005355 | Bacteria | 820 |
| 19 | Ga0070659_100157070 | 3300005366 | Bacteria | 1858 |
| 20 | Ga0070667_100120679 | 3300005367 | Bacteria | 2280 |
| 21 | Ga0070667_100179649 | 3300005367 | Bacteria | 1871 |
| 22 | Ga0070713_100112103 | 3300005436 | Bacteria | 2380 |
| 23 | Ga0070713_100887985 | 3300005436 | Bacteria | 857 |
| 24 | Ga0070701_10503235 | 3300005438 | Bacteria | 787 |
| 25 | Ga0070708_100079567 | 3300005445 | Bacteria | 2965 |
| 26 | Ga0070708_100774547 | 3300005445 | Bacteria | 902 |
| 27 | Ga0070681_10370807 | 3300005458 | Bacteria | 1342 |
| 28 | Ga0070681_10874707 | 3300005458 | Bacteria | 817 |
| 29 | Ga0070685_10486304 | 3300005466 | Bacteria | 871 |
| 30 | Ga0070706_100093295 | 3300005467 | Bacteria | 2793 |
| 31 | Ga0070706_100141862 | 3300005467 | Bacteria | 2242 |
| 32 | Ga0070707_100065707 | 3300005468 | Bacteria | 3485 |
| 33 | Ga0070707_100146729 | 3300005468 | Bacteria | 2296 |
| 34 | Ga0070707_100277024 | 3300005468 | Bacteria | 1631 |
| 35 | Ga0070707_101048773 | 3300005468 | Bacteria | 781 |
| 36 | Ga0070698_100000167 | 3300005471 | Bacteria | 60583 |
| 37 | Ga0070698_100070783 | 3300005471 | Bacteria | 3499 |
| 38 | Ga0070699_100097703 | 3300005518 | Bacteria | 2573 |
| 39 | Ga0070684_100179781 | 3300005535 | Bacteria | 1923 |
| 40 | Ga0070684_100198332 | 3300005535 | Bacteria | 1828 |
| 41 | Ga0070684_100301838 | 3300005535 | Bacteria | 1469 |
| 42 | Ga0070684_101273349 | 3300005535 | Bacteria | 692 |
| 43 | Ga0068853_100383376 | 3300005539 | Bacteria | 1313 |
| 44 | Ga0070686_100723175 | 3300005544 | Bacteria | 796 |
| 45 | Ga0070665_100125650 | 3300005548 | Bacteria | 2567 |
| 46 | Ga0070704_101831796 | 3300005549 | Bacteria | 562 |
| 47 | Ga0068855_100038776 | 3300005563 | Bacteria | 5659 |
| 48 | Ga0070664_100040849 | 3300005564 | Bacteria | 3913 |
| 49 | Ga0070664_100047083 | 3300005564 | Bacteria | 3643 |
| 50 | Ga0070664_100146863 | 3300005564 | Bacteria | 2080 |
| 51 | Ga0068857_100048670 | 3300005577 | Bacteria | 3763 |
| 52 | Ga0068857_100106437 | 3300005577 | Bacteria | 2519 |
| 53 | Ga0068856_100273961 | 3300005614 | Bacteria | 1704 |
| 54 | Ga0070702_100192936 | 3300005615 | Bacteria | 1342 |
| 55 | Ga0070702_100654320 | 3300005615 | Bacteria | 795 |
| 56 | Ga0068852_100048221 | 3300005616 | Bacteria | 3639 |
| 57 | Ga0068852_100248276 | 3300005616 | Bacteria | 1704 |
| 58 | Ga0068859_100098146 | 3300005617 | Bacteria | 2983 |
| 59 | Ga0068864_100012262 | 3300005618 | Bacteria | 7083 |
| 60 | Ga0068863_100040671 | 3300005841 | Bacteria | 4420 |
| 61 | Ga0068858_100000711 | 3300005842 | Bacteria | 34748 |
| 62 | Ga0068860_100037608 | 3300005843 | Bacteria | 4633 |
| 63 | Ga0068862_100106849 | 3300005844 | Bacteria | 2454 |
| 64 | Ga0070717_10002580 | 3300006028 | Bacteria | 12786 |
| 65 | Ga0070717_10077064 | 3300006028 | Bacteria | 2791 |
| 66 | Ga0070717_10516069 | 3300006028 | Bacteria | 1081 |
| 67 | Ga0075365_10281741 | 3300006038 | Bacteria | 1170 |
| 68 | Ga0075363_100119088 | 3300006048 | Bacteria | 1473 |
| 69 | Ga0075363_100179302 | 3300006048 | Bacteria | 1205 |
| 70 | Ga0075364_10187971 | 3300006051 | Bacteria | 1398 |
| 71 | Ga0070715_10139243 | 3300006163 | Bacteria | 1177 |
| 72 | Ga0068871_100634948 | 3300006358 | Bacteria | 974 |
| 73 | Ga0075430_100017753 | 3300006846 | Bacteria | 6057 |
| 74 | Ga0075431_100026443 | 3300006847 | Bacteria | 5955 |
| 75 | Ga0075431_100036298 | 3300006847 | Bacteria | 5076 |
| 76 | Ga0075431_100883401 | 3300006847 | Bacteria | 864 |
| 77 | Ga0097620_100098147 | 3300006931 | Bacteria | 2983 |
| 78 | Ga0105244_10053418 | 3300009036 | Bacteria | 2053 |
| 79 | Ga0105240_10022984 | 3300009093 | Bacteria | 8258 |
| 80 | Ga0105245_10110932 | 3300009098 | Bacteria | 2551 |
| 81 | Ga0105247_10936709 | 3300009101 | Bacteria | 672 |
| 82 | Ga0114129_10000446 | 3300009147 | Bacteria | 49171 |
| 83 | Ga0114129_10017220 | 3300009147 | Bacteria | 10293 |
| 84 | Ga0114129_10079579 | 3300009147 | Bacteria | 4557 |
| 85 | Ga0114129_10345504 | 3300009147 | Bacteria | 1972 |
| 86 | Ga0105248_10482283 | 3300009177 | Bacteria | 1398 |
| 87 | Ga0105237_11300301 | 3300009545 | Bacteria | 734 |
| 88 | Ga0105238_10616083 | 3300009551 | Bacteria | 1094 |
| 89 | Ga0105249_10000893 | 3300009553 | Bacteria | 26438 |
| 90 | Ga0105239_10392837 | 3300010375 | Bacteria | 1569 |
| 91 | Ga0105239_12028300 | 3300010375 | Bacteria | 668 |
| 92 | Ga0105246_10095631 | 3300011119 | Bacteria | 2151 |
| 93 | Ga0105246_10863297 | 3300011119 | Bacteria | 808 |
| 94 | Ga0157370_10022781 | 3300013104 | Bacteria | 6231 |
| 95 | Ga0157370_10122351 | 3300013104 | Bacteria | 2430 |
| 96 | Ga0157369_10006061 | 3300013105 | Bacteria | 14029 |
| 97 | Ga0157369_10223620 | 3300013105 | Bacteria | 1970 |
| 98 | Ga0157374_11322181 | 3300013296 | Bacteria | 743 |
| 99 | Ga0157374_11554555 | 3300013296 | Bacteria | 685 |
| 100 | Ga0163162_10567120 | 3300013306 | Bacteria | 1263 |
| 101 | Ga0163162_11184837 | 3300013306 | Bacteria | 867 |
| 102 | Ga0157372_10032804 | 3300013307 | Bacteria | 5697 |
| 103 | Ga0157372_10193545 | 3300013307 | Bacteria | 2355 |
| 104 | Ga0157372_10253045 | 3300013307 | Bacteria | 2045 |
| 105 | Ga0157372_10510595 | 3300013307 | Bacteria | 1401 |
| 106 | Ga0157372_11591634 | 3300013307 | Bacteria | 752 |
| 107 | Ga0157372_12182363 | 3300013307 | Bacteria | 636 |
| 108 | Ga0157375_10267154 | 3300013308 | Bacteria | 1872 |
| 109 | Ga0157375_10938015 | 3300013308 | Bacteria | 1008 |
| 110 | Ga0157375_11051547 | 3300013308 | Bacteria | 952 |
| 111 | Ga0163163_10001227 | 3300014325 | Bacteria | 21689 |
| 112 | Ga0163163_10482173 | 3300014325 | Bacteria | 1301 |
| 113 | Ga0163163_11504947 | 3300014325 | Bacteria | 734 |
| 114 | Ga0157377_10240681 | 3300014745 | Bacteria | 1168 |
| 115 | Ga0157379_10000496 | 3300014968 | Bacteria | 32033 |
| 116 | Ga0157379_10066281 | 3300014968 | Bacteria | 3228 |
| 117 | Ga0157376_11561972 | 3300014969 | Bacteria | 694 |
| 118 | Ga0163161_10431974 | 3300017792 | Bacteria | 1061 |
| 119 | Ga0206356_11321571 | 3300020070 | Bacteria | 1082 |
| 120 | Ga0206354_10964057 | 3300020081 | Bacteria | 972 |
| 121 | Ga0206353_10597598 | 3300020082 | Bacteria | 1312 |
| 122 | Ga0224712_10145637 | 3300022467 | Bacteria | 1046 |
| 123 | Ga0207680_10839634 | 3300025903 | Bacteria | 659 |
| 124 | Ga0207647_10025454 | 3300025904 | Bacteria | 3887 |
| 125 | Ga0207684_10114196 | 3300025910 | Bacteria | 2313 |
| 126 | Ga0207684_11225782 | 3300025910 | Bacteria | 620 |
| 127 | Ga0207695_10067138 | 3300025913 | Bacteria | 3680 |
| 128 | Ga0207662_10387081 | 3300025918 | Bacteria | 946 |
| 129 | Ga0207646_10001990 | 3300025922 | Bacteria | 24555 |
| 130 | Ga0207646_10222018 | 3300025922 | Bacteria | 1707 |
