F465610

General Info

Members Datasets Scaffolds Average Seq Length
577 253 1154 171

Family's Representative Sequence

Representative Sequence 3300010375|Ga0105239_10391319|Ga0105239_103913193
Length 191
Sequence MCLTMTATDTAADAAPVTAAMVVPSFDTPGSVGRKLAIICSKGNLDMAYPGLILANAALGEGVETHLFFTFWGFDMITKATMGDLKFSFVGNTAMHPPGHSGMGLHHMLGALPGATAAATTMLKKQIAEQDVPEVPEFLELLSASGAHLWACRMSADMNHLTMDDLYDGVEAIISASDFIELTEGAQLLFI

Samples

Sample ID Description Type Environment
1 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
16 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
22 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
37 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
38 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
39 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
42 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
43 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
47 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
53 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
61 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
64 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
65 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
66 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
67 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
71 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
72 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
105 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
106 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
107 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
108 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
109 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
110 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
111 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
112 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
113 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
114 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
115 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
116 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
117 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
118 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
119 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
120 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
121 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
124 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
125 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
127 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
128 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
131 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
132 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
133 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
134 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
135 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
139 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
145 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
146 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
147 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
148 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
149 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
150 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
151 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
152 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
153 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
154 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
158 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
159 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
164 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
165 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
166 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
167 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
170 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
171 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
178 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
179 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
180 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
181 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
182 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
183 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
184 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
185 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
186 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
187 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
188 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
189 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
190 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
191 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
192 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
193 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
194 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
195 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
196 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
197 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
209 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
215 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
216 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
219 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
220 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
221 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
222 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
223 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
224 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
225 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
226 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
227 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
228 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
229 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
232 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
233 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
236 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
244 2643221641 Nocardioides sp. Root122 Isolate Unclassified
245 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
246 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
247 2643221711 Terrabacter sp. Root85 Isolate Unclassified
248 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
249 2816332119 Kribbella amoyensis DSM 24683 Isolate Rhizosphere
250 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
251 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
252 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
253 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 94.8
Metatranscriptomes 3.47
Isolates 1.73

