F465492

General Info

Members Datasets Scaffolds Average Seq Length
576 271 1152 128

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100194633|Ga0075428_1001946332
Length 138
Sequence MGAHRPRWSGMPTVRTETLDLRSASDVVSVRQIVRTWSIEAGFSLVDQTKMVTAASELARNTVDYGGGGTVCLELMTDGIRRGVRVTFQDQGPGIPDIEKAMQDHYTTGNGGAKRLVNEFDITSRVGEGTRVAITRWK

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
93 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
94 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
170 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
171 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
172 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
173 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
174 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
175 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
178 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
179 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
180 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
181 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
182 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
189 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
197 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
198 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
199 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
200 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
201 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
202 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
203 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
204 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
205 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
208 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
211 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
212 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
213 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
214 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
215 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
228 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
245 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
249 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
250 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
251 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
252 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
261 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
264 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
265 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
266 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
269 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
270 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
271 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 4.34
Rhizosphere 94.27
Stem 0
Stem Tuber 0
Unclassified 2.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100194633 3300006844 Bacteria 2193
2 Ga0065704_10150401 3300005289 Bacteria 1434
3 Ga0065715_10108998 3300005293 Bacteria 2690
4 Ga0065707_10096641 3300005295 Bacteria 3249
5 Ga0065707_10135445 3300005295 Bacteria 1849
6 Ga0070658_10191257 3300005327 Bacteria 1725
7 Ga0070658_10219738 3300005327 Bacteria 1606
8 Ga0070658_11556399 3300005327 Bacteria 573
9 Ga0070676_10000282 3300005328 Bacteria 22559
10 Ga0070676_10339214 3300005328 Bacteria 1030
11 Ga0070683_100005660 3300005329 Bacteria 10434
12 Ga0070683_100037301 3300005329 Bacteria 4449
13 Ga0070690_100618937 3300005330 Bacteria 824
14 Ga0070670_100014281 3300005331 Bacteria 6814
15 Ga0070670_100019199 3300005331 Bacteria 5861
16 Ga0070670_100077733 3300005331 Bacteria 2851
17 Ga0070670_100132163 3300005331 Bacteria 2156
18 Ga0070677_10175192 3300005333 Unclassified 1017
19 Ga0070677_10231586 3300005333 Bacteria 908
20 Ga0070677_10376561 3300005333 Bacteria 742
21 Ga0070677_10866573 3300005333 Unclassified 520
22 Ga0068869_100005685 3300005334 Bacteria 7864
23 Ga0068869_100051996 3300005334 Bacteria 2973
24 Ga0070666_10101931 3300005335 Bacteria 1979