| 131 | Ga0207646_10778386 | 3300025922 | Bacteria | 853 |
| 132 | Ga0207694_10665384 | 3300025924 | Bacteria | 878 |
| 133 | Ga0207650_10155885 | 3300025925 | Bacteria | 1806 |
| 134 | Ga0207659_10340586 | 3300025926 | Bacteria | 1242 |
| 135 | Ga0207700_10311499 | 3300025928 | Bacteria | 1362 |
| 136 | Ga0207700_10496692 | 3300025928 | Bacteria | 1079 |
| 137 | Ga0207690_10287003 | 3300025932 | Bacteria | 1283 |
| 138 | Ga0207709_10656604 | 3300025935 | Bacteria | 835 |
| 139 | Ga0207704_10629569 | 3300025938 | Bacteria | 881 |
| 140 | Ga0207661_10004109 | 3300025944 | Bacteria | 10176 |
| 141 | Ga0207661_10196393 | 3300025944 | Bacteria | 1772 |
| 142 | Ga0207661_10507175 | 3300025944 | Bacteria | 1102 |
| 143 | Ga0207661_10985785 | 3300025944 | Bacteria | 776 |
| 144 | Ga0207679_10047736 | 3300025945 | Bacteria | 3113 |
| 145 | Ga0207679_10060876 | 3300025945 | Bacteria | 2807 |
| 146 | Ga0207667_10036906 | 3300025949 | Bacteria | 5231 |
| 147 | Ga0207651_10363944 | 3300025960 | Bacteria | 1222 |
| 148 | Ga0207712_10540744 | 3300025961 | Bacteria | 1001 |
| 149 | Ga0207640_10354688 | 3300025981 | Bacteria | 1180 |
| 150 | Ga0207658_10155297 | 3300025986 | Bacteria | 1869 |
| 151 | Ga0207703_10000003 | 3300026035 | Bacteria | 532213 |
| 152 | Ga0207708_10204174 | 3300026075 | Bacteria | 1577 |
| 153 | Ga0207641_10135016 | 3300026088 | Bacteria | 2220 |
| 154 | Ga0207648_11156929 | 3300026089 | Bacteria | 726 |
| 155 | Ga0207676_11314930 | 3300026095 | Bacteria | 718 |
| 156 | Ga0207674_10070526 | 3300026116 | Bacteria | 3513 |
| 157 | Ga0207674_10124423 | 3300026116 | Bacteria | 2545 |
| 158 | Ga0207674_10139576 | 3300026116 | Bacteria | 2384 |
| 159 | Ga0207683_10559739 | 3300026121 | Bacteria | 1057 |
| 160 | Ga0207698_10235717 | 3300026142 | Bacteria | 1664 |
| 161 | Ga0268265_10088370 | 3300028380 | Bacteria | 2469 |
| 162 | Ga0268264_10000576 | 3300028381 | Bacteria | 44482 |
| 163 | Ga0307511_10249176 | 3300030521 | Bacteria | 856 |
| 164 | Ga0307512_10032691 | 3300030522 | Bacteria | 4486 |
| 165 | Ga0307513_10245825 | 3300031456 | Bacteria | 1590 |
| 166 | Ga0307509_10061552 | 3300031507 | Bacteria | 3961 |
| 167 | Ga0307508_10000257 | 3300031616 | Bacteria | 64856 |
| 168 | Ga0307508_10078356 | 3300031616 | Bacteria | 2885 |
| 169 | Ga0307508_10092278 | 3300031616 | Bacteria | 2617 |
| 170 | Ga0307508_10192307 | 3300031616 | Bacteria | 1642 |
| 171 | Ga0307508_10251106 | 3300031616 | Bacteria | 1365 |
| 172 | Ga0316575_10000001 | 3300031665 | Bacteria | 151281 |
| 173 | Ga0316575_10006580 | 3300031665 | Bacteria | 4186 |
| 174 | Ga0316575_10018297 | 3300031665 | Bacteria | 2669 |
| 175 | Ga0316579_10025854 | 3300031691 | Bacteria | 2653 |
| 176 | Ga0316576_10001855 | 3300031727 | Bacteria | 11735 |
| 177 | Ga0316576_10003125 | 3300031727 | Bacteria | 9657 |
| 178 | Ga0316576_10012522 | 3300031727 | Bacteria | 5606 |
| 179 | Ga0316576_10014073 | 3300031727 | Bacteria | 5335 |
| 180 | Ga0316576_10016161 | 3300031727 | Bacteria | 5031 |
| 181 | Ga0316576_10099693 | 3300031727 | Bacteria | 2170 |
| 182 | Ga0316578_10001048 | 3300031728 | Bacteria | 10658 |
| 183 | Ga0316578_10002819 | 3300031728 | Bacteria | 7765 |
| 184 | Ga0316578_10031988 | 3300031728 | Bacteria | 3002 |
| 185 | Ga0316578_10278384 | 3300031728 | Unclassified | 1002 |
| 186 | Ga0307516_10000971 | 3300031730 | Bacteria | 39615 |
| 187 | Ga0307516_10018849 | 3300031730 | Bacteria | 7163 |
| 188 | Ga0307405_10114693 | 3300031731 | Bacteria | 1832 |
| 189 | Ga0307405_10464294 | 3300031731 | Bacteria | 1007 |
| 190 | Ga0307405_10483614 | 3300031731 | Bacteria | 989 |
| 191 | Ga0316577_10015105 | 3300031733 | Bacteria | 4245 |
| 192 | Ga0307518_10208947 | 3300031838 | Bacteria | 1287 |
| 193 | Ga0307406_10816305 | 3300031901 | Bacteria | 788 |
| 194 | Ga0307407_10505317 | 3300031903 | Bacteria | 887 |
| 195 | Ga0307409_100669195 | 3300031995 | Bacteria | 1034 |
| 196 | Ga0307416_100781885 | 3300032002 | Bacteria | 1049 |
| 197 | Ga0307411_10602544 | 3300032005 | Bacteria | 945 |
| 198 | Ga0307415_100178928 | 3300032126 | Bacteria | 1662 |
| 199 | Ga0307415_100349031 | 3300032126 | Bacteria | 1245 |
| 200 | Ga0316583_10016250 | 3300032133 | Bacteria | 2679 |
| 201 | Ga0316580_10008879 | 3300032139 | Bacteria | 3017 |
| 202 | Ga0316593_10010743 | 3300032168 | Bacteria | 2639 |
| 203 | Ga0316593_10037548 | 3300032168 | Bacteria | 1601 |
| 204 | Ga0307507_10006363 | 3300033179 | Bacteria | 18205 |
| 205 | Ga0307507_10345157 | 3300033179 | Bacteria | 879 |
| 206 | Ga0307510_10231897 | 3300033180 | Bacteria | 1348 |
| 207 | Ga0307510_10424959 | 3300033180 | Bacteria | 771 |
| 208 | Ga0316592_1003717 | 3300033524 | Bacteria | 2779 |
| 209 | Ga0316592_1005174 | 3300033524 | Bacteria | 2465 |
| 210 | Ga0316592_1090381 | 3300033524 | Bacteria | 700 |
| 211 | Ga0316592_1098912 | 3300033524 | Bacteria | 670 |
| 212 | Ga0316586_1002852 | 3300033527 | Bacteria | 2206 |
| 213 | Ga0316586_1002860 | 3300033527 | Bacteria | 2205 |
| 214 | Ga0316586_1003219 | 3300033527 | Bacteria | 2123 |
| 215 | Ga0316588_1006018 | 3300033528 | Bacteria | 2403 |
| 216 | Ga0316588_1008292 | 3300033528 | Bacteria | 2134 |
| 217 | Ga0316587_1005909 | 3300033529 | Bacteria | 1853 |
| 218 | Ga0316587_1008153 | 3300033529 | Bacteria | 1642 |
| 219 | Ga0316596_1021059 | 3300033541 | Bacteria | 1660 |
| 220 | Ga0316596_1047854 | 3300033541 | Bacteria | 1130 |
| 221 | Ga0373926_0002478 | 3300035083 | Bacteria | 5860 |
| 222 | Ga0373944_0069349 | 3300035089 | Bacteria | 1146 |
| 223 | Ga0373945_0159170 | 3300035116 | Bacteria | 920 |
| 224 | Ga0373953_0026457 | 3300035117 | Bacteria | 2222 |
| 225 | Ga0373954_0181872 | 3300035118 | Bacteria | 1031 |
| 226 | Ga0373954_0203310 | 3300035118 | Bacteria | 973 |
| 227 | Ga0373957_0116108 | 3300035120 | Bacteria | 1081 |
| 228 | Ga0316574_0007004 | 3300035398 | Bacteria | 6143 |
| 229 | Ga0316574_0024394 | 3300035398 | Bacteria | 3618 |
| 230 | Ga0316574_0049046 | 3300035398 | Bacteria | 2624 |
| 231 | Ga0316574_0067076 | 3300035398 | Bacteria | 2262 |
| 232 | Ga0373935_0004573 | 3300035692 | Bacteria | 8136 |
| 233 | Ga0373933_0426916 | 3300035724 | Bacteria | 866 |
| 234 | Ga0373947_0000016 | 3300035725 | Bacteria | 124284 |
| 235 | Ga0373947_0742182 | 3300035725 | Bacteria | 670 |
| 236 | Ga0373937_0065201 | 3300036401 | Bacteria | 3352 |
| 237 | Ga0373937_0208514 | 3300036401 | Bacteria | 1838 |
| 238 | Ga0316582_0000644 | 3300036647 | Bacteria | 13652 |
| 239 | Ga0316584_0001926 | 3300036712 | Bacteria | 12926 |
| 240 | Ga0316584_0072705 | 3300036712 | Bacteria | 2577 |
| 241 | Ga0373925_1144918 | 3300037068 | Bacteria | 640 |
| 242 | Ga0395899_0013499 | 3300037312 | Bacteria | 6244 |
| 243 | Ga0395900_0041356 | 3300037418 | Bacteria | 4752 |