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 12.65
Rhizosphere 81.11
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105239_10391319 3300010375 Bacteria 1572
2 JGI24740J21852_10037969 3300001979 Bacteria 1482
3 JGI24739J22299_10004236 3300001989 Bacteria 5491
4 JGI24737J22298_10015912 3300001990 Bacteria 2430
5 JGI24735J21928_10027814 3300002067 Bacteria 1692
6 JGI24735J21928_10125502 3300002067 Bacteria 739
7 rootH2_10125301 3300003320 Bacteria 3188
8 Ga0058862_10080988 3300004803 Bacteria 1016
9 Ga0070683_100004382 3300005329 Bacteria 11613
10 Ga0070683_100076599 3300005329 Bacteria 3127
11 Ga0070683_100152959 3300005329 Bacteria 2187
12 Ga0070683_100239226 3300005329 Bacteria 1727
13 Ga0070683_100299526 3300005329 Bacteria 1530
14 Ga0070683_100966077 3300005329 Bacteria 818
15 Ga0070682_100385133 3300005337 Bacteria 1056
16 Ga0070682_101120120 3300005337 Bacteria 660
17 Ga0070675_100290144 3300005354 Bacteria 1440
18 Ga0070671_100802121 3300005355 Bacteria 820
19 Ga0070659_100157070 3300005366 Bacteria 1858
20 Ga0070667_100120679 3300005367 Bacteria 2280
21 Ga0070667_100179649 3300005367 Bacteria 1871
22 Ga0070713_100112103 3300005436 Bacteria 2380
23 Ga0070713_100887985 3300005436 Bacteria 857
24 Ga0070701_10503235 3300005438 Bacteria 787
25 Ga0070708_100079567 3300005445 Bacteria 2965
26 Ga0070708_100774547 3300005445 Bacteria 902
27 Ga0070681_10370807 3300005458 Bacteria 1342
28 Ga0070681_10874707 3300005458 Bacteria 817
29 Ga0070685_10486304 3300005466 Bacteria 871
30 Ga0070706_100093295 3300005467 Bacteria 2793
31 Ga0070706_100141862 3300005467 Bacteria 2242
32 Ga0070707_100065707 3300005468 Bacteria 3485
33 Ga0070707_100146729 3300005468 Bacteria 2296
34 Ga0070707_100277024 3300005468 Bacteria 1631
35 Ga0070707_101048773 3300005468 Bacteria 781
36 Ga0070698_100000167 3300005471 Bacteria 60583
37 Ga0070698_100070783 3300005471 Bacteria 3499
38 Ga0070699_100097703 3300005518 Bacteria 2573
39 Ga0070684_100179781 3300005535 Bacteria 1923
40 Ga0070684_100198332 3300005535 Bacteria 1828
41 Ga0070684_100301838 3300005535 Bacteria 1469
42 Ga0070684_101273349 3300005535 Bacteria 692
43 Ga0068853_100383376 3300005539 Bacteria 1313
44 Ga0070686_100723175 3300005544 Bacteria 796
45 Ga0070665_100125650 3300005548 Bacteria 2567
46 Ga0070704_101831796 3300005549 Bacteria 562
47 Ga0068855_100038776 3300005563 Bacteria 5659
48 Ga0070664_100040849 3300005564 Bacteria 3913
49 Ga0070664_100047083 3300005564 Bacteria 3643
50 Ga0070664_100146863 3300005564 Bacteria 2080
51 Ga0068857_100048670 3300005577 Bacteria 3763
52 Ga0068857_100106437 3300005577 Bacteria 2519
53 Ga0068856_100273961 3300005614 Bacteria 1704
54 Ga0070702_100192936 3300005615 Bacteria 1342
55 Ga0070702_100654320 3300005615 Bacteria 795
56 Ga0068852_100048221 3300005616 Bacteria 3639
57 Ga0068852_100248276 3300005616 Bacteria 1704
58 Ga0068859_100098146 3300005617 Bacteria 2983
59 Ga0068864_100012262 3300005618 Bacteria 7083
60 Ga0068863_100040671 3300005841 Bacteria 4420
61 Ga0068858_100000711 3300005842 Bacteria 34748
62 Ga0068860_100037608 3300005843 Bacteria 4633
63 Ga0068862_100106849 3300005844 Bacteria 2454
64 Ga0070717_10002580 3300006028 Bacteria 12786
65 Ga0070717_10077064 3300006028 Bacteria 2791
66 Ga0070717_10516069 3300006028 Bacteria 1081
67 Ga0075365_10281741 3300006038 Bacteria 1170
68 Ga0075363_100119088 3300006048 Bacteria 1473
69 Ga0075363_100179302 3300006048 Bacteria 1205
70 Ga0075364_10187971 3300006051 Bacteria 1398
71 Ga0070715_10139243 3300006163 Bacteria 1177
72 Ga0068871_100634948 3300006358 Bacteria 974
73 Ga0075430_100017753 3300006846 Bacteria 6057
74 Ga0075431_100026443 3300006847 Bacteria 5955
75 Ga0075431_100036298 3300006847 Bacteria 5076
76 Ga0075431_100883401 3300006847 Bacteria 864
77 Ga0097620_100098147 3300006931 Bacteria 2983
78 Ga0105244_10053418 3300009036 Bacteria 2053
79 Ga0105240_10022984 3300009093 Bacteria 8258
80 Ga0105245_10110932 3300009098 Bacteria 2551
81 Ga0105247_10936709 3300009101 Bacteria 672
82 Ga0114129_10000446 3300009147 Bacteria 49171
83 Ga0114129_10017220 3300009147 Bacteria 10293
84 Ga0114129_10079579 3300009147 Bacteria 4557
85 Ga0114129_10345504 3300009147 Bacteria 1972
86 Ga0105248_10482283 3300009177 Bacteria 1398
87 Ga0105237_11300301 3300009545 Bacteria 734
88 Ga0105238_10616083 3300009551 Bacteria 1094
89 Ga0105249_10000893 3300009553 Bacteria 26438
90 Ga0105239_10392837 3300010375 Bacteria 1569
91 Ga0105239_12028300 3300010375 Bacteria 668
92 Ga0105246_10095631 3300011119 Bacteria 2151
93 Ga0105246_10863297 3300011119 Bacteria 808
94 Ga0157370_10022781 3300013104 Bacteria 6231
95 Ga0157370_10122351 3300013104 Bacteria 2430
96 Ga0157369_10006061 3300013105 Bacteria 14029
97 Ga0157369_10223620 3300013105 Bacteria 1970
98 Ga0157374_11322181 3300013296 Bacteria 743
99 Ga0157374_11554555 3300013296 Bacteria 685
100 Ga0163162_10567120 3300013306 Bacteria 1263
101 Ga0163162_11184837 3300013306 Bacteria 867
102 Ga0157372_10032804 3300013307 Bacteria 5697
103 Ga0157372_10193545 3300013307 Bacteria 2355
104 Ga0157372_10253045 3300013307 Bacteria 2045
105 Ga0157372_10510595 3300013307 Bacteria 1401
106 Ga0157372_11591634 3300013307 Bacteria 752
107 Ga0157372_12182363 3300013307 Bacteria 636
108 Ga0157375_10267154 3300013308 Bacteria 1872
109 Ga0157375_10938015 3300013308 Bacteria 1008
110 Ga0157375_11051547 3300013308 Bacteria 952
111 Ga0163163_10001227 3300014325 Bacteria 21689
112 Ga0163163_10482173 3300014325 Bacteria 1301
113 Ga0163163_11504947 3300014325 Bacteria 734
114 Ga0157377_10240681 3300014745 Bacteria 1168
115 Ga0157379_10000496 3300014968 Bacteria 32033
116 Ga0157379_10066281 3300014968 Bacteria 3228
117 Ga0157376_11561972 3300014969 Bacteria 694
118 Ga0163161_10431974 3300017792 Bacteria 1061
119 Ga0206356_11321571 3300020070 Bacteria 1082
120 Ga0206354_10964057 3300020081 Bacteria 972
121 Ga0206353_10597598 3300020082 Bacteria 1312
122 Ga0224712_10145637 3300022467 Bacteria 1046
123 Ga0207680_10839634 3300025903 Bacteria 659
124 Ga0207647_10025454 3300025904 Bacteria 3887
125 Ga0207684_10114196 3300025910 Bacteria 2313
126 Ga0207684_11225782 3300025910 Bacteria 620
127 Ga0207695_10067138 3300025913 Bacteria 3680
128 Ga0207662_10387081 3300025918 Bacteria 946
129 Ga0207646_10001990 3300025922 Bacteria 24555
130 Ga0207646_10222018 3300025922 Bacteria 1707
131 Ga0207646_10778386 3300025922 Bacteria 853
132 Ga0207694_10665384 3300025924 Bacteria 878
133 Ga0207650_10155885 3300025925 Bacteria 1806
134 Ga0207659_10340586 3300025926 Bacteria 1242
135 Ga0207700_10311499 3300025928 Bacteria 1362
136 Ga0207700_10496692 3300025928 Bacteria 1079
137 Ga0207690_10287003 3300025932 Bacteria 1283
138 Ga0207709_10656604 3300025935 Bacteria 835
139 Ga0207704_10629569 3300025938 Bacteria 881