25 Ga0070666_10140645 3300005335 Bacteria 1681
26 Ga0070680_100144983 3300005336 Bacteria 1992
27 Ga0068868_100074553 3300005338 Bacteria 2710
28 Ga0068868_100078007 3300005338 Bacteria 2651
29 Ga0068868_100148421 3300005338 Bacteria 1929
30 Ga0068868_101786289 3300005338 Bacteria 581
31 Ga0070660_100007611 3300005339 Bacteria 7549
32 Ga0070660_100066568 3300005339 Bacteria 2805
33 Ga0070660_100114452 3300005339 Bacteria 2148
34 Ga0070660_100979937 3300005339 Bacteria 714
35 Ga0070689_100012729 3300005340 Bacteria 6072
36 Ga0070689_100015306 3300005340 Bacteria 5590
37 Ga0070691_10357102 3300005341 Bacteria 813
38 Ga0070687_100002933 3300005343 Bacteria 6542
39 Ga0070687_100025412 3300005343 Bacteria 2841
40 Ga0070661_100001996 3300005344 Bacteria 14106
41 Ga0070661_100024252 3300005344 Bacteria 4351
42 Ga0070692_10002004 3300005345 Bacteria 7729
43 Ga0070692_10270091 3300005345 Bacteria 1026
44 Ga0070692_10379216 3300005345 Bacteria 887
45 Ga0070668_100000718 3300005347 Bacteria 22668
46 Ga0070668_100065756 3300005347 Bacteria 2813
47 Ga0070668_100116152 3300005347 Bacteria 2134
48 Ga0070668_101037558 3300005347 Bacteria 738
49 Ga0070669_100007480 3300005353 Bacteria 7825
50 Ga0070669_100008210 3300005353 Bacteria 7457
51 Ga0070669_100027330 3300005353 Bacteria 4105
52 Ga0070669_100069424 3300005353 Bacteria 2602
53 Ga0070669_101421691 3300005353 Bacteria 602
54 Ga0070675_100024133 3300005354 Bacteria 4869
55 Ga0070675_100187108 3300005354 Bacteria 1793
56 Ga0070675_100532548 3300005354 Bacteria 1061
57 Ga0070675_101106564 3300005354 Bacteria 728
58 Ga0070671_100027562 3300005355 Bacteria 4677
59 Ga0070671_100097425 3300005355 Bacteria 2466
60 Ga0070671_100204817 3300005355 Bacteria 1673
61 Ga0070671_100306705 3300005355 Bacteria 1352
62 Ga0070671_100689148 3300005355 Bacteria 886
63 Ga0070674_100088337 3300005356 Bacteria 2231
64 Ga0070674_100167269 3300005356 Bacteria 1673
65 Ga0070674_100220477 3300005356 Bacteria 1475
66 Ga0070674_100378600 3300005356 Bacteria 1151
67 Ga0070673_100027555 3300005364 Bacteria 4213
68 Ga0070673_100061878 3300005364 Bacteria 2971
69 Ga0070673_100888554 3300005364 Bacteria 826
70 Ga0070688_100003894 3300005365 Bacteria 7741
71 Ga0070688_100006593 3300005365 Bacteria 6213
72 Ga0070659_100011206 3300005366 Bacteria 6625
73 Ga0070659_100033551 3300005366 Bacteria 3987
74 Ga0070667_100007233 3300005367 Bacteria 9221
75 Ga0070667_100201542 3300005367 Bacteria 1766
76 Ga0070703_10289203 3300005406 Bacteria 679
77 Ga0070701_10002208 3300005438 Bacteria 7436
78 Ga0070701_10070920 3300005438 Bacteria 1863
79 Ga0070711_100019085 3300005439 Bacteria 4391
80 Ga0070711_100121470 3300005439 Bacteria 1933
81 Ga0070705_100177230 3300005440 Bacteria 1440
82 Ga0070700_100004761 3300005441 Bacteria 7119
83 Ga0070700_100006391 3300005441 Bacteria 6297
84 Ga0070700_100146118 3300005441 Bacteria 1612
85 Ga0070694_100009452 3300005444 Bacteria 5982
86 Ga0070694_100280704 3300005444 Bacteria 1270
87 Ga0070694_101301281 3300005444 Unclassified 611
88 Ga0070663_100018472 3300005455 Bacteria 4573
89 Ga0070663_100045955 3300005455 Bacteria 3087
90 Ga0070678_100012375 3300005456 Bacteria 5300
91 Ga0070678_100465663 3300005456 Bacteria 1110
92 Ga0070678_100567775 3300005456 Bacteria 1009
93 Ga0070662_100001977 3300005457 Bacteria 12576
94 Ga0070662_100194060 3300005457 Bacteria 1608
95 Ga0070662_100287046 3300005457 Bacteria 1333
96 Ga0070681_10000071 3300005458 Bacteria 74708
97 Ga0070681_11844442 3300005458 Bacteria 532
98 Ga0068867_100005816 3300005459 Bacteria 8747
99 Ga0068867_100007921 3300005459 Bacteria 7504
100 Ga0068867_100159911 3300005459 Bacteria 1776
101 Ga0070685_10219325 3300005466 Bacteria 1245
102 Ga0070699_100266336 3300005518 Bacteria 1533
103 Ga0070679_100019932 3300005530 Bacteria 6532
104 Ga0070684_100012941 3300005535 Bacteria 6709
105 Ga0070684_100189465 3300005535 Bacteria 1871
106 Ga0070684_100460752 3300005535 Bacteria 1175
107 Ga0068853_100005938 3300005539 Bacteria 9642
108 Ga0068853_100846567 3300005539 Bacteria 877
109 Ga0070672_100030245 3300005543 Bacteria 4067