| 244 | Ga0395900_0066094 | 3300037418 | Bacteria | 3716 |
| 245 | Ga0395898_0014539 | 3300037466 | Bacteria | 8083 |
| 246 | Ga0395898_0286805 | 3300037466 | Bacteria | 1570 |
| 247 | Ga0395898_0481099 | 3300037466 | Bacteria | 1181 |
| 248 | Ga0395905_0051830 | 3300037471 | Bacteria | 3844 |
| 249 | Ga0395905_0841234 | 3300037471 | Bacteria | 821 |
| 250 | Ga0395901_0044705 | 3300038443 | Bacteria | 4593 |
| 251 | Ga0395901_0092082 | 3300038443 | Bacteria | 3173 |
| 252 | Ga0395901_0109967 | 3300038443 | Bacteria | 2893 |
| 253 | Ga0395901_0172455 | 3300038443 | Bacteria | 2269 |
| 254 | Ga0451795_0369261 | 3300041456 | Bacteria | 590 |
| 255 | Ga0439448_0072595 | 3300042005 | Bacteria | 1147 |
| 256 | Ga0439440_0019925 | 3300042993 | Bacteria | 1501 |
| 257 | Ga0495592_0588876 | 3300046454 | Bacteria | 680 |
| 258 | Ga0495629_0069268 | 3300046459 | Bacteria | 2462 |
| 259 | Ga0495629_0165108 | 3300046459 | Bacteria | 1538 |
| 260 | Ga0495629_0524457 | 3300046459 | Bacteria | 797 |
| 261 | Ga0495651_0071639 | 3300046462 | Bacteria | 2635 |
| 262 | Ga0495653_0219721 | 3300046463 | Bacteria | 1278 |
| 263 | Ga0495582_0111158 | 3300046473 | Bacteria | 1539 |
| 264 | Ga0495594_0001619 | 3300046499 | Bacteria | 11714 |
| 265 | Ga0495630_0159739 | 3300046517 | Bacteria | 1716 |
| 266 | Ga0495630_0352542 | 3300046517 | Bacteria | 1126 |
| 267 | Ga0495630_0847242 | 3300046517 | Bacteria | 697 |
| 268 | Ga0495587_0356737 | 3300046536 | Bacteria | 814 |
| 269 | Ga0495597_0140570 | 3300046542 | Bacteria | 996 |
| 270 | Ga0495667_0117646 | 3300046559 | Bacteria | 1717 |
| 271 | Ga0495634_0328364 | 3300046642 | Bacteria | 920 |
| 272 | Ga0495611_0282923 | 3300046648 | Bacteria | 766 |
| 273 | Ga0495635_0293396 | 3300046663 | Bacteria | 1091 |
| 274 | Ga0495635_0364056 | 3300046663 | Bacteria | 964 |
| 275 | Ga0495623_0141893 | 3300046679 | Bacteria | 1428 |
| 276 | Ga0495658_0822974 | 3300046683 | Bacteria | 594 |
| 277 | Ga0495613_0511382 | 3300046689 | Bacteria | 808 |
| 278 | Ga0495624_0254755 | 3300046690 | Bacteria | 1061 |
| 279 | Ga0495600_0456261 | 3300046809 | Bacteria | 790 |
| 280 | Ga0495581_0225552 | 3300047315 | Bacteria | 1096 |
| 281 | Ga0495604_0286988 | 3300047317 | Bacteria | 1110 |
| 282 | Ga0495674_0284612 | 3300047319 | Bacteria | 1354 |
| 283 | Ga0495680_0162001 | 3300047322 | Bacteria | 1624 |
| 284 | Ga0495680_0719675 | 3300047322 | Bacteria | 658 |
| 285 | Ga0495602_0391639 | 3300048088 | Bacteria | 993 |
| 286 | Ga0496100_0019527 | 3300048903 | Bacteria | 4045 |
| 287 | Ga0496100_0378880 | 3300048903 | Bacteria | 1074 |
| 288 | Ga0496100_0751785 | 3300048903 | Bacteria | 762 |
| 289 | Ga0496100_0968287 | 3300048903 | Bacteria | 669 |
| 290 | Ga0496101_0070878 | 3300048904 | Bacteria | 2553 |
| 291 | Ga0496101_0078501 | 3300048904 | Bacteria | 2435 |
| 292 | Ga0496101_0256504 | 3300048904 | Bacteria | 1363 |
| 293 | Ga0496101_0379792 | 3300048904 | Bacteria | 1112 |
| 294 | Ga0496102_0043496 | 3300048905 | Bacteria | 4073 |
| 295 | Ga0496102_0128008 | 3300048905 | Bacteria | 2375 |
| 296 | Ga0496102_0183995 | 3300048905 | Bacteria | 1968 |
| 297 | Ga0496102_0786280 | 3300048905 | Bacteria | 874 |
| 298 | Ga0496102_1388244 | 3300048905 | Bacteria | 621 |
| 299 | Ga0496103_0397558 | 3300048906 | Bacteria | 885 |
| 300 | Ga0496104_0012699 | 3300048907 | Bacteria | 7585 |
| 301 | Ga0496104_0013216 | 3300048907 | Bacteria | 7442 |
| 302 | Ga0496104_0054560 | 3300048907 | Bacteria | 3777 |
| 303 | Ga0496104_0077992 | 3300048907 | Bacteria | 3156 |
| 304 | Ga0496104_0269581 | 3300048907 | Bacteria | 1615 |
| 305 | Ga0496104_0395329 | 3300048907 | Bacteria | 1295 |
| 306 | Ga0496104_1213473 | 3300048907 | Bacteria | 657 |
| 307 | Ga0496105_0001090 | 3300048908 | Bacteria | 18828 |
| 308 | Ga0496105_0048618 | 3300048908 | Bacteria | 3501 |
| 309 | Ga0496105_0212589 | 3300048908 | Bacteria | 1576 |
| 310 | Ga0496106_0098627 | 3300048909 | Bacteria | 2264 |
| 311 | Ga0496106_0268328 | 3300048909 | Bacteria | 1366 |
| 312 | Ga0496107_0147590 | 3300048910 | Bacteria | 1739 |
| 313 | Ga0496107_0313579 | 3300048910 | Bacteria | 1167 |
| 314 | Ga0496107_0826072 | 3300048910 | Bacteria | 678 |
| 315 | Ga0496108_0085788 | 3300048911 | Bacteria | 2673 |
| 316 | Ga0496108_0136169 | 3300048911 | Bacteria | 2113 |
| 317 | Ga0496108_0201650 | 3300048911 | Bacteria | 1727 |
| 318 | Ga0496108_0205894 | 3300048911 | Bacteria | 1707 |
| 319 | Ga0496108_0687988 | 3300048911 | Bacteria | 887 |
| 320 | Ga0496109_0060676 | 3300048912 | Bacteria | 3456 |
| 321 | Ga0496109_0173692 | 3300048912 | Bacteria | 2022 |
| 322 | Ga0496109_0174638 | 3300048912 | Bacteria | 2016 |
| 323 | Ga0496109_0323533 | 3300048912 | Bacteria | 1455 |
| 324 | Ga0496109_0561377 | 3300048912 | Bacteria | 1077 |
| 325 | Ga0496109_1270614 | 3300048912 | Bacteria | 672 |
| 326 | Ga0496110_0003609 | 3300048913 | Bacteria | 11907 |
| 327 | Ga0496110_0008319 | 3300048913 | Bacteria | 8345 |
| 328 | Ga0496110_0045745 | 3300048913 | Bacteria | 3827 |
| 329 | Ga0496110_0201194 | 3300048913 | Bacteria | 1810 |
| 330 | Ga0496110_0207977 | 3300048913 | Bacteria | 1778 |
| 331 | Ga0496110_0283926 | 3300048913 | Bacteria | 1507 |
| 332 | Ga0496110_0441373 | 3300048913 | Bacteria | 1186 |
| 333 | Ga0496110_0456922 | 3300048913 | Bacteria | 1164 |
| 334 | Ga0496110_0592145 | 3300048913 | Bacteria | 1006 |
| 335 | Ga0496111_0014665 | 3300048914 | Bacteria | 5359 |
| 336 | Ga0496111_0076504 | 3300048914 | Bacteria | 2439 |
| 337 | Ga0496111_0082819 | 3300048914 | Bacteria | 2343 |
| 338 | Ga0496111_0548961 | 3300048914 | Bacteria | 848 |
| 339 | Ga0496112_0016267 | 3300048915 | Bacteria | 6963 |
| 340 | Ga0496112_0129931 | 3300048915 | Bacteria | 2490 |
| 341 | Ga0496112_0153329 | 3300048915 | Bacteria | 2271 |
| 342 | Ga0496112_0294495 | 3300048915 | Bacteria | 1569 |
| 343 | Ga0496112_0594442 | 3300048915 | Bacteria | 1039 |
| 344 | Ga0496112_0774484 | 3300048915 | Bacteria | 885 |
| 345 | Ga0496112_0927682 | 3300048915 | Bacteria | 792 |
| 346 | Ga0496113_0046173 | 3300048916 | Bacteria | 3233 |
| 347 | Ga0496113_0114099 | 3300048916 | Bacteria | 2106 |
| 348 | Ga0496113_0200246 | 3300048916 | Bacteria | 1587 |
| 349 | Ga0496114_0024705 | 3300048917 | Bacteria | 4905 |
| 350 | Ga0496114_0028407 | 3300048917 | Bacteria | 4590 |
| 351 | Ga0496114_0059472 | 3300048917 | Bacteria | 3192 |
| 352 | Ga0496114_0075148 | 3300048917 | Bacteria | 2845 |
| 353 | Ga0496114_0196107 | 3300048917 | Bacteria | 1767 |
| 354 | Ga0496114_0421403 | 3300048917 | Bacteria | 1182 |
| 355 | Ga0496115_0282477 | 3300048918 | Bacteria | 1362 |
| 356 | Ga0496115_0385750 | 3300048918 | Bacteria | 1139 |
| 357 | Ga0496115_0750339 | 3300048918 | Bacteria | 763 |