140 Ga0207661_10004109 3300025944 Bacteria 10176
141 Ga0207661_10196393 3300025944 Bacteria 1772
142 Ga0207661_10507175 3300025944 Bacteria 1102
143 Ga0207661_10985785 3300025944 Bacteria 776
144 Ga0207679_10047736 3300025945 Bacteria 3113
145 Ga0207679_10060876 3300025945 Bacteria 2807
146 Ga0207667_10036906 3300025949 Bacteria 5231
147 Ga0207651_10363944 3300025960 Bacteria 1222
148 Ga0207712_10540744 3300025961 Bacteria 1001
149 Ga0207640_10354688 3300025981 Bacteria 1180
150 Ga0207658_10155297 3300025986 Bacteria 1869
151 Ga0207703_10000003 3300026035 Bacteria 532213
152 Ga0207708_10204174 3300026075 Bacteria 1577
153 Ga0207641_10135016 3300026088 Bacteria 2220
154 Ga0207648_11156929 3300026089 Bacteria 726
155 Ga0207676_11314930 3300026095 Bacteria 718
156 Ga0207674_10070526 3300026116 Bacteria 3513
157 Ga0207674_10124423 3300026116 Bacteria 2545
158 Ga0207674_10139576 3300026116 Bacteria 2384
159 Ga0207683_10559739 3300026121 Bacteria 1057
160 Ga0207698_10235717 3300026142 Bacteria 1664
161 Ga0268265_10088370 3300028380 Bacteria 2469
162 Ga0268264_10000576 3300028381 Bacteria 44482
163 Ga0307511_10249176 3300030521 Bacteria 856
164 Ga0307512_10032691 3300030522 Bacteria 4486
165 Ga0307513_10245825 3300031456 Bacteria 1590
166 Ga0307509_10061552 3300031507 Bacteria 3961
167 Ga0307508_10000257 3300031616 Bacteria 64856
168 Ga0307508_10078356 3300031616 Bacteria 2885
169 Ga0307508_10092278 3300031616 Bacteria 2617
170 Ga0307508_10192307 3300031616 Bacteria 1642
171 Ga0307508_10251106 3300031616 Bacteria 1365
172 Ga0316575_10000001 3300031665 Bacteria 151281
173 Ga0316575_10006580 3300031665 Bacteria 4186
174 Ga0316575_10018297 3300031665 Bacteria 2669
175 Ga0316579_10025854 3300031691 Bacteria 2653
176 Ga0316576_10001855 3300031727 Bacteria 11735
177 Ga0316576_10003125 3300031727 Bacteria 9657
178 Ga0316576_10012522 3300031727 Bacteria 5606
179 Ga0316576_10014073 3300031727 Bacteria 5335
180 Ga0316576_10016161 3300031727 Bacteria 5031
181 Ga0316576_10099693 3300031727 Bacteria 2170
182 Ga0316578_10001048 3300031728 Bacteria 10658
183 Ga0316578_10002819 3300031728 Bacteria 7765
184 Ga0316578_10031988 3300031728 Bacteria 3002
185 Ga0316578_10278384 3300031728 Unclassified 1002
186 Ga0307516_10000971 3300031730 Bacteria 39615
187 Ga0307516_10018849 3300031730 Bacteria 7163
188 Ga0307405_10114693 3300031731 Bacteria 1832
189 Ga0307405_10464294 3300031731 Bacteria 1007
190 Ga0307405_10483614 3300031731 Bacteria 989
191 Ga0316577_10015105 3300031733 Bacteria 4245
192 Ga0307518_10208947 3300031838 Bacteria 1287
193 Ga0307406_10816305 3300031901 Bacteria 788
194 Ga0307407_10505317 3300031903 Bacteria 887
195 Ga0307409_100669195 3300031995 Bacteria 1034
196 Ga0307416_100781885 3300032002 Bacteria 1049
197 Ga0307411_10602544 3300032005 Bacteria 945
198 Ga0307415_100178928 3300032126 Bacteria 1662
199 Ga0307415_100349031 3300032126 Bacteria 1245
200 Ga0316583_10016250 3300032133 Bacteria 2679
201 Ga0316580_10008879 3300032139 Bacteria 3017
202 Ga0316593_10010743 3300032168 Bacteria 2639
203 Ga0316593_10037548 3300032168 Bacteria 1601
204 Ga0307507_10006363 3300033179 Bacteria 18205
205 Ga0307507_10345157 3300033179 Bacteria 879
206 Ga0307510_10231897 3300033180 Bacteria 1348
207 Ga0307510_10424959 3300033180 Bacteria 771
208 Ga0316592_1003717 3300033524 Bacteria 2779
209 Ga0316592_1005174 3300033524 Bacteria 2465
210 Ga0316592_1090381 3300033524 Bacteria 700
211 Ga0316592_1098912 3300033524 Bacteria 670
212 Ga0316586_1002852 3300033527 Bacteria 2206
213 Ga0316586_1002860 3300033527 Bacteria 2205
214 Ga0316586_1003219 3300033527 Bacteria 2123
215 Ga0316588_1006018 3300033528 Bacteria 2403
216 Ga0316588_1008292 3300033528 Bacteria 2134
217 Ga0316587_1005909 3300033529 Bacteria 1853
218 Ga0316587_1008153 3300033529 Bacteria 1642
219 Ga0316596_1021059 3300033541 Bacteria 1660
220 Ga0316596_1047854 3300033541 Bacteria 1130
221 Ga0373926_0002478 3300035083 Bacteria 5860
222 Ga0373944_0069349 3300035089 Bacteria 1146
223 Ga0373945_0159170 3300035116 Bacteria 920
224 Ga0373953_0026457 3300035117 Bacteria 2222
225 Ga0373954_0181872 3300035118 Bacteria 1031
226 Ga0373954_0203310 3300035118 Bacteria 973
227 Ga0373957_0116108 3300035120 Bacteria 1081
228 Ga0316574_0007004 3300035398 Bacteria 6143
229 Ga0316574_0024394 3300035398 Bacteria 3618
230 Ga0316574_0049046 3300035398 Bacteria 2624
231 Ga0316574_0067076 3300035398 Bacteria 2262
232 Ga0373935_0004573 3300035692 Bacteria 8136
233 Ga0373933_0426916 3300035724 Bacteria 866
234 Ga0373947_0000016 3300035725 Bacteria 124284
235 Ga0373947_0742182 3300035725 Bacteria 670
236 Ga0373937_0065201 3300036401 Bacteria 3352
237 Ga0373937_0208514 3300036401 Bacteria 1838
238 Ga0316582_0000644 3300036647 Bacteria 13652
239 Ga0316584_0001926 3300036712 Bacteria 12926
240 Ga0316584_0072705 3300036712 Bacteria 2577
241 Ga0373925_1144918 3300037068 Bacteria 640
242 Ga0395899_0013499 3300037312 Bacteria 6244
243 Ga0395900_0041356 3300037418 Bacteria 4752
244 Ga0395900_0066094 3300037418 Bacteria 3716
245 Ga0395898_0014539 3300037466 Bacteria 8083
246 Ga0395898_0286805 3300037466 Bacteria 1570
247 Ga0395898_0481099 3300037466 Bacteria 1181
248 Ga0395905_0051830 3300037471 Bacteria 3844
249 Ga0395905_0841234 3300037471 Bacteria 821
250 Ga0395901_0044705 3300038443 Bacteria 4593
251 Ga0395901_0092082 3300038443 Bacteria 3173
252 Ga0395901_0109967 3300038443 Bacteria 2893
253 Ga0395901_0172455 3300038443 Bacteria 2269
254 Ga0451795_0369261 3300041456 Bacteria 590
255 Ga0439448_0072595 3300042005 Bacteria 1147
256 Ga0439440_0019925 3300042993 Bacteria 1501
257 Ga0495592_0588876 3300046454 Bacteria 680
258 Ga0495629_0069268 3300046459 Bacteria 2462
259 Ga0495629_0165108 3300046459 Bacteria 1538
260 Ga0495629_0524457 3300046459 Bacteria 797
261 Ga0495651_0071639 3300046462 Bacteria 2635
262 Ga0495653_0219721 3300046463 Bacteria 1278
263 Ga0495582_0111158 3300046473 Bacteria 1539
264 Ga0495594_0001619 3300046499 Bacteria 11714
265 Ga0495630_0159739 3300046517 Bacteria 1716
266 Ga0495630_0352542 3300046517 Bacteria 1126
267 Ga0495630_0847242 3300046517 Bacteria 697
268 Ga0495587_0356737 3300046536 Bacteria 814
269 Ga0495597_0140570 3300046542 Bacteria 996
270 Ga0495667_0117646 3300046559 Bacteria 1717
271 Ga0495634_0328364 3300046642 Bacteria 920
272 Ga0495611_0282923 3300046648 Bacteria 766
273 Ga0495635_0293396 3300046663 Bacteria 1091
274 Ga0495635_0364056 3300046663 Bacteria 964
275 Ga0495623_0141893 3300046679 Bacteria 1428
276 Ga0495658_0822974 3300046683 Bacteria 594
277 Ga0495613_0511382 3300046689 Bacteria 808
278 Ga0495624_0254755 3300046690 Bacteria 1061
279 Ga0495600_0456261 3300046809 Bacteria 790
280 Ga0495581_0225552 3300047315 Bacteria 1096
281 Ga0495604_0286988 3300047317 Bacteria 1110