110 Ga0070672_100055956 3300005543 Bacteria 3092
111 Ga0070672_100069860 3300005543 Bacteria 2789
112 Ga0070672_100107648 3300005543 Bacteria 2269
113 Ga0070672_100136598 3300005543 Bacteria 2019
114 Ga0070686_100002690 3300005544 Bacteria 9785
115 Ga0070686_100080770 3300005544 Bacteria 2152
116 Ga0070686_100311769 3300005544 Bacteria 1170
117 Ga0070695_100399207 3300005545 Bacteria 1042
118 Ga0070696_102009842 3300005546 Bacteria 502
119 Ga0070693_100280851 3300005547 Bacteria 1115
120 Ga0070665_100027257 3300005548 Bacteria 5754
121 Ga0070665_100070707 3300005548 Bacteria 3497
122 Ga0070665_100216690 3300005548 Bacteria 1915
123 Ga0070665_100312605 3300005548 Bacteria 1575
124 Ga0070665_101563868 3300005548 Bacteria 668
125 Ga0068855_100065242 3300005563 Bacteria 4245
126 Ga0068855_100797320 3300005563 Bacteria 1004
127 Ga0068855_100812272 3300005563 Bacteria 993
128 Ga0070664_100003897 3300005564 Bacteria 12039
129 Ga0070664_100035006 3300005564 Bacteria 4215
130 Ga0070664_100047635 3300005564 Bacteria 3621
131 Ga0070664_100104218 3300005564 Bacteria 2470
132 Ga0070664_100233234 3300005564 Bacteria 1650
133 Ga0070664_100345831 3300005564 Bacteria 1352
134 Ga0070664_100501453 3300005564 Bacteria 1119
135 Ga0070664_100842734 3300005564 Bacteria 858
136 Ga0068857_100001111 3300005577 Bacteria 20920
137 Ga0068857_100009848 3300005577 Bacteria 8300
138 Ga0068857_100024750 3300005577 Bacteria 5287
139 Ga0068857_100524398 3300005577 Bacteria 1114
140 Ga0068857_100968182 3300005577 Unclassified 818
141 Ga0068854_100481497 3300005578 Bacteria 1042
142 Ga0068854_100599858 3300005578 Bacteria 940
143 Ga0068854_100650782 3300005578 Bacteria 905
144 Ga0070702_100204454 3300005615 Bacteria 1310
145 Ga0068852_100191255 3300005616 Bacteria 1931
146 Ga0068852_100342246 3300005616 Bacteria 1458
147 Ga0068852_100854465 3300005616 Bacteria 926
148 Ga0068859_100049859 3300005617 Bacteria 4205
149 Ga0068864_100017121 3300005618 Bacteria 6044
150 Ga0068864_100101573 3300005618 Bacteria 2551
151 Ga0068864_100348244 3300005618 Bacteria 1397
152 Ga0068864_100989621 3300005618 Bacteria 834
153 Ga0068866_10049238 3300005718 Bacteria 2134
154 Ga0068861_100047490 3300005719 Bacteria 3241
155 Ga0068861_100057482 3300005719 Bacteria 2972
156 Ga0068861_100381217 3300005719 Bacteria 1246
157 Ga0068851_10005406 3300005834 Bacteria 5795
158 Ga0068851_10119404 3300005834 Bacteria 1415
159 Ga0068870_10006821 3300005840 Bacteria 5063
160 Ga0068870_10210992 3300005840 Bacteria 1183
161 Ga0068870_10271261 3300005840 Bacteria 1060
162 Ga0068863_100018347 3300005841 Bacteria 6697
163 Ga0068863_100066749 3300005841 Bacteria 3403
164 Ga0068863_100127170 3300005841 Bacteria 2432
165 Ga0068863_100180411 3300005841 Bacteria 2026
166 Ga0068863_100503984 3300005841 Unclassified 1192
167 Ga0068858_100009257 3300005842 Bacteria 9407
168 Ga0068860_100006337 3300005843 Bacteria 11881
169 Ga0068860_100026281 3300005843 Bacteria 5612
170 Ga0068862_100006757 3300005844 Bacteria 9511
171 Ga0068862_100024542 3300005844 Bacteria 5060
172 Ga0068862_100055414 3300005844 Bacteria 3396
173 Ga0068862_100057509 3300005844 Bacteria 3335
174 Ga0070715_10348047 3300006163 Bacteria 808
175 Ga0070716_100876651 3300006173 Bacteria 701
176 Ga0070712_100259846 3300006175 Bacteria 1391
177 Ga0075366_10022892 3300006195 Bacteria 3638
178 Ga0097621_100615149 3300006237 Bacteria 994
179 Ga0097621_101165591 3300006237 Bacteria 725
180 Ga0097621_101395359 3300006237 Bacteria 663
181 Ga0068871_100604895 3300006358 Bacteria 997
182 Ga0068871_101028888 3300006358 Bacteria 768
183 Ga0068871_101195127 3300006358 Bacteria 713
184 Ga0075428_100017888 3300006844 Bacteria 7833
185 Ga0075428_100322162 3300006844 Bacteria 1661
186 Ga0075428_100758739 3300006844 Bacteria 1032
187 Ga0075428_102402956 3300006844 Bacteria 541
188 Ga0075430_100002681 3300006846 Bacteria 14864
189 Ga0075430_100008889 3300006846 Bacteria 8478
190 Ga0075430_100036407 3300006846 Bacteria 4173
191 Ga0075431_100052907 3300006847 Bacteria 4187
192 Ga0075431_100068452 3300006847 Bacteria 3664
193 Ga0075431_100091994 3300006847 Bacteria 3130