| 358 | Ga0496116_0000119 | 3300048919 | Bacteria | 167176 |
| 359 | Ga0496117_0003284 | 3300048920 | Bacteria | 18969 |
| 360 | Ga0496118_0005228 | 3300048921 | Bacteria | 14842 |
| 361 | Ga0496119_0019280 | 3300048922 | Bacteria | 5033 |
| 362 | Ga0496119_0032234 | 3300048922 | Bacteria | 3496 |
| 363 | Ga0496121_0007235 | 3300048924 | Bacteria | 13436 |
| 364 | Ga0501031_0000913 | 3300049568 | Bacteria | 17795 |
| 365 | Ga0501031_0003686 | 3300049568 | Bacteria | 9853 |
| 366 | Ga0501031_0154404 | 3300049568 | Bacteria | 1500 |
| 367 | Ga0501031_0387025 | 3300049568 | Bacteria | 905 |
| 368 | Ga0501031_0399406 | 3300049568 | Bacteria | 889 |
| 369 | Ga0501032_0017012 | 3300049569 | Bacteria | 5108 |
| 370 | Ga0501033_0019148 | 3300049570 | Bacteria | 5176 |
| 371 | Ga0501033_0072571 | 3300049570 | Bacteria | 2527 |
| 372 | Ga0501034_0018841 | 3300049571 | Bacteria | 7074 |
| 373 | Ga0501034_0333987 | 3300049571 | Bacteria | 1447 |
| 374 | Ga0501034_0392370 | 3300049571 | Bacteria | 1312 |
| 375 | Ga0501036_0007899 | 3300049572 | Bacteria | 8702 |
| 376 | Ga0501036_0016566 | 3300049572 | Bacteria | 6155 |
| 377 | Ga0501036_0047610 | 3300049572 | Bacteria | 3631 |
| 378 | Ga0501036_0349509 | 3300049572 | Bacteria | 1235 |
| 379 | Ga0501036_0409775 | 3300049572 | Bacteria | 1130 |
| 380 | Ga0501036_0522691 | 3300049572 | Bacteria | 987 |
| 381 | Ga0501036_1267481 | 3300049572 | Bacteria | 600 |
| 382 | Ga0501037_0206703 | 3300049573 | Bacteria | 1386 |
| 383 | Ga0501037_0573909 | 3300049573 | Bacteria | 759 |
| 384 | Ga0501038_0064012 | 3300049574 | Bacteria | 3137 |
| 385 | Ga0501038_0098474 | 3300049574 | Bacteria | 2438 |
| 386 | Ga0501038_0514147 | 3300049574 | Bacteria | 914 |
| 387 | Ga0501038_0641834 | 3300049574 | Bacteria | 800 |
| 388 | Ga0501039_0006409 | 3300049575 | Bacteria | 8942 |
| 389 | Ga0501039_0039448 | 3300049575 | Bacteria | 3647 |
| 390 | Ga0501039_0061799 | 3300049575 | Bacteria | 2901 |
| 391 | Ga0501039_0171481 | 3300049575 | Bacteria | 1706 |
| 392 | Ga0501039_0713248 | 3300049575 | Bacteria | 784 |
| 393 | Ga0501040_0008866 | 3300049576 | Bacteria | 6536 |
| 394 | Ga0501040_0009396 | 3300049576 | Bacteria | 6372 |
| 395 | Ga0501040_0009452 | 3300049576 | Bacteria | 6358 |
| 396 | Ga0501040_0081484 | 3300049576 | Bacteria | 2243 |
| 397 | Ga0501040_0089468 | 3300049576 | Bacteria | 2139 |
| 398 | Ga0501040_0292823 | 3300049576 | Bacteria | 1163 |
| 399 | Ga0501040_0792188 | 3300049576 | Bacteria | 686 |
| 400 | Ga0501041_0006357 | 3300049577 | Bacteria | 6913 |
| 401 | Ga0501041_0009306 | 3300049577 | Bacteria | 5785 |
| 402 | Ga0501041_0018970 | 3300049577 | Bacteria | 4099 |
| 403 | Ga0501041_0048898 | 3300049577 | Bacteria | 2576 |
| 404 | Ga0501041_0213663 | 3300049577 | Bacteria | 1210 |
| 405 | Ga0501041_0374929 | 3300049577 | Bacteria | 900 |
| 406 | Ga0501041_0531404 | 3300049577 | Bacteria | 749 |
| 407 | Ga0501042_0003198 | 3300049578 | Bacteria | 10234 |
| 408 | Ga0501042_0008662 | 3300049578 | Bacteria | 6740 |
| 409 | Ga0501042_0034546 | 3300049578 | Bacteria | 3586 |
| 410 | Ga0501042_0045049 | 3300049578 | Bacteria | 3144 |
| 411 | Ga0501042_0094190 | 3300049578 | Bacteria | 2151 |
| 412 | Ga0501042_0343597 | 3300049578 | Bacteria | 1079 |
| 413 | Ga0501042_0351582 | 3300049578 | Bacteria | 1066 |
| 414 | Ga0501042_0467014 | 3300049578 | Bacteria | 915 |
| 415 | Ga0501042_0475003 | 3300049578 | Bacteria | 907 |
| 416 | Ga0501042_1063547 | 3300049578 | Bacteria | 590 |
| 417 | Ga0501043_0018221 | 3300049579 | Bacteria | 5505 |
| 418 | Ga0501043_0259828 | 3300049579 | Bacteria | 1336 |
| 419 | Ga0501046_0045547 | 3300049580 | Bacteria | 3485 |
| 420 | Ga0501046_0053006 | 3300049580 | Bacteria | 3196 |
| 421 | Ga0501046_0073820 | 3300049580 | Bacteria | 2647 |
| 422 | Ga0501046_0084413 | 3300049580 | Bacteria | 2449 |
| 423 | Ga0501046_0092732 | 3300049580 | Bacteria | 2322 |
| 424 | Ga0501046_0094317 | 3300049580 | Bacteria | 2300 |
| 425 | Ga0501046_0104305 | 3300049580 | Bacteria | 2173 |
| 426 | Ga0501046_0168409 | 3300049580 | Bacteria | 1645 |
| 427 | Ga0501046_0196836 | 3300049580 | Bacteria | 1501 |
| 428 | Ga0501047_0108778 | 3300049581 | Bacteria | 2655 |
| 429 | Ga0501048_0005139 | 3300049582 | Bacteria | 9968 |
| 430 | Ga0501048_0008407 | 3300049582 | Bacteria | 7805 |
| 431 | Ga0501048_0016896 | 3300049582 | Bacteria | 5379 |
| 432 | Ga0501048_0032011 | 3300049582 | Bacteria | 3803 |
| 433 | Ga0501048_0328195 | 3300049582 | Bacteria | 1090 |
| 434 | Ga0501067_0000743 | 3300049583 | Bacteria | 17525 |
| 435 | Ga0501068_0038089 | 3300049584 | Bacteria | 2879 |
| 436 | Ga0501068_0211459 | 3300049584 | Bacteria | 1232 |
| 437 | Ga0501068_0701584 | 3300049584 | Bacteria | 662 |
| 438 | Ga0501069_0038794 | 3300049585 | Bacteria | 2630 |
| 439 | Ga0501069_0100195 | 3300049585 | Bacteria | 1644 |
| 440 | Ga0501069_0106217 | 3300049585 | Bacteria | 1596 |
| 441 | Ga0501070_0093262 | 3300049586 | Bacteria | 2491 |
| 442 | Ga0501070_0114717 | 3300049586 | Bacteria | 2225 |
| 443 | Ga0501070_0799528 | 3300049586 | Bacteria | 741 |
| 444 | Ga0501071_0006756 | 3300049587 | Bacteria | 7467 |
| 445 | Ga0501071_0017348 | 3300049587 | Bacteria | 4962 |
| 446 | Ga0501071_0105398 | 3300049587 | Bacteria | 2081 |
| 447 | Ga0501071_0129201 | 3300049587 | Bacteria | 1876 |
| 448 | Ga0501071_0479405 | 3300049587 | Bacteria | 953 |
| 449 | Ga0501071_0935734 | 3300049587 | Bacteria | 669 |
| 450 | Ga0501071_1260808 | 3300049587 | Bacteria | 571 |
| 451 | Ga0501072_0005005 | 3300049588 | Bacteria | 10084 |
| 452 | Ga0501072_0013715 | 3300049588 | Bacteria | 6204 |
| 453 | Ga0501072_0030868 | 3300049588 | Bacteria | 4192 |
| 454 | Ga0501072_0038015 | 3300049588 | Bacteria | 3777 |
| 455 | Ga0501072_0050454 | 3300049588 | Bacteria | 3276 |
| 456 | Ga0501072_0064681 | 3300049588 | Bacteria | 2884 |
| 457 | Ga0501072_0287864 | 3300049588 | Bacteria | 1306 |
| 458 | Ga0501073_0634390 | 3300049589 | Bacteria | 737 |
| 459 | Ga0501073_0656734 | 3300049589 | Bacteria | 724 |
| 460 | Ga0501074_0006155 | 3300049590 | Bacteria | 8666 |
| 461 | Ga0501074_0021486 | 3300049590 | Bacteria | 4685 |
| 462 | Ga0501074_0033710 | 3300049590 | Bacteria | 3711 |
| 463 | Ga0501074_0137185 | 3300049590 | Bacteria | 1750 |
| 464 | Ga0501074_0147792 | 3300049590 | Bacteria | 1681 |
| 465 | Ga0501074_0162887 | 3300049590 | Bacteria | 1593 |
| 466 | Ga0501074_0771886 | 3300049590 | Unclassified | 678 |
| 467 | Ga0501075_0002108 | 3300049591 | Bacteria | 13151 |
| 468 | Ga0501075_0003711 | 3300049591 | Bacteria | 10257 |
| 469 | Ga0501075_0038303 | 3300049591 | Bacteria | 3583 |
| 470 | Ga0501075_0067991 | 3300049591 | Bacteria | 2691 |
| 471 | Ga0501075_0170265 | 3300049591 | Unclassified | 1662 |