282 Ga0495674_0284612 3300047319 Bacteria 1354
283 Ga0495680_0162001 3300047322 Bacteria 1624
284 Ga0495680_0719675 3300047322 Bacteria 658
285 Ga0495602_0391639 3300048088 Bacteria 993
286 Ga0496100_0019527 3300048903 Bacteria 4045
287 Ga0496100_0378880 3300048903 Bacteria 1074
288 Ga0496100_0751785 3300048903 Bacteria 762
289 Ga0496100_0968287 3300048903 Bacteria 669
290 Ga0496101_0070878 3300048904 Bacteria 2553
291 Ga0496101_0078501 3300048904 Bacteria 2435
292 Ga0496101_0256504 3300048904 Bacteria 1363
293 Ga0496101_0379792 3300048904 Bacteria 1112
294 Ga0496102_0043496 3300048905 Bacteria 4073
295 Ga0496102_0128008 3300048905 Bacteria 2375
296 Ga0496102_0183995 3300048905 Bacteria 1968
297 Ga0496102_0786280 3300048905 Bacteria 874
298 Ga0496102_1388244 3300048905 Bacteria 621
299 Ga0496103_0397558 3300048906 Bacteria 885
300 Ga0496104_0012699 3300048907 Bacteria 7585
301 Ga0496104_0013216 3300048907 Bacteria 7442
302 Ga0496104_0054560 3300048907 Bacteria 3777
303 Ga0496104_0077992 3300048907 Bacteria 3156
304 Ga0496104_0269581 3300048907 Bacteria 1615
305 Ga0496104_0395329 3300048907 Bacteria 1295
306 Ga0496104_1213473 3300048907 Bacteria 657
307 Ga0496105_0001090 3300048908 Bacteria 18828
308 Ga0496105_0048618 3300048908 Bacteria 3501
309 Ga0496105_0212589 3300048908 Bacteria 1576
310 Ga0496106_0098627 3300048909 Bacteria 2264
311 Ga0496106_0268328 3300048909 Bacteria 1366
312 Ga0496107_0147590 3300048910 Bacteria 1739
313 Ga0496107_0313579 3300048910 Bacteria 1167
314 Ga0496107_0826072 3300048910 Bacteria 678
315 Ga0496108_0085788 3300048911 Bacteria 2673
316 Ga0496108_0136169 3300048911 Bacteria 2113
317 Ga0496108_0201650 3300048911 Bacteria 1727
318 Ga0496108_0205894 3300048911 Bacteria 1707
319 Ga0496108_0687988 3300048911 Bacteria 887
320 Ga0496109_0060676 3300048912 Bacteria 3456
321 Ga0496109_0173692 3300048912 Bacteria 2022
322 Ga0496109_0174638 3300048912 Bacteria 2016
323 Ga0496109_0323533 3300048912 Bacteria 1455
324 Ga0496109_0561377 3300048912 Bacteria 1077
325 Ga0496109_1270614 3300048912 Bacteria 672
326 Ga0496110_0003609 3300048913 Bacteria 11907
327 Ga0496110_0008319 3300048913 Bacteria 8345
328 Ga0496110_0045745 3300048913 Bacteria 3827
329 Ga0496110_0201194 3300048913 Bacteria 1810
330 Ga0496110_0207977 3300048913 Bacteria 1778
331 Ga0496110_0283926 3300048913 Bacteria 1507
332 Ga0496110_0441373 3300048913 Bacteria 1186
333 Ga0496110_0456922 3300048913 Bacteria 1164
334 Ga0496110_0592145 3300048913 Bacteria 1006
335 Ga0496111_0014665 3300048914 Bacteria 5359
336 Ga0496111_0076504 3300048914 Bacteria 2439
337 Ga0496111_0082819 3300048914 Bacteria 2343
338 Ga0496111_0548961 3300048914 Bacteria 848
339 Ga0496112_0016267 3300048915 Bacteria 6963
340 Ga0496112_0129931 3300048915 Bacteria 2490
341 Ga0496112_0153329 3300048915 Bacteria 2271
342 Ga0496112_0294495 3300048915 Bacteria 1569
343 Ga0496112_0594442 3300048915 Bacteria 1039
344 Ga0496112_0774484 3300048915 Bacteria 885
345 Ga0496112_0927682 3300048915 Bacteria 792
346 Ga0496113_0046173 3300048916 Bacteria 3233
347 Ga0496113_0114099 3300048916 Bacteria 2106
348 Ga0496113_0200246 3300048916 Bacteria 1587
349 Ga0496114_0024705 3300048917 Bacteria 4905
350 Ga0496114_0028407 3300048917 Bacteria 4590
351 Ga0496114_0059472 3300048917 Bacteria 3192
352 Ga0496114_0075148 3300048917 Bacteria 2845
353 Ga0496114_0196107 3300048917 Bacteria 1767
354 Ga0496114_0421403 3300048917 Bacteria 1182
355 Ga0496115_0282477 3300048918 Bacteria 1362
356 Ga0496115_0385750 3300048918 Bacteria 1139
357 Ga0496115_0750339 3300048918 Bacteria 763
358 Ga0496116_0000119 3300048919 Bacteria 167176
359 Ga0496117_0003284 3300048920 Bacteria 18969
360 Ga0496118_0005228 3300048921 Bacteria 14842
361 Ga0496119_0019280 3300048922 Bacteria 5033
362 Ga0496119_0032234 3300048922 Bacteria 3496
363 Ga0496121_0007235 3300048924 Bacteria 13436
364 Ga0501031_0000913 3300049568 Bacteria 17795
365 Ga0501031_0003686 3300049568 Bacteria 9853
366 Ga0501031_0154404 3300049568 Bacteria 1500
367 Ga0501031_0387025 3300049568 Bacteria 905
368 Ga0501031_0399406 3300049568 Bacteria 889
369 Ga0501032_0017012 3300049569 Bacteria 5108
370 Ga0501033_0019148 3300049570 Bacteria 5176
371 Ga0501033_0072571 3300049570 Bacteria 2527
372 Ga0501034_0018841 3300049571 Bacteria 7074
373 Ga0501034_0333987 3300049571 Bacteria 1447
374 Ga0501034_0392370 3300049571 Bacteria 1312
375 Ga0501036_0007899 3300049572 Bacteria 8702
376 Ga0501036_0016566 3300049572 Bacteria 6155
377 Ga0501036_0047610 3300049572 Bacteria 3631
378 Ga0501036_0349509 3300049572 Bacteria 1235
379 Ga0501036_0409775 3300049572 Bacteria 1130
380 Ga0501036_0522691 3300049572 Bacteria 987
381 Ga0501036_1267481 3300049572 Bacteria 600
382 Ga0501037_0206703 3300049573 Bacteria 1386
383 Ga0501037_0573909 3300049573 Bacteria 759
384 Ga0501038_0064012 3300049574 Bacteria 3137
385 Ga0501038_0098474 3300049574 Bacteria 2438
386 Ga0501038_0514147 3300049574 Bacteria 914
387 Ga0501038_0641834 3300049574 Bacteria 800
388 Ga0501039_0006409 3300049575 Bacteria 8942
389 Ga0501039_0039448 3300049575 Bacteria 3647
390 Ga0501039_0061799 3300049575 Bacteria 2901
391 Ga0501039_0171481 3300049575 Bacteria 1706
392 Ga0501039_0713248 3300049575 Bacteria 784
393 Ga0501040_0008866 3300049576 Bacteria 6536
394 Ga0501040_0009396 3300049576 Bacteria 6372
395 Ga0501040_0009452 3300049576 Bacteria 6358
396 Ga0501040_0081484 3300049576 Bacteria 2243
397 Ga0501040_0089468 3300049576 Bacteria 2139
398 Ga0501040_0292823 3300049576 Bacteria 1163
399 Ga0501040_0792188 3300049576 Bacteria 686
400 Ga0501041_0006357 3300049577 Bacteria 6913
401 Ga0501041_0009306 3300049577 Bacteria 5785
402 Ga0501041_0018970 3300049577 Bacteria 4099
403 Ga0501041_0048898 3300049577 Bacteria 2576
404 Ga0501041_0213663 3300049577 Bacteria 1210
405 Ga0501041_0374929 3300049577 Bacteria 900
406 Ga0501041_0531404 3300049577 Bacteria 749
407 Ga0501042_0003198 3300049578 Bacteria 10234
408 Ga0501042_0008662 3300049578 Bacteria 6740
409 Ga0501042_0034546 3300049578 Bacteria 3586
410 Ga0501042_0045049 3300049578 Bacteria 3144
411 Ga0501042_0094190 3300049578 Bacteria 2151
412 Ga0501042_0343597 3300049578 Bacteria 1079
413 Ga0501042_0351582 3300049578 Bacteria 1066
414 Ga0501042_0467014 3300049578 Bacteria 915
415 Ga0501042_0475003 3300049578 Bacteria 907
416 Ga0501042_1063547 3300049578 Bacteria 590
417 Ga0501043_0018221 3300049579 Bacteria 5505
418 Ga0501043_0259828 3300049579 Bacteria 1336
419 Ga0501046_0045547 3300049580 Bacteria 3485
420 Ga0501046_0053006 3300049580 Bacteria 3196
421 Ga0501046_0073820 3300049580 Bacteria 2647
422 Ga0501046_0084413 3300049580 Bacteria 2449
423 Ga0501046_0092732 3300049580 Bacteria 2322
424 Ga0501046_0094317 3300049580 Bacteria 2300
425 Ga0501046_0104305 3300049580 Bacteria 2173