194 Ga0075431_100095789 3300006847 Bacteria 3064
195 Ga0075431_100157689 3300006847 Bacteria 2335
196 Ga0075431_100300705 3300006847 Bacteria 1621
197 Ga0075431_101333838 3300006847 Bacteria 678
198 Ga0075433_10098883 3300006852 Bacteria 2583
199 Ga0075433_10106362 3300006852 Bacteria 2487
200 Ga0075433_10230463 3300006852 Bacteria 1645
201 Ga0075434_100033676 3300006871 Bacteria 5058
202 Ga0075434_100050471 3300006871 Bacteria 4133
203 Ga0075434_100885087 3300006871 Bacteria 908
204 Ga0075434_101157054 3300006871 Bacteria 786
205 Ga0075429_100195030 3300006880 Bacteria 1774
206 Ga0075429_100434974 3300006880 Bacteria 1149
207 Ga0075429_100481864 3300006880 Bacteria 1087
208 Ga0075429_100669010 3300006880 Bacteria 910
209 Ga0075429_100853253 3300006880 Bacteria 797
210 Ga0068865_100003002 3300006881 Bacteria 10080
211 Ga0068865_100019195 3300006881 Bacteria 4422
212 Ga0068865_100115695 3300006881 Bacteria 1985
213 Ga0097620_100049861 3300006931 Bacteria 4205
214 Ga0075435_100444256 3300007076 Bacteria 1118
215 Ga0105250_10266302 3300009092 Bacteria 735
216 Ga0111539_10098370 3300009094 Bacteria 3436
217 Ga0111539_10143600 3300009094 Bacteria 2794
218 Ga0111539_11104155 3300009094 Bacteria 922
219 Ga0105245_10240362 3300009098 Bacteria 1755
220 Ga0114129_10056761 3300009147 Bacteria 5483
221 Ga0114129_10069695 3300009147 Bacteria 4901
222 Ga0114129_10170889 3300009147 Bacteria 2963
223 Ga0114129_10250341 3300009147 Bacteria 2378
224 Ga0105243_10115585 3300009148 Bacteria 2253
225 Ga0105242_10017719 3300009176 Bacteria 5555
226 Ga0105242_10239509 3300009176 Bacteria 1630
227 Ga0105242_10443832 3300009176 Bacteria 1221
228 Ga0105248_10085196 3300009177 Bacteria 3556
229 Ga0105248_10136807 3300009177 Bacteria 2764
230 Ga0105248_10189770 3300009177 Bacteria 2316
231 Ga0105248_10190015 3300009177 Bacteria 2314
232 Ga0105238_10098988 3300009551 Bacteria 2899
233 Ga0105249_10005387 3300009553 Bacteria 11043
234 Ga0105249_10017190 3300009553 Bacteria 6421
235 Ga0105249_11066213 3300009553 Bacteria 878
236 Ga0105239_10009602 3300010375 Bacteria 10884
237 Ga0105239_10303145 3300010375 Bacteria 1799
238 Ga0157373_10190687 3300013100 Bacteria 1444
239 Ga0157371_10029360 3300013102 Bacteria 3977
240 Ga0157370_11607574 3300013104 Bacteria 584
241 Ga0157369_10135062 3300013105 Bacteria 2612
242 Ga0157374_10064953 3300013296 Bacteria 3426
243 Ga0157378_10012923 3300013297 Bacteria 7307
244 Ga0163162_10004238 3300013306 Bacteria 13791
245 Ga0163162_10124510 3300013306 Bacteria 2683
246 Ga0163162_10636456 3300013306 Bacteria 1191
247 Ga0157372_10491317 3300013307 Bacteria 1431
248 Ga0157372_10689934 3300013307 Bacteria 1188
249 Ga0157372_11088345 3300013307 Bacteria 925
250 Ga0157372_11162957 3300013307 Bacteria 892
251 Ga0157375_10039536 3300013308 Bacteria 4541
252 Ga0157375_10163196 3300013308 Bacteria 2371
253 Ga0157375_10209327 3300013308 Bacteria 2107
254 Ga0163163_10423086 3300014325 Bacteria 1391
255 Ga0157380_10013302 3300014326 Bacteria 5995
256 Ga0157380_10063644 3300014326 Bacteria 2958
257 Ga0157380_10139281 3300014326 Bacteria 2082
258 Ga0157380_10468580 3300014326 Bacteria 1215
259 Ga0157377_10001792 3300014745 Bacteria 9368
260 Ga0157379_10009584 3300014968 Bacteria 8434
261 Ga0157379_10015062 3300014968 Bacteria 6783
262 Ga0182007_10043715 3300015262 Bacteria 1488
263 Ga0163161_10033955 3300017792 Bacteria 3648
264 Ga0163161_10094603 3300017792 Bacteria 2215
265 Ga0213876_10178472 3300021384 Bacteria 1130
266 Ga0213876_10671658 3300021384 Bacteria 551
267 Ga0213875_10006111 3300021388 Bacteria 6365
268 Ga0207666_1005715 3300025271 Bacteria 1594
269 Ga0207697_10009089 3300025315 Bacteria 4306
270 Ga0207656_10012620 3300025321 Bacteria 3216
271 Ga0207682_10042184 3300025893 Bacteria 1864
272 Ga0207682_10054212 3300025893 Bacteria 1666
273 Ga0207682_10200030 3300025893 Bacteria 918
274 Ga0207682_10248976 3300025893 Bacteria 827
275 Ga0207642_10046804 3300025899 Bacteria 1929
276 Ga0207642_10076078 3300025899 Bacteria 1614
277 Ga0207688_10007713 3300025901 Bacteria 5862