| 472 | Ga0501075_0171145 | 3300049591 | Bacteria | 1657 |
| 473 | Ga0501075_0200608 | 3300049591 | Bacteria | 1521 |
| 474 | Ga0501075_0289990 | 3300049591 | Bacteria | 1247 |
| 475 | Ga0501075_0374826 | 3300049591 | Bacteria | 1085 |
| 476 | Ga0501075_0375418 | 3300049591 | Bacteria | 1084 |
| 477 | Ga0501075_0383343 | 3300049591 | Bacteria | 1072 |
| 478 | Ga0501076_0005020 | 3300049592 | Bacteria | 9470 |
| 479 | Ga0501076_0015817 | 3300049592 | Bacteria | 5708 |
| 480 | Ga0501076_0049146 | 3300049592 | Bacteria | 3335 |
| 481 | Ga0501076_0096521 | 3300049592 | Bacteria | 2381 |
| 482 | Ga0501076_0107831 | 3300049592 | Bacteria | 2249 |
| 483 | Ga0501076_0111432 | 3300049592 | Bacteria | 2212 |
| 484 | Ga0501076_0158633 | 3300049592 | Bacteria | 1842 |
| 485 | Ga0501076_0603668 | 3300049592 | Bacteria | 905 |
| 486 | Ga0501076_0988331 | 3300049592 | Bacteria | 693 |
| 487 | Ga0501077_0007727 | 3300049593 | Bacteria | 6635 |
| 488 | Ga0501077_0012160 | 3300049593 | Bacteria | 5387 |
| 489 | Ga0501077_0013664 | 3300049593 | Bacteria | 5089 |
| 490 | Ga0501077_0054568 | 3300049593 | Bacteria | 2538 |
| 491 | Ga0501077_0237433 | 3300049593 | Bacteria | 1159 |
| 492 | Ga0501077_0320429 | 3300049593 | Bacteria | 988 |
| 493 | Ga0501077_0497478 | 3300049593 | Bacteria | 782 |
| 494 | Ga0501079_0009970 | 3300049741 | Bacteria | 7212 |
| 495 | Ga0501079_0038837 | 3300049741 | Bacteria | 3671 |
| 496 | Ga0501079_0069563 | 3300049741 | Bacteria | 2717 |
| 497 | Ga0501079_0182933 | 3300049741 | Bacteria | 1636 |
| 498 | Ga0501079_0575287 | 3300049741 | Bacteria | 886 |
| 499 | Ga0501079_0682888 | 3300049741 | Bacteria | 808 |
| 500 | Ga0501080_0007922 | 3300049742 | Bacteria | 9623 |
| 501 | Ga0501080_0009204 | 3300049742 | Bacteria | 8998 |
| 502 | Ga0501080_0054989 | 3300049742 | Bacteria | 3707 |
| 503 | Ga0501080_0710447 | 3300049742 | Bacteria | 886 |
| 504 | Ga0501081_0006413 | 3300049743 | Bacteria | 7633 |
| 505 | Ga0501081_0009768 | 3300049743 | Bacteria | 6252 |
| 506 | Ga0501081_0039714 | 3300049743 | Bacteria | 3221 |
| 507 | Ga0501081_0085936 | 3300049743 | Bacteria | 2208 |
| 508 | Ga0501081_0172263 | 3300049743 | Bacteria | 1563 |
| 509 | Ga0501081_0214925 | 3300049743 | Bacteria | 1397 |
| 510 | Ga0501081_0225699 | 3300049743 | Bacteria | 1363 |
| 511 | Ga0501081_0788677 | 3300049743 | Bacteria | 715 |
| 512 | Ga0501083_0016184 | 3300049744 | Bacteria | 5222 |
| 513 | Ga0501083_0041709 | 3300049744 | Bacteria | 3112 |
| 514 | Ga0501083_0520005 | 3300049744 | Bacteria | 775 |
| 515 | Ga0501035_0053707 | 3300049822 | Bacteria | 3602 |
| 516 | Ga0501035_0112998 | 3300049822 | Bacteria | 2379 |
| 517 | Ga0501035_0592640 | 3300049822 | Bacteria | 904 |
| 518 | Ga0501035_0701220 | 3300049822 | Bacteria | 816 |
| 519 | Ga0501044_0252800 | 3300049823 | Bacteria | 1703 |
| 520 | Ga0501044_0994685 | 3300049823 | Bacteria | 711 |
| 521 | Ga0501045_0002811 | 3300049824 | Bacteria | 11893 |
| 522 | Ga0501045_0006966 | 3300049824 | Bacteria | 7836 |
| 523 | Ga0501045_0019064 | 3300049824 | Bacteria | 4886 |
| 524 | Ga0501045_0058140 | 3300049824 | Bacteria | 2831 |
| 525 | Ga0501045_0124803 | 3300049824 | Bacteria | 1912 |
| 526 | Ga0501045_0185767 | 3300049824 | Bacteria | 1549 |
| 527 | Ga0501045_0239345 | 3300049824 | Bacteria | 1351 |
| 528 | Ga0501045_0429022 | 3300049824 | Bacteria | 983 |
| 529 | nmdc:mga03n38_79229_c1 | 3300050490 | Bacteria | 1539 |
| 530 | nmdc:mga06z11_329727_c1 | 3300050494 | Bacteria | 911 |
| 531 | nmdc:mga05p37_1367_c1 | 3300050507 | Bacteria | 28342 |
| 532 | nmdc:mga05p37_164516_c1 | 3300050507 | Bacteria | 2708 |
| 533 | nmdc:mga05p37_2560_c1 | 3300050507 | Bacteria | 21147 |
| 534 | nmdc:mga05p37_286517_c1 | 3300050507 | Bacteria | 1962 |
| 535 | nmdc:mga0qj67_5258_c1 | 3300050509 | Bacteria | 9439 |
| 536 | nmdc:mga06r32_2695_c1 | 3300050510 | Bacteria | 15876 |
| 537 | Ga0495601_0140235 | 3300053077 | Bacteria | 1577 |
| 538 | Ga0495595_0473138 | 3300053084 | Bacteria | 638 |
| 539 | Ga0495619_0023348 | 3300053085 | Bacteria | 3965 |
| 540 | Ga0495619_0294122 | 3300053085 | Bacteria | 1125 |
| 541 | Ga0500630_272532 | 3300053159 | Bacteria | 576 |
| 542 | Ga0501084_0007439 | 3300054114 | Bacteria | 9028 |
| 543 | Ga0501084_0042812 | 3300054114 | Bacteria | 3788 |
| 544 | Ga0501084_0045616 | 3300054114 | Bacteria | 3670 |
| 545 | Ga0501084_0049672 | 3300054114 | Bacteria | 3511 |
| 546 | Ga0501084_0051513 | 3300054114 | Bacteria | 3445 |
| 547 | Ga0501084_0112800 | 3300054114 | Bacteria | 2284 |
| 548 | Ga0501084_0132142 | 3300054114 | Bacteria | 2101 |
| 549 | Ga0501084_0160608 | 3300054114 | Bacteria | 1896 |
| 550 | Ga0501084_0396555 | 3300054114 | Bacteria | 1166 |
| 551 | Ga0501084_0663600 | 3300054114 | Bacteria | 880 |
| 552 | Ga0501084_1027271 | 3300054114 | Bacteria | 692 |
| 553 | Ga0501082_0008736 | 3300060353 | Bacteria | 8731 |
| 554 | Ga0501082_0014645 | 3300060353 | Bacteria | 6756 |
| 555 | Ga0501082_0072806 | 3300060353 | Bacteria | 2959 |
| 556 | Ga0501082_0073507 | 3300060353 | Bacteria | 2945 |
| 557 | Ga0501082_0112983 | 3300060353 | Bacteria | 2352 |
| 558 | Ga0501082_0207615 | 3300060353 | Bacteria | 1704 |
| 559 | Ga0501082_0403331 | 3300060353 | Bacteria | 1193 |
| 560 | Ga0501082_0653544 | 3300060353 | Bacteria | 920 |
| 561 | Ga0530510_0002028 | 3300061734 | Bacteria | 13915 |
| 562 | Ga0530510_0004299 | 3300061734 | Bacteria | 9856 |
| 563 | Ga0530510_0009089 | 3300061734 | Bacteria | 6964 |
| 564 | Ga0530510_0047806 | 3300061734 | Bacteria | 3092 |
| 565 | Ga0530510_0054968 | 3300061734 | Bacteria | 2877 |
| 566 | Ga0530510_0397676 | 3300061734 | Bacteria | 1038 |
| 567 | Ga0530510_0622415 | 3300061734 | Bacteria | 821 |
| 568 | 2644228632 | 2643221641 | Bacteria | 4490190 |
| 569 | 2644503963 | 2643221690 | Bacteria | 4654705 |
| 570 | 2644524688 | 2643221694 | Bacteria | 4392972 |
| 571 | 2644609012 | 2643221711 | Bacteria | 4865335 |
| 572 | 2644668776 | 2643221722 | Bacteria | 4247614 |
| 573 | 2816426372 | 2816332119 | Bacteria | 8120218 |
| 574 | 2819665856 | 2818991458 | Bacteria | 4794049 |
| 575 | 2855390730 | 2855386786 | Bacteria | 4752232 |
| 576 | 2919450213 | 2919446982 | Bacteria | 3994487 |
| 577 | 2932433484 | 2932431166 | Bacteria | 4215299 |
| 578 | Ga0105239_10391319 | |||
| 579 | JGI24740J21852_10037969 | |||
| 580 | JGI24739J22299_10004236 | |||
| 581 | JGI24737J22298_10015912 | |||
| 582 | JGI24735J21928_10027814 | |||
| 583 | JGI24735J21928_10125502 | |||
| 584 | rootH2_10125301 | |||
| 585 | Ga0058862_10080988 | |||
| 586 | Ga0070683_100004382 | |||
| 587 | Ga0070683_100076599 | |||
| 588 | Ga0070683_100152959 | |||
| 589 | Ga0070683_100239226 | |||
| 590 | Ga0070683_100299526 | |||
| 591 | Ga0070683_100966077 | |||