426 Ga0501046_0168409 3300049580 Bacteria 1645
427 Ga0501046_0196836 3300049580 Bacteria 1501
428 Ga0501047_0108778 3300049581 Bacteria 2655
429 Ga0501048_0005139 3300049582 Bacteria 9968
430 Ga0501048_0008407 3300049582 Bacteria 7805
431 Ga0501048_0016896 3300049582 Bacteria 5379
432 Ga0501048_0032011 3300049582 Bacteria 3803
433 Ga0501048_0328195 3300049582 Bacteria 1090
434 Ga0501067_0000743 3300049583 Bacteria 17525
435 Ga0501068_0038089 3300049584 Bacteria 2879
436 Ga0501068_0211459 3300049584 Bacteria 1232
437 Ga0501068_0701584 3300049584 Bacteria 662
438 Ga0501069_0038794 3300049585 Bacteria 2630
439 Ga0501069_0100195 3300049585 Bacteria 1644
440 Ga0501069_0106217 3300049585 Bacteria 1596
441 Ga0501070_0093262 3300049586 Bacteria 2491
442 Ga0501070_0114717 3300049586 Bacteria 2225
443 Ga0501070_0799528 3300049586 Bacteria 741
444 Ga0501071_0006756 3300049587 Bacteria 7467
445 Ga0501071_0017348 3300049587 Bacteria 4962
446 Ga0501071_0105398 3300049587 Bacteria 2081
447 Ga0501071_0129201 3300049587 Bacteria 1876
448 Ga0501071_0479405 3300049587 Bacteria 953
449 Ga0501071_0935734 3300049587 Bacteria 669
450 Ga0501071_1260808 3300049587 Bacteria 571
451 Ga0501072_0005005 3300049588 Bacteria 10084
452 Ga0501072_0013715 3300049588 Bacteria 6204
453 Ga0501072_0030868 3300049588 Bacteria 4192
454 Ga0501072_0038015 3300049588 Bacteria 3777
455 Ga0501072_0050454 3300049588 Bacteria 3276
456 Ga0501072_0064681 3300049588 Bacteria 2884
457 Ga0501072_0287864 3300049588 Bacteria 1306
458 Ga0501073_0634390 3300049589 Bacteria 737
459 Ga0501073_0656734 3300049589 Bacteria 724
460 Ga0501074_0006155 3300049590 Bacteria 8666
461 Ga0501074_0021486 3300049590 Bacteria 4685
462 Ga0501074_0033710 3300049590 Bacteria 3711
463 Ga0501074_0137185 3300049590 Bacteria 1750
464 Ga0501074_0147792 3300049590 Bacteria 1681
465 Ga0501074_0162887 3300049590 Bacteria 1593
466 Ga0501074_0771886 3300049590 Unclassified 678
467 Ga0501075_0002108 3300049591 Bacteria 13151
468 Ga0501075_0003711 3300049591 Bacteria 10257
469 Ga0501075_0038303 3300049591 Bacteria 3583
470 Ga0501075_0067991 3300049591 Bacteria 2691
471 Ga0501075_0170265 3300049591 Unclassified 1662
472 Ga0501075_0171145 3300049591 Bacteria 1657
473 Ga0501075_0200608 3300049591 Bacteria 1521
474 Ga0501075_0289990 3300049591 Bacteria 1247
475 Ga0501075_0374826 3300049591 Bacteria 1085
476 Ga0501075_0375418 3300049591 Bacteria 1084
477 Ga0501075_0383343 3300049591 Bacteria 1072
478 Ga0501076_0005020 3300049592 Bacteria 9470
479 Ga0501076_0015817 3300049592 Bacteria 5708
480 Ga0501076_0049146 3300049592 Bacteria 3335
481 Ga0501076_0096521 3300049592 Bacteria 2381
482 Ga0501076_0107831 3300049592 Bacteria 2249
483 Ga0501076_0111432 3300049592 Bacteria 2212
484 Ga0501076_0158633 3300049592 Bacteria 1842
485 Ga0501076_0603668 3300049592 Bacteria 905
486 Ga0501076_0988331 3300049592 Bacteria 693
487 Ga0501077_0007727 3300049593 Bacteria 6635
488 Ga0501077_0012160 3300049593 Bacteria 5387
489 Ga0501077_0013664 3300049593 Bacteria 5089
490 Ga0501077_0054568 3300049593 Bacteria 2538
491 Ga0501077_0237433 3300049593 Bacteria 1159
492 Ga0501077_0320429 3300049593 Bacteria 988
493 Ga0501077_0497478 3300049593 Bacteria 782
494 Ga0501079_0009970 3300049741 Bacteria 7212
495 Ga0501079_0038837 3300049741 Bacteria 3671
496 Ga0501079_0069563 3300049741 Bacteria 2717
497 Ga0501079_0182933 3300049741 Bacteria 1636
498 Ga0501079_0575287 3300049741 Bacteria 886
499 Ga0501079_0682888 3300049741 Bacteria 808
500 Ga0501080_0007922 3300049742 Bacteria 9623
501 Ga0501080_0009204 3300049742 Bacteria 8998
502 Ga0501080_0054989 3300049742 Bacteria 3707
503 Ga0501080_0710447 3300049742 Bacteria 886
504 Ga0501081_0006413 3300049743 Bacteria 7633
505 Ga0501081_0009768 3300049743 Bacteria 6252
506 Ga0501081_0039714 3300049743 Bacteria 3221
507 Ga0501081_0085936 3300049743 Bacteria 2208
508 Ga0501081_0172263 3300049743 Bacteria 1563
509 Ga0501081_0214925 3300049743 Bacteria 1397
510 Ga0501081_0225699 3300049743 Bacteria 1363
511 Ga0501081_0788677 3300049743 Bacteria 715
512 Ga0501083_0016184 3300049744 Bacteria 5222
513 Ga0501083_0041709 3300049744 Bacteria 3112
514 Ga0501083_0520005 3300049744 Bacteria 775
515 Ga0501035_0053707 3300049822 Bacteria 3602
516 Ga0501035_0112998 3300049822 Bacteria 2379
517 Ga0501035_0592640 3300049822 Bacteria 904
518 Ga0501035_0701220 3300049822 Bacteria 816
519 Ga0501044_0252800 3300049823 Bacteria 1703
520 Ga0501044_0994685 3300049823 Bacteria 711
521 Ga0501045_0002811 3300049824 Bacteria 11893
522 Ga0501045_0006966 3300049824 Bacteria 7836
523 Ga0501045_0019064 3300049824 Bacteria 4886
524 Ga0501045_0058140 3300049824 Bacteria 2831
525 Ga0501045_0124803 3300049824 Bacteria 1912
526 Ga0501045_0185767 3300049824 Bacteria 1549
527 Ga0501045_0239345 3300049824 Bacteria 1351
528 Ga0501045_0429022 3300049824 Bacteria 983
529 nmdc:mga03n38_79229_c1 3300050490 Bacteria 1539
530 nmdc:mga06z11_329727_c1 3300050494 Bacteria 911
531 nmdc:mga05p37_1367_c1 3300050507 Bacteria 28342
532 nmdc:mga05p37_164516_c1 3300050507 Bacteria 2708
533 nmdc:mga05p37_2560_c1 3300050507 Bacteria 21147
534 nmdc:mga05p37_286517_c1 3300050507 Bacteria 1962
535 nmdc:mga0qj67_5258_c1 3300050509 Bacteria 9439
536 nmdc:mga06r32_2695_c1 3300050510 Bacteria 15876
537 Ga0495601_0140235 3300053077 Bacteria 1577
538 Ga0495595_0473138 3300053084 Bacteria 638
539 Ga0495619_0023348 3300053085 Bacteria 3965
540 Ga0495619_0294122 3300053085 Bacteria 1125
541 Ga0500630_272532 3300053159 Bacteria 576
542 Ga0501084_0007439 3300054114 Bacteria 9028
543 Ga0501084_0042812 3300054114 Bacteria 3788
544 Ga0501084_0045616 3300054114 Bacteria 3670
545 Ga0501084_0049672 3300054114 Bacteria 3511
546 Ga0501084_0051513 3300054114 Bacteria 3445
547 Ga0501084_0112800 3300054114 Bacteria 2284
548 Ga0501084_0132142 3300054114 Bacteria 2101
549 Ga0501084_0160608 3300054114 Bacteria 1896
550 Ga0501084_0396555 3300054114 Bacteria 1166
551 Ga0501084_0663600 3300054114 Bacteria 880
552 Ga0501084_1027271 3300054114 Bacteria 692
553 Ga0501082_0008736 3300060353 Bacteria 8731
554 Ga0501082_0014645 3300060353 Bacteria 6756
555 Ga0501082_0072806 3300060353 Bacteria 2959
556 Ga0501082_0073507 3300060353 Bacteria 2945
557 Ga0501082_0112983 3300060353 Bacteria 2352
558 Ga0501082_0207615 3300060353 Bacteria 1704
559 Ga0501082_0403331 3300060353 Bacteria 1193
560 Ga0501082_0653544 3300060353 Bacteria 920
561 Ga0530510_0002028 3300061734 Bacteria 13915
562 Ga0530510_0004299 3300061734 Bacteria 9856
563 Ga0530510_0009089 3300061734 Bacteria 6964
564 Ga0530510_0047806 3300061734 Bacteria 3092
565 Ga0530510_0054968 3300061734 Bacteria 2877
566 Ga0530510_0397676 3300061734 Bacteria 1038
567 Ga0530510_0622415 3300061734 Bacteria 821
568 2644228632 2643221641 Bacteria 4490190