278 Ga0207680_10058362 3300025903 Bacteria 2339
279 Ga0207647_10046601 3300025904 Bacteria 2701
280 Ga0207645_10002921 3300025907 Bacteria 13207
281 Ga0207645_10099347 3300025907 Bacteria 1877
282 Ga0207643_10004769 3300025908 Bacteria 7265
283 Ga0207643_10087053 3300025908 Bacteria 1816
284 Ga0207705_10271055 3300025909 Bacteria 1298
285 Ga0207705_10725961 3300025909 Bacteria 772
286 Ga0207707_10031996 3300025912 Bacteria 4605
287 Ga0207693_10459282 3300025915 Bacteria 995
288 Ga0207693_10474557 3300025915 Bacteria 977
289 Ga0207663_10139021 3300025916 Bacteria 1689
290 Ga0207660_10034639 3300025917 Bacteria 3501
291 Ga0207662_10001229 3300025918 Bacteria 12277
292 Ga0207662_10021258 3300025918 Bacteria 3708
293 Ga0207662_10135042 3300025918 Bacteria 1559
294 Ga0207657_10048217 3300025919 Bacteria 3720
295 Ga0207657_10080854 3300025919 Bacteria 2731
296 Ga0207649_10004669 3300025920 Bacteria 7410
297 Ga0207649_10061522 3300025920 Bacteria 2364
298 Ga0207649_10232189 3300025920 Bacteria 1320
299 Ga0207649_11402083 3300025920 Bacteria 553
300 Ga0207652_10008869 3300025921 Bacteria 8101
301 Ga0207681_10005678 3300025923 Bacteria 7660
302 Ga0207681_10020526 3300025923 Bacteria 4189
303 Ga0207681_10057868 3300025923 Bacteria 2651
304 Ga0207681_10122662 3300025923 Bacteria 1908
305 Ga0207694_10032791 3300025924 Bacteria 3977
306 Ga0207650_10017089 3300025925 Bacteria 5078
307 Ga0207650_10033672 3300025925 Bacteria 3712
308 Ga0207650_10228827 3300025925 Bacteria 1499
309 Ga0207650_10461412 3300025925 Bacteria 1058
310 Ga0207659_10046106 3300025926 Bacteria 3076
311 Ga0207659_10307241 3300025926 Bacteria 1305
312 Ga0207644_10177010 3300025931 Bacteria 1669
313 Ga0207644_10207924 3300025931 Bacteria 1546
314 Ga0207644_10397548 3300025931 Bacteria 1126
315 Ga0207644_10593935 3300025931 Bacteria 919
316 Ga0207690_10049674 3300025932 Bacteria 2797
317 Ga0207690_10256054 3300025932 Bacteria 1354
318 Ga0207690_10487369 3300025932 Bacteria 996
319 Ga0207706_10000494 3300025933 Bacteria 42203
320 Ga0207706_10031168 3300025933 Bacteria 4752
321 Ga0207706_10059948 3300025933 Bacteria 3351
322 Ga0207706_10092395 3300025933 Bacteria 2661
323 Ga0207686_10118593 3300025934 Bacteria 1797
324 Ga0207686_10259933 3300025934 Bacteria 1272
325 Ga0207686_11374268 3300025934 Bacteria 581
326 Ga0207709_10067455 3300025935 Bacteria 2258
327 Ga0207670_10067517 3300025936 Bacteria 2460
328 Ga0207670_10195492 3300025936 Bacteria 1533
329 Ga0207669_10282198 3300025937 Bacteria 1253
330 Ga0207669_10540783 3300025937 Bacteria 938
331 Ga0207669_10844427 3300025937 Bacteria 762
332 Ga0207704_10074487 3300025938 Bacteria 2166
333 Ga0207691_10004693 3300025940 Bacteria 13226
334 Ga0207691_10006854 3300025940 Bacteria 10994
335 Ga0207691_10009140 3300025940 Bacteria 9512
336 Ga0207691_10018690 3300025940 Bacteria 6566
337 Ga0207691_10079195 3300025940 Bacteria 2957
338 Ga0207711_10070629 3300025941 Bacteria 3028
339 Ga0207711_10222586 3300025941 Bacteria 1726
340 Ga0207711_10672321 3300025941 Bacteria 966
341 Ga0207689_10002099 3300025942 Bacteria 18795
342 Ga0207689_10094473 3300025942 Bacteria 2456
343 Ga0207661_10013763 3300025944 Bacteria 5909
344 Ga0207661_10248760 3300025944 Bacteria 1579
345 Ga0207661_10594850 3300025944 Bacteria 1015
346 Ga0207661_10696669 3300025944 Bacteria 934
347 Ga0207679_10008713 3300025945 Bacteria 6469
348 Ga0207679_10010205 3300025945 Bacteria 6042
349 Ga0207679_10279665 3300025945 Bacteria 1431
350 Ga0207679_10418129 3300025945 Bacteria 1182
351 Ga0207679_10891270 3300025945 Bacteria 813
352 Ga0207667_10110216 3300025949 Bacteria 2840
353 Ga0207667_11337892 3300025949 Bacteria 692
354 Ga0207651_10238989 3300025960 Bacteria 1479
355 Ga0207651_11603541 3300025960 Bacteria 586
356 Ga0207712_10002553 3300025961 Bacteria 11695
357 Ga0207712_10004473 3300025961 Bacteria 8825
358 Ga0207712_10147724 3300025961 Bacteria 1812
359 Ga0207668_10046195 3300025972 Bacteria 2974
360 Ga0207668_10086485 3300025972 Bacteria 2290
361 Ga0207668_10339778 3300025972 Bacteria 1252
362 Ga0207668_10483824 3300025972 Bacteria 1062