| 592 | Ga0070682_100385133 | |||
| 593 | Ga0070682_101120120 | |||
| 594 | Ga0070675_100290144 | |||
| 595 | Ga0070671_100802121 | |||
| 596 | Ga0070659_100157070 | |||
| 597 | Ga0070667_100120679 | |||
| 598 | Ga0070667_100179649 | |||
| 599 | Ga0070713_100112103 | |||
| 600 | Ga0070713_100887985 | |||
| 601 | Ga0070701_10503235 | |||
| 602 | Ga0070708_100079567 | |||
| 603 | Ga0070708_100774547 | |||
| 604 | Ga0070681_10370807 | |||
| 605 | Ga0070681_10874707 | |||
| 606 | Ga0070685_10486304 | |||
| 607 | Ga0070706_100093295 | |||
| 608 | Ga0070706_100141862 | |||
| 609 | Ga0070707_100065707 | |||
| 610 | Ga0070707_100146729 | |||
| 611 | Ga0070707_100277024 | |||
| 612 | Ga0070707_101048773 | |||
| 613 | Ga0070698_100000167 | |||
| 614 | Ga0070698_100070783 | |||
| 615 | Ga0070699_100097703 | |||
| 616 | Ga0070684_100179781 | |||
| 617 | Ga0070684_100198332 | |||
| 618 | Ga0070684_100301838 | |||
| 619 | Ga0070684_101273349 | |||
| 620 | Ga0068853_100383376 | |||
| 621 | Ga0070686_100723175 | |||
| 622 | Ga0070665_100125650 | |||
| 623 | Ga0070704_101831796 | |||
| 624 | Ga0068855_100038776 | |||
| 625 | Ga0070664_100040849 | |||
| 626 | Ga0070664_100047083 | |||
| 627 | Ga0070664_100146863 | |||
| 628 | Ga0068857_100048670 | |||
| 629 | Ga0068857_100106437 | |||
| 630 | Ga0068856_100273961 | |||
| 631 | Ga0070702_100192936 | |||
| 632 | Ga0070702_100654320 | |||
| 633 | Ga0068852_100048221 | |||
| 634 | Ga0068852_100248276 | |||
| 635 | Ga0068859_100098146 | |||
| 636 | Ga0068864_100012262 | |||
| 637 | Ga0068863_100040671 | |||
| 638 | Ga0068858_100000711 | |||
| 639 | Ga0068860_100037608 | |||
| 640 | Ga0068862_100106849 | |||
| 641 | Ga0070717_10002580 | |||
| 642 | Ga0070717_10077064 | |||
| 643 | Ga0070717_10516069 | |||
| 644 | Ga0075365_10281741 | |||
| 645 | Ga0075363_100119088 | |||
| 646 | Ga0075363_100179302 | |||
| 647 | Ga0075364_10187971 | |||
| 648 | Ga0070715_10139243 | |||
| 649 | Ga0068871_100634948 | |||
| 650 | Ga0075430_100017753 | |||
| 651 | Ga0075431_100026443 | |||
| 652 | Ga0075431_100036298 | |||
| 653 | Ga0075431_100883401 | |||
| 654 | Ga0097620_100098147 | |||
| 655 | Ga0105244_10053418 | |||
| 656 | Ga0105240_10022984 | |||
| 657 | Ga0105245_10110932 | |||
| 658 | Ga0105247_10936709 | |||
| 659 | Ga0114129_10000446 | |||
| 660 | Ga0114129_10017220 | |||
| 661 | Ga0114129_10079579 | |||
| 662 | Ga0114129_10345504 | |||
| 663 | Ga0105248_10482283 | |||
| 664 | Ga0105237_11300301 | |||
| 665 | Ga0105238_10616083 | |||
| 666 | Ga0105249_10000893 | |||
| 667 | Ga0105239_10392837 | |||
| 668 | Ga0105239_12028300 | |||
| 669 | Ga0105246_10095631 | |||
| 670 | Ga0105246_10863297 | |||
| 671 | Ga0157370_10022781 | |||
| 672 | Ga0157370_10122351 | |||
| 673 | Ga0157369_10006061 | |||
| 674 | Ga0157369_10223620 | |||
| 675 | Ga0157374_11322181 | |||
| 676 | Ga0157374_11554555 | |||
| 677 | Ga0163162_10567120 | |||
| 678 | Ga0163162_11184837 | |||
| 679 | Ga0157372_10032804 | |||
| 680 | Ga0157372_10193545 | |||
| 681 | Ga0157372_10253045 | |||
| 682 | Ga0157372_10510595 | |||
| 683 | Ga0157372_11591634 | |||
| 684 | Ga0157372_12182363 | |||
| 685 | Ga0157375_10267154 | |||
| 686 | Ga0157375_10938015 | |||
| 687 | Ga0157375_11051547 | |||
| 688 | Ga0163163_10001227 | |||
| 689 | Ga0163163_10482173 | |||
| 690 | Ga0163163_11504947 | |||
| 691 | Ga0157377_10240681 | |||
| 692 | Ga0157379_10000496 | |||
| 693 | Ga0157379_10066281 | |||
| 694 | Ga0157376_11561972 | |||
| 695 | Ga0163161_10431974 | |||
| 696 | Ga0206356_11321571 | |||
| 697 | Ga0206354_10964057 | |||
| 698 | Ga0206353_10597598 | |||
| 699 | Ga0224712_10145637 | |||
| 700 | Ga0207680_10839634 | |||
| 701 | Ga0207647_10025454 | |||
| 702 | Ga0207684_10114196 | |||
| 703 | Ga0207684_11225782 | |||
| 704 | Ga0207695_10067138 | |||
| 705 | Ga0207662_10387081 | |||
| 706 | Ga0207646_10001990 | |||
| 707 | Ga0207646_10222018 | |||
| 708 | Ga0207646_10778386 | |||
| 709 | Ga0207694_10665384 | |||
| 710 | Ga0207650_10155885 | |||
| 711 | Ga0207659_10340586 | |||
| 712 | Ga0207700_10311499 | |||
| 713 | Ga0207700_10496692 | |||
| 714 | Ga0207690_10287003 | |||
| 715 | Ga0207709_10656604 | |||
| 716 | Ga0207704_10629569 | |||
| 717 | Ga0207661_10004109 | |||
| 718 | Ga0207661_10196393 | |||
| 719 | Ga0207661_10507175 | |||
| 720 | Ga0207661_10985785 | |||
| 721 | Ga0207679_10047736 | |||
| 722 | Ga0207679_10060876 | |||
| 723 | Ga0207667_10036906 | |||
| 724 | Ga0207651_10363944 | |||
| 725 | Ga0207712_10540744 | |||
| 726 | Ga0207640_10354688 | |||
| 727 | Ga0207658_10155297 | |||
| 728 | Ga0207703_10000003 | |||
| 729 | Ga0207708_10204174 | |||
| 730 | Ga0207641_10135016 | |||
| 731 | Ga0207648_11156929 | |||
| 732 | Ga0207676_11314930 | |||
| 733 | Ga0207674_10070526 | |||
| 734 | Ga0207674_10124423 | |||
| 735 | Ga0207674_10139576 | |||
| 736 | Ga0207683_10559739 | |||
| 737 | Ga0207698_10235717 | |||
| 738 | Ga0268265_10088370 | |||
| 739 | Ga0268264_10000576 | |||
| 740 | Ga0307511_10249176 | |||
| 741 | Ga0307512_10032691 | |||
| 742 | Ga0307513_10245825 | |||
| 743 | Ga0307509_10061552 | |||
| 744 | Ga0307508_10000257 | |||
| 745 | Ga0307508_10078356 | |||
| 746 | Ga0307508_10092278 | |||
| 747 | Ga0307508_10192307 | |||
| 748 | Ga0307508_10251106 | |||
| 749 | Ga0316575_10000001 | |||
| 750 | Ga0316575_10006580 | |||
| 751 | Ga0316575_10018297 | |||
| 752 | Ga0316579_10025854 | |||
| 753 | Ga0316576_10001855 | |||
| 754 | Ga0316576_10003125 | |||
| 755 | Ga0316576_10012522 | |||
| 756 | Ga0316576_10014073 | |||
| 757 | Ga0316576_10016161 | |||
| 758 | Ga0316576_10099693 | |||
| 759 | Ga0316578_10001048 | |||
| 760 | Ga0316578_10002819 | |||
| 761 | Ga0316578_10031988 | |||
| 762 | Ga0316578_10278384 | |||
| 763 | Ga0307516_10000971 | |||
| 764 | Ga0307516_10018849 | |||
| 765 | Ga0307405_10114693 | |||
| 766 | Ga0307405_10464294 | |||
| 767 | Ga0307405_10483614 | |||
| 768 | Ga0316577_10015105 | |||
| 769 | Ga0307518_10208947 | |||
| 770 | Ga0307406_10816305 | |||
| 771 | Ga0307407_10505317 | |||
| 772 | Ga0307409_100669195 | |||
| 773 | Ga0307416_100781885 | |||
| 774 | Ga0307411_10602544 | |||
| 775 | Ga0307415_100178928 | |||
| 776 | Ga0307415_100349031 | |||
| 777 | Ga0316583_10016250 | |||
| 778 | Ga0316580_10008879 | |||
| 779 | Ga0316593_10010743 | |||
| 780 | Ga0316593_10037548 | |||
| 781 | Ga0307507_10006363 | |||
| 782 | Ga0307507_10345157 | |||
| 783 | Ga0307510_10231897 | |||
| 784 | Ga0307510_10424959 | |||
| 785 | Ga0316592_1003717 | |||
| 786 | Ga0316592_1005174 | |||
| 787 | Ga0316592_1090381 | |||
| 788 | Ga0316592_1098912 | |||
| 789 | Ga0316586_1002852 | |||
| 790 | Ga0316586_1002860 | |||
| 791 | Ga0316586_1003219 | |||
| 792 | Ga0316588_1006018 | |||
| 793 | Ga0316588_1008292 | |||