569 2644503963 2643221690 Bacteria 4654705
570 2644524688 2643221694 Bacteria 4392972
571 2644609012 2643221711 Bacteria 4865335
572 2644668776 2643221722 Bacteria 4247614
573 2816426372 2816332119 Bacteria 8120218
574 2819665856 2818991458 Bacteria 4794049
575 2855390730 2855386786 Bacteria 4752232
576 2919450213 2919446982 Bacteria 3994487
577 2932433484 2932431166 Bacteria 4215299
578 Ga0105239_10391319
579 JGI24740J21852_10037969
580 JGI24739J22299_10004236
581 JGI24737J22298_10015912
582 JGI24735J21928_10027814
583 JGI24735J21928_10125502
584 rootH2_10125301
585 Ga0058862_10080988
586 Ga0070683_100004382
587 Ga0070683_100076599
588 Ga0070683_100152959
589 Ga0070683_100239226
590 Ga0070683_100299526
591 Ga0070683_100966077
592 Ga0070682_100385133
593 Ga0070682_101120120
594 Ga0070675_100290144
595 Ga0070671_100802121
596 Ga0070659_100157070
597 Ga0070667_100120679
598 Ga0070667_100179649
599 Ga0070713_100112103
600 Ga0070713_100887985
601 Ga0070701_10503235
602 Ga0070708_100079567
603 Ga0070708_100774547
604 Ga0070681_10370807
605 Ga0070681_10874707
606 Ga0070685_10486304
607 Ga0070706_100093295
608 Ga0070706_100141862
609 Ga0070707_100065707
610 Ga0070707_100146729
611 Ga0070707_100277024
612 Ga0070707_101048773
613 Ga0070698_100000167
614 Ga0070698_100070783
615 Ga0070699_100097703
616 Ga0070684_100179781
617 Ga0070684_100198332
618 Ga0070684_100301838
619 Ga0070684_101273349
620 Ga0068853_100383376
621 Ga0070686_100723175
622 Ga0070665_100125650
623 Ga0070704_101831796
624 Ga0068855_100038776
625 Ga0070664_100040849
626 Ga0070664_100047083
627 Ga0070664_100146863
628 Ga0068857_100048670
629 Ga0068857_100106437
630 Ga0068856_100273961
631 Ga0070702_100192936
632 Ga0070702_100654320
633 Ga0068852_100048221
634 Ga0068852_100248276
635 Ga0068859_100098146
636 Ga0068864_100012262
637 Ga0068863_100040671
638 Ga0068858_100000711
639 Ga0068860_100037608
640 Ga0068862_100106849
641 Ga0070717_10002580
642 Ga0070717_10077064
643 Ga0070717_10516069
644 Ga0075365_10281741
645 Ga0075363_100119088
646 Ga0075363_100179302
647 Ga0075364_10187971
648 Ga0070715_10139243
649 Ga0068871_100634948
650 Ga0075430_100017753
651 Ga0075431_100026443
652 Ga0075431_100036298
653 Ga0075431_100883401
654 Ga0097620_100098147
655 Ga0105244_10053418
656 Ga0105240_10022984
657 Ga0105245_10110932
658 Ga0105247_10936709
659 Ga0114129_10000446
660 Ga0114129_10017220
661 Ga0114129_10079579
662 Ga0114129_10345504
663 Ga0105248_10482283
664 Ga0105237_11300301
665 Ga0105238_10616083
666 Ga0105249_10000893
667 Ga0105239_10392837
668 Ga0105239_12028300
669 Ga0105246_10095631
670 Ga0105246_10863297
671 Ga0157370_10022781
672 Ga0157370_10122351
673 Ga0157369_10006061
674 Ga0157369_10223620
675 Ga0157374_11322181
676 Ga0157374_11554555
677 Ga0163162_10567120
678 Ga0163162_11184837
679 Ga0157372_10032804
680 Ga0157372_10193545
681 Ga0157372_10253045
682 Ga0157372_10510595
683 Ga0157372_11591634
684 Ga0157372_12182363
685 Ga0157375_10267154
686 Ga0157375_10938015
687 Ga0157375_11051547
688 Ga0163163_10001227
689 Ga0163163_10482173
690 Ga0163163_11504947
691 Ga0157377_10240681
692 Ga0157379_10000496
693 Ga0157379_10066281
694 Ga0157376_11561972
695 Ga0163161_10431974
696 Ga0206356_11321571
697 Ga0206354_10964057
698 Ga0206353_10597598
699 Ga0224712_10145637
700 Ga0207680_10839634
701 Ga0207647_10025454
702 Ga0207684_10114196
703 Ga0207684_11225782
704 Ga0207695_10067138
705 Ga0207662_10387081
706 Ga0207646_10001990
707 Ga0207646_10222018
708 Ga0207646_10778386
709 Ga0207694_10665384
710 Ga0207650_10155885
711 Ga0207659_10340586
712 Ga0207700_10311499
713 Ga0207700_10496692
714 Ga0207690_10287003
715 Ga0207709_10656604
716 Ga0207704_10629569
717 Ga0207661_10004109
718 Ga0207661_10196393
719 Ga0207661_10507175
720 Ga0207661_10985785
721 Ga0207679_10047736
722 Ga0207679_10060876
723 Ga0207667_10036906
724 Ga0207651_10363944
725 Ga0207712_10540744
726 Ga0207640_10354688
727 Ga0207658_10155297
728 Ga0207703_10000003
729 Ga0207708_10204174
730 Ga0207641_10135016
731 Ga0207648_11156929
732 Ga0207676_11314930
733 Ga0207674_10070526
734 Ga0207674_10124423
735 Ga0207674_10139576
736 Ga0207683_10559739
737 Ga0207698_10235717
738 Ga0268265_10088370
739 Ga0268264_10000576
740 Ga0307511_10249176
741 Ga0307512_10032691
742 Ga0307513_10245825
743 Ga0307509_10061552
744 Ga0307508_10000257
745 Ga0307508_10078356
746 Ga0307508_10092278
747 Ga0307508_10192307
748 Ga0307508_10251106
749 Ga0316575_10000001
750 Ga0316575_10006580
751 Ga0316575_10018297
752 Ga0316579_10025854
753 Ga0316576_10001855
754 Ga0316576_10003125
755 Ga0316576_10012522
756 Ga0316576_10014073
757 Ga0316576_10016161
758 Ga0316576_10099693
759 Ga0316578_10001048
760 Ga0316578_10002819
761 Ga0316578_10031988
762 Ga0316578_10278384
763 Ga0307516_10000971
764 Ga0307516_10018849
765 Ga0307405_10114693
766 Ga0307405_10464294
767 Ga0307405_10483614
768 Ga0316577_10015105
769 Ga0307518_10208947
770 Ga0307406_10816305
771 Ga0307407_10505317
772 Ga0307409_100669195
773 Ga0307416_100781885
774 Ga0307411_10602544
775 Ga0307415_100178928
776 Ga0307415_100349031
777 Ga0316583_10016250
778 Ga0316580_10008879
779 Ga0316593_10010743
780 Ga0316593_10037548
781 Ga0307507_10006363
782 Ga0307507_10345157
783 Ga0307510_10231897
784 Ga0307510_10424959
785 Ga0316592_1003717
786 Ga0316592_1005174
787 Ga0316592_1090381
788 Ga0316592_1098912
789 Ga0316586_1002852
790 Ga0316586_1002860
791 Ga0316586_1003219
792 Ga0316588_1006018
793 Ga0316588_1008292
794 Ga0316587_1005909
795 Ga0316587_1008153
796 Ga0316596_1021059
797 Ga0316596_1047854
798 Ga0373926_0002478
799 Ga0373944_0069349
800 Ga0373945_0159170
801 Ga0373953_0026457
802 Ga0373954_0181872
803 Ga0373954_0203310
804 Ga0373957_0116108
805 Ga0316574_0007004
806 Ga0316574_0024394
807 Ga0316574_0049046
808 Ga0316574_0067076
809 Ga0373935_0004573
810 Ga0373933_0426916
811 Ga0373947_0000016
812 Ga0373947_0742182
813 Ga0373937_0065201
814 Ga0373937_0208514
815 Ga0316582_0000644
816 Ga0316584_0001926
817 Ga0316584_0072705
818 Ga0373925_1144918
819 Ga0395899_0013499
820 Ga0395900_0041356
821 Ga0395900_0066094
822 Ga0395898_0014539
823 Ga0395898_0286805
824 Ga0395898_0481099
825 Ga0395905_0051830
826 Ga0395905_0841234
827 Ga0395901_0044705
828 Ga0395901_0092082
829 Ga0395901_0109967
830 Ga0395901_0172455
831 Ga0451795_0369261
832 Ga0439448_0072595
833 Ga0439440_0019925
834 Ga0495592_0588876
835 Ga0495629_0069268
836 Ga0495629_0165108
837 Ga0495629_0524457
838 Ga0495651_0071639
839 Ga0495653_0219721
840 Ga0495582_0111158
841 Ga0495594_0001619
842 Ga0495630_0159739
843 Ga0495630_0352542
844 Ga0495630_0847242
845 Ga0495587_0356737
846 Ga0495597_0140570
847 Ga0495667_0117646
848 Ga0495634_0328364
849 Ga0495611_0282923
850 Ga0495635_0293396
851 Ga0495635_0364056
852 Ga0495623_0141893
853 Ga0495658_0822974