363 Ga0207668_11341624 3300025972 Bacteria 644
364 Ga0207640_10265422 3300025981 Bacteria 1340
365 Ga0207640_10274154 3300025981 Bacteria 1321
366 Ga0207658_10141318 3300025986 Bacteria 1948
367 Ga0207658_10206151 3300025986 Bacteria 1645
368 Ga0207677_10045606 3300026023 Bacteria 2928
369 Ga0207677_10187928 3300026023 Bacteria 1631
370 Ga0207677_10975192 3300026023 Bacteria 767
371 Ga0207703_10021846 3300026035 Bacteria 5010
372 Ga0207703_10202559 3300026035 Bacteria 1764
373 Ga0207639_10069507 3300026041 Bacteria 2748
374 Ga0207639_10639296 3300026041 Bacteria 984
375 Ga0207678_10021222 3300026067 Bacteria 5693
376 Ga0207678_10054084 3300026067 Bacteria 3458
377 Ga0207678_10252416 3300026067 Bacteria 1511
378 Ga0207708_10007056 3300026075 Bacteria 8302
379 Ga0207708_10126617 3300026075 Bacteria 1994
380 Ga0207702_10681123 3300026078 Bacteria 1012
381 Ga0207641_10012631 3300026088 Bacteria 6925
382 Ga0207641_10094702 3300026088 Bacteria 2619
383 Ga0207641_10214606 3300026088 Bacteria 1781
384 Ga0207641_10230499 3300026088 Bacteria 1721
385 Ga0207641_10383110 3300026088 Bacteria 1347
386 Ga0207641_11197559 3300026088 Bacteria 759
387 Ga0207648_10004644 3300026089 Bacteria 14061
388 Ga0207648_10006197 3300026089 Bacteria 11911
389 Ga0207648_10047705 3300026089 Bacteria 3753
390 Ga0207648_10462922 3300026089 Bacteria 1156
391 Ga0207648_11086465 3300026089 Bacteria 750
392 Ga0207676_10140459 3300026095 Bacteria 2067
393 Ga0207676_10154956 3300026095 Bacteria 1978
394 Ga0207676_10176661 3300026095 Bacteria 1866
395 Ga0207676_10233917 3300026095 Bacteria 1644
396 Ga0207676_10629342 3300026095 Bacteria 1033
397 Ga0207676_11354086 3300026095 Bacteria 707
398 Ga0207674_10000434 3300026116 Bacteria 54449
399 Ga0207674_10001935 3300026116 Bacteria 26300
400 Ga0207674_10005098 3300026116 Bacteria 15683
401 Ga0207675_100000284 3300026118 Bacteria 48743
402 Ga0207675_100002585 3300026118 Bacteria 17927
403 Ga0207675_100087876 3300026118 Bacteria 2920
404 Ga0207675_100563950 3300026118 Bacteria 1139
405 Ga0207683_10007466 3300026121 Bacteria 9377
406 Ga0207683_10498268 3300026121 Bacteria 1125
407 Ga0207698_10407353 3300026142 Bacteria 1301
408 Ga0207698_10543972 3300026142 Bacteria 1137
409 Ga0207698_11090581 3300026142 Bacteria 811
410 Ga0207428_10108759 3300027907 Bacteria 2135
411 Ga0207428_10256766 3300027907 Bacteria 1302
412 Ga0207428_11174435 3300027907 Bacteria 534
413 Ga0268266_10377300 3300028379 Bacteria 1337
414 Ga0268266_10724726 3300028379 Bacteria 959
415 Ga0268265_10006533 3300028380 Bacteria 7900
416 Ga0268265_10021432 3300028380 Bacteria 4526
417 Ga0268265_10146511 3300028380 Bacteria 1985
418 Ga0268265_10854629 3300028380 Bacteria 890
419 Ga0268264_10065175 3300028381 Bacteria 3068
420 Ga0268264_10150705 3300028381 Bacteria 2084
421 Ga0307408_100005129 3300031548 Bacteria 8791
422 Ga0307410_10349226 3300031852 Bacteria 1181
423 Ga0307410_10412087 3300031852 Bacteria 1094
424 Ga0307406_10004181 3300031901 Bacteria 7857
425 Ga0307412_10475400 3300031911 Bacteria 1035
426 Ga0307412_11717696 3300031911 Bacteria 576
427 Ga0307409_100764522 3300031995 Unclassified 971
428 Ga0307409_101838452 3300031995 Bacteria 635
429 Ga0307416_100441673 3300032002 Bacteria 1351
430 Ga0307414_10571948 3300032004 Bacteria 1010
431 Ga0307411_10168041 3300032005 Bacteria 1651
432 Ga0307415_100389762 3300032126 Bacteria 1186
433 Ga0373959_0154999 3300034820 Bacteria 582
434 Ga0373926_0231641 3300035083 Unclassified 714
435 Ga0373929_0205036 3300035085 Bacteria 554
436 Ga0373940_0040218 3300035088 Bacteria 1282
437 Ga0373940_0059423 3300035088 Bacteria 1090
438 Ga0373949_0118712 3300035090 Bacteria 740
439 Ga0373932_0012226 3300035112 Bacteria 2111
440 Ga0373941_0386324 3300035115 Unclassified 576
441 Ga0373953_0332002 3300035117 Bacteria 665
442 Ga0373956_0153141 3300035119 Bacteria 1085
443 Ga0373960_0018290 3300035121 Bacteria 1826
444 Ga0373960_0039688 3300035121 Bacteria 1355
445 Ga0373943_0061750 3300035170 Bacteria 1874
446 Ga0373931_0015755 3300035691 Bacteria 3710
447 Ga0373931_0027125 3300035691 Bacteria 2921