| 794 | Ga0316587_1005909 | |||
| 795 | Ga0316587_1008153 | |||
| 796 | Ga0316596_1021059 | |||
| 797 | Ga0316596_1047854 | |||
| 798 | Ga0373926_0002478 | |||
| 799 | Ga0373944_0069349 | |||
| 800 | Ga0373945_0159170 | |||
| 801 | Ga0373953_0026457 | |||
| 802 | Ga0373954_0181872 | |||
| 803 | Ga0373954_0203310 | |||
| 804 | Ga0373957_0116108 | |||
| 805 | Ga0316574_0007004 | |||
| 806 | Ga0316574_0024394 | |||
| 807 | Ga0316574_0049046 | |||
| 808 | Ga0316574_0067076 | |||
| 809 | Ga0373935_0004573 | |||
| 810 | Ga0373933_0426916 | |||
| 811 | Ga0373947_0000016 | |||
| 812 | Ga0373947_0742182 | |||
| 813 | Ga0373937_0065201 | |||
| 814 | Ga0373937_0208514 | |||
| 815 | Ga0316582_0000644 | |||
| 816 | Ga0316584_0001926 | |||
| 817 | Ga0316584_0072705 | |||
| 818 | Ga0373925_1144918 | |||
| 819 | Ga0395899_0013499 | |||
| 820 | Ga0395900_0041356 | |||
| 821 | Ga0395900_0066094 | |||
| 822 | Ga0395898_0014539 | |||
| 823 | Ga0395898_0286805 | |||
| 824 | Ga0395898_0481099 | |||
| 825 | Ga0395905_0051830 | |||
| 826 | Ga0395905_0841234 | |||
| 827 | Ga0395901_0044705 | |||
| 828 | Ga0395901_0092082 | |||
| 829 | Ga0395901_0109967 | |||
| 830 | Ga0395901_0172455 | |||
| 831 | Ga0451795_0369261 | |||
| 832 | Ga0439448_0072595 | |||
| 833 | Ga0439440_0019925 | |||
| 834 | Ga0495592_0588876 | |||
| 835 | Ga0495629_0069268 | |||
| 836 | Ga0495629_0165108 | |||
| 837 | Ga0495629_0524457 | |||
| 838 | Ga0495651_0071639 | |||
| 839 | Ga0495653_0219721 | |||
| 840 | Ga0495582_0111158 | |||
| 841 | Ga0495594_0001619 | |||
| 842 | Ga0495630_0159739 | |||
| 843 | Ga0495630_0352542 | |||
| 844 | Ga0495630_0847242 | |||
| 845 | Ga0495587_0356737 | |||
| 846 | Ga0495597_0140570 | |||
| 847 | Ga0495667_0117646 | |||
| 848 | Ga0495634_0328364 | |||
| 849 | Ga0495611_0282923 | |||
| 850 | Ga0495635_0293396 | |||
| 851 | Ga0495635_0364056 | |||
| 852 | Ga0495623_0141893 | |||
| 853 | Ga0495658_0822974 | |||
| 854 | Ga0495613_0511382 | |||
| 855 | Ga0495624_0254755 | |||
| 856 | Ga0495600_0456261 | |||
| 857 | Ga0495581_0225552 | |||
| 858 | Ga0495604_0286988 | |||
| 859 | Ga0495674_0284612 | |||
| 860 | Ga0495680_0162001 | |||
| 861 | Ga0495680_0719675 | |||
| 862 | Ga0495602_0391639 | |||
| 863 | Ga0496100_0019527 | |||
| 864 | Ga0496100_0378880 | |||
| 865 | Ga0496100_0751785 | |||
| 866 | Ga0496100_0968287 | |||
| 867 | Ga0496101_0070878 | |||
| 868 | Ga0496101_0078501 | |||
| 869 | Ga0496101_0256504 | |||
| 870 | Ga0496101_0379792 | |||
| 871 | Ga0496102_0043496 | |||
| 872 | Ga0496102_0128008 | |||
| 873 | Ga0496102_0183995 | |||
| 874 | Ga0496102_0786280 | |||
| 875 | Ga0496102_1388244 | |||
| 876 | Ga0496103_0397558 | |||
| 877 | Ga0496104_0012699 | |||
| 878 | Ga0496104_0013216 | |||
| 879 | Ga0496104_0054560 | |||
| 880 | Ga0496104_0077992 | |||
| 881 | Ga0496104_0269581 | |||
| 882 | Ga0496104_0395329 | |||
| 883 | Ga0496104_1213473 | |||
| 884 | Ga0496105_0001090 | |||
| 885 | Ga0496105_0048618 | |||
| 886 | Ga0496105_0212589 | |||
| 887 | Ga0496106_0098627 | |||
| 888 | Ga0496106_0268328 | |||
| 889 | Ga0496107_0147590 | |||
| 890 | Ga0496107_0313579 | |||
| 891 | Ga0496107_0826072 | |||
| 892 | Ga0496108_0085788 | |||
| 893 | Ga0496108_0136169 | |||
| 894 | Ga0496108_0201650 | |||
| 895 | Ga0496108_0205894 | |||
| 896 | Ga0496108_0687988 | |||
| 897 | Ga0496109_0060676 | |||
| 898 | Ga0496109_0173692 | |||
| 899 | Ga0496109_0174638 | |||
| 900 | Ga0496109_0323533 | |||
| 901 | Ga0496109_0561377 | |||
| 902 | Ga0496109_1270614 | |||
| 903 | Ga0496110_0003609 | |||
| 904 | Ga0496110_0008319 | |||
| 905 | Ga0496110_0045745 | |||
| 906 | Ga0496110_0201194 | |||
| 907 | Ga0496110_0207977 | |||
| 908 | Ga0496110_0283926 | |||
| 909 | Ga0496110_0441373 | |||
| 910 | Ga0496110_0456922 | |||
| 911 | Ga0496110_0592145 | |||
| 912 | Ga0496111_0014665 | |||
| 913 | Ga0496111_0076504 | |||
| 914 | Ga0496111_0082819 | |||
| 915 | Ga0496111_0548961 | |||
| 916 | Ga0496112_0016267 | |||
| 917 | Ga0496112_0129931 | |||
| 918 | Ga0496112_0153329 | |||
| 919 | Ga0496112_0294495 | |||
| 920 | Ga0496112_0594442 | |||
| 921 | Ga0496112_0774484 | |||
| 922 | Ga0496112_0927682 | |||
| 923 | Ga0496113_0046173 | |||
| 924 | Ga0496113_0114099 | |||
| 925 | Ga0496113_0200246 | |||
| 926 | Ga0496114_0024705 | |||
| 927 | Ga0496114_0028407 | |||
| 928 | Ga0496114_0059472 | |||
| 929 | Ga0496114_0075148 | |||
| 930 | Ga0496114_0196107 | |||
| 931 | Ga0496114_0421403 | |||
| 932 | Ga0496115_0282477 | |||
| 933 | Ga0496115_0385750 | |||
| 934 | Ga0496115_0750339 | |||
| 935 | Ga0496116_0000119 | |||
| 936 | Ga0496117_0003284 | |||
| 937 | Ga0496118_0005228 | |||
| 938 | Ga0496119_0019280 | |||
| 939 | Ga0496119_0032234 | |||
| 940 | Ga0496121_0007235 | |||
| 941 | Ga0501031_0000913 | |||
| 942 | Ga0501031_0003686 | |||
| 943 | Ga0501031_0154404 | |||
| 944 | Ga0501031_0387025 | |||
| 945 | Ga0501031_0399406 | |||
| 946 | Ga0501032_0017012 | |||
| 947 | Ga0501033_0019148 | |||
| 948 | Ga0501033_0072571 | |||
| 949 | Ga0501034_0018841 | |||
| 950 | Ga0501034_0333987 | |||
| 951 | Ga0501034_0392370 | |||
| 952 | Ga0501036_0007899 | |||
| 953 | Ga0501036_0016566 | |||
| 954 | Ga0501036_0047610 | |||
| 955 | Ga0501036_0349509 | |||
| 956 | Ga0501036_0409775 | |||
| 957 | Ga0501036_0522691 | |||
| 958 | Ga0501036_1267481 | |||
| 959 | Ga0501037_0206703 | |||
| 960 | Ga0501037_0573909 | |||
| 961 | Ga0501038_0064012 | |||
| 962 | Ga0501038_0098474 | |||
| 963 | Ga0501038_0514147 | |||
| 964 | Ga0501038_0641834 | |||
| 965 | Ga0501039_0006409 | |||
| 966 | Ga0501039_0039448 | |||
| 967 | Ga0501039_0061799 | |||
| 968 | Ga0501039_0171481 | |||
| 969 | Ga0501039_0713248 | |||
| 970 | Ga0501040_0008866 | |||
| 971 | Ga0501040_0009396 | |||
| 972 | Ga0501040_0009452 | |||
| 973 | Ga0501040_0081484 | |||
| 974 | Ga0501040_0089468 | |||
| 975 | Ga0501040_0292823 | |||
| 976 | Ga0501040_0792188 | |||
| 977 | Ga0501041_0006357 | |||
| 978 | Ga0501041_0009306 | |||
| 979 | Ga0501041_0018970 | |||
| 980 | Ga0501041_0048898 | |||
| 981 | Ga0501041_0213663 | |||
| 982 | Ga0501041_0374929 | |||
| 983 | Ga0501041_0531404 | |||
| 984 | Ga0501042_0003198 | |||
| 985 | Ga0501042_0008662 | |||
| 986 | Ga0501042_0034546 | |||
| 987 | Ga0501042_0045049 | |||
| 988 | Ga0501042_0094190 | |||
| 989 | Ga0501042_0343597 | |||
| 990 | Ga0501042_0351582 | |||
| 991 | Ga0501042_0467014 | |||
| 992 | Ga0501042_0475003 | |||
| 993 | Ga0501042_1063547 | |||
| 994 | Ga0501043_0018221 | |||
| 995 | Ga0501043_0259828 | |||
| 996 | Ga0501046_0045547 | |||
| 997 | Ga0501046_0053006 | |||
| 998 | Ga0501046_0073820 | |||
| 999 | Ga0501046_0084413 | |||
| 1000 | Ga0501046_0092732 | |||
| 1001 | Ga0501046_0094317 | |||
| 1002 | Ga0501046_0104305 | |||