854 Ga0495613_0511382
855 Ga0495624_0254755
856 Ga0495600_0456261
857 Ga0495581_0225552
858 Ga0495604_0286988
859 Ga0495674_0284612
860 Ga0495680_0162001
861 Ga0495680_0719675
862 Ga0495602_0391639
863 Ga0496100_0019527
864 Ga0496100_0378880
865 Ga0496100_0751785
866 Ga0496100_0968287
867 Ga0496101_0070878
868 Ga0496101_0078501
869 Ga0496101_0256504
870 Ga0496101_0379792
871 Ga0496102_0043496
872 Ga0496102_0128008
873 Ga0496102_0183995
874 Ga0496102_0786280
875 Ga0496102_1388244
876 Ga0496103_0397558
877 Ga0496104_0012699
878 Ga0496104_0013216
879 Ga0496104_0054560
880 Ga0496104_0077992
881 Ga0496104_0269581
882 Ga0496104_0395329
883 Ga0496104_1213473
884 Ga0496105_0001090
885 Ga0496105_0048618
886 Ga0496105_0212589
887 Ga0496106_0098627
888 Ga0496106_0268328
889 Ga0496107_0147590
890 Ga0496107_0313579
891 Ga0496107_0826072
892 Ga0496108_0085788
893 Ga0496108_0136169
894 Ga0496108_0201650
895 Ga0496108_0205894
896 Ga0496108_0687988
897 Ga0496109_0060676
898 Ga0496109_0173692
899 Ga0496109_0174638
900 Ga0496109_0323533
901 Ga0496109_0561377
902 Ga0496109_1270614
903 Ga0496110_0003609
904 Ga0496110_0008319
905 Ga0496110_0045745
906 Ga0496110_0201194
907 Ga0496110_0207977
908 Ga0496110_0283926
909 Ga0496110_0441373
910 Ga0496110_0456922
911 Ga0496110_0592145
912 Ga0496111_0014665
913 Ga0496111_0076504
914 Ga0496111_0082819
915 Ga0496111_0548961
916 Ga0496112_0016267
917 Ga0496112_0129931
918 Ga0496112_0153329
919 Ga0496112_0294495
920 Ga0496112_0594442
921 Ga0496112_0774484
922 Ga0496112_0927682
923 Ga0496113_0046173
924 Ga0496113_0114099
925 Ga0496113_0200246
926 Ga0496114_0024705
927 Ga0496114_0028407
928 Ga0496114_0059472
929 Ga0496114_0075148
930 Ga0496114_0196107
931 Ga0496114_0421403
932 Ga0496115_0282477
933 Ga0496115_0385750
934 Ga0496115_0750339
935 Ga0496116_0000119
936 Ga0496117_0003284
937 Ga0496118_0005228
938 Ga0496119_0019280
939 Ga0496119_0032234
940 Ga0496121_0007235
941 Ga0501031_0000913
942 Ga0501031_0003686
943 Ga0501031_0154404
944 Ga0501031_0387025
945 Ga0501031_0399406
946 Ga0501032_0017012
947 Ga0501033_0019148
948 Ga0501033_0072571
949 Ga0501034_0018841
950 Ga0501034_0333987
951 Ga0501034_0392370
952 Ga0501036_0007899
953 Ga0501036_0016566
954 Ga0501036_0047610
955 Ga0501036_0349509
956 Ga0501036_0409775
957 Ga0501036_0522691
958 Ga0501036_1267481
959 Ga0501037_0206703
960 Ga0501037_0573909
961 Ga0501038_0064012
962 Ga0501038_0098474
963 Ga0501038_0514147
964 Ga0501038_0641834
965 Ga0501039_0006409
966 Ga0501039_0039448
967 Ga0501039_0061799
968 Ga0501039_0171481
969 Ga0501039_0713248
970 Ga0501040_0008866
971 Ga0501040_0009396
972 Ga0501040_0009452
973 Ga0501040_0081484
974 Ga0501040_0089468
975 Ga0501040_0292823
976 Ga0501040_0792188
977 Ga0501041_0006357
978 Ga0501041_0009306
979 Ga0501041_0018970
980 Ga0501041_0048898
981 Ga0501041_0213663
982 Ga0501041_0374929
983 Ga0501041_0531404
984 Ga0501042_0003198
985 Ga0501042_0008662
986 Ga0501042_0034546
987 Ga0501042_0045049
988 Ga0501042_0094190
989 Ga0501042_0343597
990 Ga0501042_0351582
991 Ga0501042_0467014
992 Ga0501042_0475003
993 Ga0501042_1063547
994 Ga0501043_0018221
995 Ga0501043_0259828
996 Ga0501046_0045547
997 Ga0501046_0053006
998 Ga0501046_0073820
999 Ga0501046_0084413
1000 Ga0501046_0092732
1001 Ga0501046_0094317
1002 Ga0501046_0104305
1003 Ga0501046_0168409
1004 Ga0501046_0196836
1005 Ga0501047_0108778
1006 Ga0501048_0005139
1007 Ga0501048_0008407
1008 Ga0501048_0016896
1009 Ga0501048_0032011
1010 Ga0501048_0328195
1011 Ga0501067_0000743
1012 Ga0501068_0038089
1013 Ga0501068_0211459
1014 Ga0501068_0701584
1015 Ga0501069_0038794
1016 Ga0501069_0100195
1017 Ga0501069_0106217
1018 Ga0501070_0093262
1019 Ga0501070_0114717
1020 Ga0501070_0799528
1021 Ga0501071_0006756
1022 Ga0501071_0017348
1023 Ga0501071_0105398
1024 Ga0501071_0129201
1025 Ga0501071_0479405
1026 Ga0501071_0935734
1027 Ga0501071_1260808
1028 Ga0501072_0005005
1029 Ga0501072_0013715
1030 Ga0501072_0030868
1031 Ga0501072_0038015
1032 Ga0501072_0050454
1033 Ga0501072_0064681
1034 Ga0501072_0287864
1035 Ga0501073_0634390
1036 Ga0501073_0656734
1037 Ga0501074_0006155
1038 Ga0501074_0021486
1039 Ga0501074_0033710
1040 Ga0501074_0137185
1041 Ga0501074_0147792
1042 Ga0501074_0162887
1043 Ga0501074_0771886
1044 Ga0501075_0002108
1045 Ga0501075_0003711
1046 Ga0501075_0038303
1047 Ga0501075_0067991
1048 Ga0501075_0170265
1049 Ga0501075_0171145
1050 Ga0501075_0200608
1051 Ga0501075_0289990
1052 Ga0501075_0374826
1053 Ga0501075_0375418
1054 Ga0501075_0383343
1055 Ga0501076_0005020
1056 Ga0501076_0015817
1057 Ga0501076_0049146
1058 Ga0501076_0096521
1059 Ga0501076_0107831
1060 Ga0501076_0111432
1061 Ga0501076_0158633
1062 Ga0501076_0603668
1063 Ga0501076_0988331
1064 Ga0501077_0007727
1065 Ga0501077_0012160
1066 Ga0501077_0013664
1067 Ga0501077_0054568
1068 Ga0501077_0237433
1069 Ga0501077_0320429
1070 Ga0501077_0497478
1071 Ga0501079_0009970
1072 Ga0501079_0038837
1073 Ga0501079_0069563
1074 Ga0501079_0182933
1075 Ga0501079_0575287
1076 Ga0501079_0682888
1077 Ga0501080_0007922
1078 Ga0501080_0009204
1079 Ga0501080_0054989
1080 Ga0501080_0710447
1081 Ga0501081_0006413
1082 Ga0501081_0009768
1083 Ga0501081_0039714
1084 Ga0501081_0085936
1085 Ga0501081_0172263
1086 Ga0501081_0214925
1087 Ga0501081_0225699
1088 Ga0501081_0788677
1089 Ga0501083_0016184
1090 Ga0501083_0041709
1091 Ga0501083_0520005
1092 Ga0501035_0053707
1093 Ga0501035_0112998
1094 Ga0501035_0592640
1095 Ga0501035_0701220
1096 Ga0501044_0252800
1097 Ga0501044_0994685
1098 Ga0501045_0002811
1099 Ga0501045_0006966
1100 Ga0501045_0019064
1101 Ga0501045_0058140
1102 Ga0501045_0124803
1103 Ga0501045_0185767
1104 Ga0501045_0239345
1105 Ga0501045_0429022
1106 nmdc:mga03n38_79229_c1
1107 nmdc:mga06z11_329727_c1
1108 nmdc:mga05p37_1367_c1
1109 nmdc:mga05p37_164516_c1
1110 nmdc:mga05p37_2560_c1
1111 nmdc:mga05p37_286517_c1
1112 nmdc:mga0qj67_5258_c1
1113 nmdc:mga06r32_2695_c1
1114 Ga0495601_0140235
1115 Ga0495595_0473138
1116 Ga0495619_0023348
1117 Ga0495619_0294122
1118 Ga0500630_272532
1119 Ga0501084_0007439
1120 Ga0501084_0042812
1121 Ga0501084_0045616
1122 Ga0501084_0049672
1123 Ga0501084_0051513
1124 Ga0501084_0112800
1125 Ga0501084_0132142
1126 Ga0501084_0160608
1127 Ga0501084_0396555
1128 Ga0501084_0663600
1129 Ga0501084_1027271
1130 Ga0501082_0008736
1131 Ga0501082_0014645
1132 Ga0501082_0072806
1133 Ga0501082_0073507
1134 Ga0501082_0112983
1135 Ga0501082_0207615
1136 Ga0501082_0403331
1137 Ga0501082_0653544
1138 Ga0530510_0002028
1139 Ga0530510_0004299
1140 Ga0530510_0009089
1141 Ga0530510_0047806
1142 Ga0530510_0054968
1143 Ga0530510_0397676
1144 Ga0530510_0622415
1145 2644228632
1146 2644503963
1147 2644524688
1148 2644609012
1149 2644668776
1150 2816426372
1151 2819665856
1152 2855390730
1153 2919450213
1154 2932433484