448 Ga0373927_0184385 3300035695 Bacteria 1369
449 Ga0373937_0037638 3300036401 Bacteria 4409
450 Ga0373925_1131104 3300037068 Unclassified 644
451 Ga0395905_0245811 3300037471 Bacteria 1672
452 Ga0436364_0997863 3300037853 Bacteria 56642
453 Ga0242420_002187 3300038996 Bacteria 2759
454 Ga0242420_013502 3300038996 Bacteria 1393
455 Ga0436365_1252851 3300039437 Bacteria 831
456 Ga0436360_0820004 3300039438 Bacteria 1451
457 Ga0439450_127487 3300042008 Bacteria 658
458 Ga0450894_010903 3300042131 Bacteria 1182
459 Ga0439446_0101589 3300042156 Bacteria 910
460 Ga0439440_0027169 3300042993 Bacteria 1328
461 Ga0466963_0344859 3300044694 Bacteria 1049
462 Ga0466963_1185737 3300044694 Unclassified 537
463 Ga0466964_0374808 3300044706 Bacteria 737
464 Ga0466957_0943586 3300044842 Bacteria 618
465 Ga0466960_0581140 3300044901 Unclassified 663
466 Ga0451576_0042383 3300045051 Bacteria 4805
467 Ga0451576_0105657 3300045051 Bacteria 2930
468 Ga0466967_1044608 3300045976 Bacteria 814
469 Ga0466967_1820620 3300045976 Bacteria 606
470 Ga0495638_0025056 3300046460 Bacteria 3882
471 Ga0495580_0073034 3300046472 Bacteria 2395
472 Ga0495665_0036016 3300046531 Bacteria 2642
473 Ga0495586_0473973 3300046535 Bacteria 722
474 Ga0495621_0007520 3300046539 Bacteria 3229
475 Ga0495615_0015830 3300048090 Bacteria 1617
476 Ga0496100_0565232 3300048903 Bacteria 881
477 Ga0496101_0360644 3300048904 Bacteria 1143
478 Ga0496102_0858703 3300048905 Bacteria 830
479 Ga0496102_1592727 3300048905 Bacteria 571
480 Ga0496102_1677247 3300048905 Bacteria 553
481 Ga0496104_0008395 3300048907 Bacteria 9182
482 Ga0496104_0291547 3300048907 Bacteria 1544
483 Ga0496105_0224050 3300048908 Bacteria 1530
484 Ga0496106_0292714 3300048909 Bacteria 1305
485 Ga0496106_0777690 3300048909 Bacteria 760
486 Ga0496107_0840905 3300048910 Bacteria 671
487 Ga0496107_0962152 3300048910 Bacteria 621
488 Ga0496108_0003121 3300048911 Bacteria 13320
489 Ga0496108_0057902 3300048911 Bacteria 3255
490 Ga0496108_0221662 3300048911 Bacteria 1643
491 Ga0496109_0006679 3300048912 Bacteria 9711
492 Ga0496109_0007588 3300048912 Bacteria 9195
493 Ga0496110_0013765 3300048913 Bacteria 6702
494 Ga0496110_0121633 3300048913 Bacteria 2352
495 Ga0496111_0013654 3300048914 Bacteria 5534
496 Ga0496112_0000138 3300048915 Bacteria 45272
497 Ga0496112_0002896 3300048915 Bacteria 13967
498 Ga0496113_0001970 3300048916 Bacteria 11758
499 Ga0496113_0923654 3300048916 Bacteria 690
500 Ga0496115_0274769 3300048918 Bacteria 1384
501 Ga0501291_023738 3300049514 Bacteria 992
502 Ga0501033_0407687 3300049570 Bacteria 947
503 Ga0501036_0237515 3300049572 Bacteria 1529
504 Ga0501037_0288131 3300049573 Bacteria 1143
505 Ga0501038_0303423 3300049574 Bacteria 1253
506 Ga0501039_0171603 3300049575 Bacteria 1705
507 Ga0501040_0032868 3300049576 Bacteria 3511
508 Ga0501040_0248019 3300049576 Bacteria 1270
509 Ga0501041_0026368 3300049577 Bacteria 3496
510 Ga0501042_0113985 3300049578 Bacteria 1947
511 Ga0501042_0245698 3300049578 Bacteria 1291
512 Ga0501043_0707547 3300049579 Bacteria 735
513 Ga0501046_0110357 3300049580 Bacteria 2102
514 Ga0501048_0031956 3300049582 Bacteria 3805
515 Ga0501067_0105479 3300049583 Bacteria 1566
516 Ga0501068_0115890 3300049584 Bacteria 1669
517 Ga0501068_0135468 3300049584 Bacteria 1542
518 Ga0501070_0112595 3300049586 Bacteria 2249
519 Ga0501070_0208698 3300049586 Bacteria 1604
520 Ga0501071_0371605 3300049587 Bacteria 1089
521 Ga0501072_0025532 3300049588 Bacteria 4602
522 Ga0501074_0181930 3300049590 Bacteria 1499
523 Ga0501074_0292695 3300049590 Bacteria 1157
524 Ga0501075_0038328 3300049591 Bacteria 3582
525 Ga0501075_0062038 3300049591 Bacteria 2818
526 Ga0501076_0067612 3300049592 Bacteria 2853
527 Ga0501077_0031668 3300049593 Bacteria 3365
528 Ga0501227_101091 3300049665 Bacteria 767
529 Ga0501233_084698 3300049668 Bacteria 821
530 Ga0501249_052164 3300049679 Bacteria 940
531 Ga0501258_072838 3300049687 Bacteria 513
532 Ga0501259_006064 3300049688 Bacteria 1918
533 Ga0501079_0043869 3300049741 Bacteria 3452
534 Ga0501080_0058922 3300049742 Bacteria 3574