| 1003 | Ga0501046_0168409 | |||
| 1004 | Ga0501046_0196836 | |||
| 1005 | Ga0501047_0108778 | |||
| 1006 | Ga0501048_0005139 | |||
| 1007 | Ga0501048_0008407 | |||
| 1008 | Ga0501048_0016896 | |||
| 1009 | Ga0501048_0032011 | |||
| 1010 | Ga0501048_0328195 | |||
| 1011 | Ga0501067_0000743 | |||
| 1012 | Ga0501068_0038089 | |||
| 1013 | Ga0501068_0211459 | |||
| 1014 | Ga0501068_0701584 | |||
| 1015 | Ga0501069_0038794 | |||
| 1016 | Ga0501069_0100195 | |||
| 1017 | Ga0501069_0106217 | |||
| 1018 | Ga0501070_0093262 | |||
| 1019 | Ga0501070_0114717 | |||
| 1020 | Ga0501070_0799528 | |||
| 1021 | Ga0501071_0006756 | |||
| 1022 | Ga0501071_0017348 | |||
| 1023 | Ga0501071_0105398 | |||
| 1024 | Ga0501071_0129201 | |||
| 1025 | Ga0501071_0479405 | |||
| 1026 | Ga0501071_0935734 | |||
| 1027 | Ga0501071_1260808 | |||
| 1028 | Ga0501072_0005005 | |||
| 1029 | Ga0501072_0013715 | |||
| 1030 | Ga0501072_0030868 | |||
| 1031 | Ga0501072_0038015 | |||
| 1032 | Ga0501072_0050454 | |||
| 1033 | Ga0501072_0064681 | |||
| 1034 | Ga0501072_0287864 | |||
| 1035 | Ga0501073_0634390 | |||
| 1036 | Ga0501073_0656734 | |||
| 1037 | Ga0501074_0006155 | |||
| 1038 | Ga0501074_0021486 | |||
| 1039 | Ga0501074_0033710 | |||
| 1040 | Ga0501074_0137185 | |||
| 1041 | Ga0501074_0147792 | |||
| 1042 | Ga0501074_0162887 | |||
| 1043 | Ga0501074_0771886 | |||
| 1044 | Ga0501075_0002108 | |||
| 1045 | Ga0501075_0003711 | |||
| 1046 | Ga0501075_0038303 | |||
| 1047 | Ga0501075_0067991 | |||
| 1048 | Ga0501075_0170265 | |||
| 1049 | Ga0501075_0171145 | |||
| 1050 | Ga0501075_0200608 | |||
| 1051 | Ga0501075_0289990 | |||
| 1052 | Ga0501075_0374826 | |||
| 1053 | Ga0501075_0375418 | |||
| 1054 | Ga0501075_0383343 | |||
| 1055 | Ga0501076_0005020 | |||
| 1056 | Ga0501076_0015817 | |||
| 1057 | Ga0501076_0049146 | |||
| 1058 | Ga0501076_0096521 | |||
| 1059 | Ga0501076_0107831 | |||
| 1060 | Ga0501076_0111432 | |||
| 1061 | Ga0501076_0158633 | |||
| 1062 | Ga0501076_0603668 | |||
| 1063 | Ga0501076_0988331 | |||
| 1064 | Ga0501077_0007727 | |||
| 1065 | Ga0501077_0012160 | |||
| 1066 | Ga0501077_0013664 | |||
| 1067 | Ga0501077_0054568 | |||
| 1068 | Ga0501077_0237433 | |||
| 1069 | Ga0501077_0320429 | |||
| 1070 | Ga0501077_0497478 | |||
| 1071 | Ga0501079_0009970 | |||
| 1072 | Ga0501079_0038837 | |||
| 1073 | Ga0501079_0069563 | |||
| 1074 | Ga0501079_0182933 | |||
| 1075 | Ga0501079_0575287 | |||
| 1076 | Ga0501079_0682888 | |||
| 1077 | Ga0501080_0007922 | |||
| 1078 | Ga0501080_0009204 | |||
| 1079 | Ga0501080_0054989 | |||
| 1080 | Ga0501080_0710447 | |||
| 1081 | Ga0501081_0006413 | |||
| 1082 | Ga0501081_0009768 | |||
| 1083 | Ga0501081_0039714 | |||
| 1084 | Ga0501081_0085936 | |||
| 1085 | Ga0501081_0172263 | |||
| 1086 | Ga0501081_0214925 | |||
| 1087 | Ga0501081_0225699 | |||
| 1088 | Ga0501081_0788677 | |||
| 1089 | Ga0501083_0016184 | |||
| 1090 | Ga0501083_0041709 | |||
| 1091 | Ga0501083_0520005 | |||
| 1092 | Ga0501035_0053707 | |||
| 1093 | Ga0501035_0112998 | |||
| 1094 | Ga0501035_0592640 | |||
| 1095 | Ga0501035_0701220 | |||
| 1096 | Ga0501044_0252800 | |||
| 1097 | Ga0501044_0994685 | |||
| 1098 | Ga0501045_0002811 | |||
| 1099 | Ga0501045_0006966 | |||
| 1100 | Ga0501045_0019064 | |||
| 1101 | Ga0501045_0058140 | |||
| 1102 | Ga0501045_0124803 | |||
| 1103 | Ga0501045_0185767 | |||
| 1104 | Ga0501045_0239345 | |||
| 1105 | Ga0501045_0429022 | |||
| 1106 | nmdc:mga03n38_79229_c1 | |||
| 1107 | nmdc:mga06z11_329727_c1 | |||
| 1108 | nmdc:mga05p37_1367_c1 | |||
| 1109 | nmdc:mga05p37_164516_c1 | |||
| 1110 | nmdc:mga05p37_2560_c1 | |||
| 1111 | nmdc:mga05p37_286517_c1 | |||
| 1112 | nmdc:mga0qj67_5258_c1 | |||
| 1113 | nmdc:mga06r32_2695_c1 | |||
| 1114 | Ga0495601_0140235 | |||
| 1115 | Ga0495595_0473138 | |||
| 1116 | Ga0495619_0023348 | |||
| 1117 | Ga0495619_0294122 | |||
| 1118 | Ga0500630_272532 | |||
| 1119 | Ga0501084_0007439 | |||
| 1120 | Ga0501084_0042812 | |||
| 1121 | Ga0501084_0045616 | |||
| 1122 | Ga0501084_0049672 | |||
| 1123 | Ga0501084_0051513 | |||
| 1124 | Ga0501084_0112800 | |||
| 1125 | Ga0501084_0132142 | |||
| 1126 | Ga0501084_0160608 | |||
| 1127 | Ga0501084_0396555 | |||
| 1128 | Ga0501084_0663600 | |||
| 1129 | Ga0501084_1027271 | |||
| 1130 | Ga0501082_0008736 | |||
| 1131 | Ga0501082_0014645 | |||
| 1132 | Ga0501082_0072806 | |||
| 1133 | Ga0501082_0073507 | |||
| 1134 | Ga0501082_0112983 | |||
| 1135 | Ga0501082_0207615 | |||
| 1136 | Ga0501082_0403331 | |||
| 1137 | Ga0501082_0653544 | |||
| 1138 | Ga0530510_0002028 | |||
| 1139 | Ga0530510_0004299 | |||
| 1140 | Ga0530510_0009089 | |||
| 1141 | Ga0530510_0047806 | |||
| 1142 | Ga0530510_0054968 | |||
| 1143 | Ga0530510_0397676 | |||
| 1144 | Ga0530510_0622415 | |||
| 1145 | 2644228632 | |||
| 1146 | 2644503963 | |||
| 1147 | 2644524688 | |||
| 1148 | 2644609012 | |||
| 1149 | 2644668776 | |||
| 1150 | 2816426372 | |||
| 1151 | 2819665856 | |||
| 1152 | 2855390730 | |||
| 1153 | 2919450213 | |||
| 1154 | 2932433484 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6qlg-assembly1.cif.gz_A | crystal structure of anubix (pada1) in complex with fmn and dimethylallyl pyrophosphate | 0.875 | 23 | 63 |
| 1l1s-assembly1.cif.gz_A | structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum | 0.8468 | 23 | 172 |
| 1l1s-assembly1.cif.gz_A | structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum | 0.8329 | 23 | 172 |
| 2qs7-assembly2.cif.gz_D | crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution | 0.8192 | 23 | 172 |
| 2pd2-assembly1.cif.gz_A | crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 | 0.8084 | 24 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q58170_143_270_3.40.1260.10 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8597 | 24 | 165 | 3.40.1260.10 |
| af_P9WNZ1_7_185_3.40.50.1950 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like | 0.8357 | 23 | 63 | 3.40.50.1950 |
| af_Q9LSB5_234_404_3.40.50.2000 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; | 0.8345 | 23 | 58 | 3.40.50.2000 |
| 2qs7B00 | Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like | 0.8139 | 23 | 172 | 3.40.1260.10 |
| af_Q80YV4_599_714_3.40.50.10880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF01937, DUF89, domain 3 | 0.8128 | 23 | 57 | 3.40.50.10880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y3ET23-F1-model_v4 | Peroxiredoxin family protein | 0.9912 | 23 | 172 |
|
| AF-A0A7Y0PG17-F1-model_v4 | Peroxiredoxin family protein | 0.9885 | 28 | 172 |
|
| AF-B3QVR0-F1-model_v4 | Peroxiredoxin family protein | 0.9872 | 23 | 172 |
|
| AF-A0A7Y2BH32-F1-model_v4 | Peroxiredoxin family protein | 0.9841 | 36 | 172 |
|
| AF-A0A7Y5WCA7-F1-model_v4 | DsrE/DsrF/DrsH-like family protein | 0.9839 | 21 | 172 |
|