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13686

DrsE_2

DsrE/DsrF/DrsH-like family

33

190

0.88

PF02635

DsrE

DsrE/DsrF-like family

34

189

0.75

Structural Annotation

Top 5 Hits

ID Description Score Start End
6qlg-assembly1.cif.gz_A crystal structure of anubix (pada1) in complex with fmn and dimethylallyl pyrophosphate 0.875 23 63
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8468 23 172
1l1s-assembly1.cif.gz_A structure of protein of unknown function mth1491 from methanobacterium thermoautotrophicum 0.8329 23 172
2qs7-assembly2.cif.gz_D crystal structure of a putative oxidoreductase of the dsre/dsrf-like family (sso1126) from sulfolobus solfataricus p2 at 2.09 a resolution 0.8192 23 172
2pd2-assembly1.cif.gz_A crystal structure of (st0148) conserved hypothetical from sulfolobus tokodaii strain7 0.8084 24 172
ID Description Score Start End Superfamily
af_Q58170_143_270_3.40.1260.10 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8597 24 165 3.40.1260.10
af_P9WNZ1_7_185_3.40.50.1950 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Flavin prenyltransferase-like 0.8357 23 63 3.40.50.1950
af_Q9LSB5_234_404_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8345 23 58 3.40.50.2000
2qs7B00 Alpha Beta;3-Layer(aba) Sandwich;Hypothetical Protein Ychn; Chain: A,;DsrEFH-like 0.8139 23 172 3.40.1260.10
af_Q80YV4_599_714_3.40.50.10880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Uncharacterised protein PF01937, DUF89, domain 3 0.8128 23 57 3.40.50.10880
ID Description Score Start End GO Terms
AF-A0A7Y3ET23-F1-model_v4 Peroxiredoxin family protein 0.9912 23 172
AF-A0A7Y0PG17-F1-model_v4 Peroxiredoxin family protein 0.9885 28 172
AF-B3QVR0-F1-model_v4 Peroxiredoxin family protein 0.9872 23 172
AF-A0A7Y2BH32-F1-model_v4 Peroxiredoxin family protein 0.9841 36 172
AF-A0A7Y5WCA7-F1-model_v4 DsrE/DsrF/DrsH-like family protein 0.9839 21 172

Map