535 Ga0501080_0736320 3300049742 Bacteria 868
536 Ga0501081_0036164 3300049743 Bacteria 3366
537 Ga0501081_0198349 3300049743 Bacteria 1455
538 Ga0501044_1149932 3300049823 Bacteria 645
539 Ga0501045_0062276 3300049824 Bacteria 2737
540 nmdc:mga05p37_145741_c1 3300050507 Bacteria 2900
541 nmdc:mga05p37_206306_c1 3300050507 Bacteria 2377
542 nmdc:mga05p37_219368_c1 3300050507 Bacteria 2296
543 nmdc:mga05p37_523720_c1 3300050507 Bacteria 1355
544 nmdc:mga09592_1173059_c1 3300050508 Unclassified 636
545 nmdc:mga09592_1251658_c1 3300050508 Bacteria 612
546 nmdc:mga09592_199776_c1 3300050508 Bacteria 1731
547 nmdc:mga09592_424152_c1 3300050508 Bacteria 1149
548 nmdc:mga09592_469193_c1 3300050508 Bacteria 1085
549 nmdc:mga0qj67_32050_c1 3300050509 Bacteria 4097
550 nmdc:mga0qj67_4888_c1 3300050509 Bacteria 9744
551 nmdc:mga0qj67_6071_c1 3300050509 Bacteria 8849
552 nmdc:mga06r32_1464311_c1 3300050510 Bacteria 624
553 nmdc:mga06r32_17889_c1 3300050510 Bacteria 6478
554 nmdc:mga06r32_236445_c1 3300050510 Bacteria 1814
555 nmdc:mga06r32_624494_c1 3300050510 Bacteria 1047
556 nmdc:mga06r32_64592_c1 3300050510 Bacteria 3529
557 nmdc:mga06r32_70789_c1 3300050510 Bacteria 3374
558 nmdc:mga06r32_83733_c1 3300050510 Bacteria 3108
559 nmdc:mga08y16_115616_c1 3300050511 Bacteria 2793
560 nmdc:mga08y16_1378393_c1 3300050511 Bacteria 669
561 nmdc:mga08y16_273285_c1 3300050511 Bacteria 1744
562 nmdc:mga0n895_299097_c1 3300050512 Bacteria 1631
563 nmdc:mga0n895_51941_c1 3300050512 Bacteria 4023
564 nmdc:mga0n895_5543_c1 3300050512 Bacteria 10568
565 nmdc:mga0n895_921994_c1 3300050512 Bacteria 858
566 nmdc:mga0a205_110257_c1 3300050515 Bacteria 2651
567 nmdc:mga0a205_111008_c1 3300050515 Bacteria 2641
568 nmdc:mga0a205_536520_c1 3300050515 Bacteria 1026
569 Ga0500641_0125158 3300053096 Bacteria 1108
570 Ga0500556_0007544 3300053104 Bacteria 3112
571 Ga0501084_0005436 3300054114 Bacteria 10447
572 Ga0590074_058471 3300059423 Bacteria 714
573 Ga0590077_004480 3300059426 Bacteria 2869
574 Ga0501082_0012821 3300060353 Bacteria 7204
575 Ga0501082_0207832 3300060353 Bacteria 1703
576 Ga0530510_0094243 3300061734 Bacteria 2187
577 Ga0075428_100194633
578 Ga0065704_10150401
579 Ga0065715_10108998
580 Ga0065707_10096641
581 Ga0065707_10135445
582 Ga0070658_10191257
583 Ga0070658_10219738
584 Ga0070658_11556399
585 Ga0070676_10000282
586 Ga0070676_10339214
587 Ga0070683_100005660
588 Ga0070683_100037301
589 Ga0070690_100618937
590 Ga0070670_100014281
591 Ga0070670_100019199
592 Ga0070670_100077733
593 Ga0070670_100132163
594 Ga0070677_10175192
595 Ga0070677_10231586
596 Ga0070677_10376561
597 Ga0070677_10866573
598 Ga0068869_100005685
599 Ga0068869_100051996
600 Ga0070666_10101931
601 Ga0070666_10140645
602 Ga0070680_100144983
603 Ga0068868_100074553
604 Ga0068868_100078007
605 Ga0068868_100148421
606 Ga0068868_101786289
607 Ga0070660_100007611
608 Ga0070660_100066568
609 Ga0070660_100114452
610 Ga0070660_100979937
611 Ga0070689_100012729
612 Ga0070689_100015306
613 Ga0070691_10357102
614 Ga0070687_100002933
615 Ga0070687_100025412
616 Ga0070661_100001996
617 Ga0070661_100024252
618 Ga0070692_10002004
619 Ga0070692_10270091
620 Ga0070692_10379216
621 Ga0070668_100000718
622 Ga0070668_100065756
623 Ga0070668_100116152
624 Ga0070668_101037558
625 Ga0070669_100007480
626 Ga0070669_100008210
627 Ga0070669_100027330
628 Ga0070669_100069424
629 Ga0070669_101421691
630 Ga0070675_100024133
631 Ga0070675_100187108
632 Ga0070675_100532548
633 Ga0070675_101106564
634 Ga0070671_100027562
635 Ga0070671_100097425
636 Ga0070671_100204817
637 Ga0070671_100306705
638 Ga0070671_100689148
639 Ga0070674_100088337
640 Ga0070674_100167269
641 Ga0070674_100220477
642 Ga0070674_100378600
643 Ga0070673_100027555
644 Ga0070673_100061878
645 Ga0070673_100888554
646 Ga0070688_100003894
647 Ga0070688_100006593
648 Ga0070659_100011206
649 Ga0070659_100033551
650 Ga0070667_100007233
651 Ga0070667_100201542
652 Ga0070703_10289203
653 Ga0070701_10002208
654 Ga0070701_10070920
655 Ga0070711_100019085
656 Ga0070711_100121470
657 Ga0070705_100177230
658 Ga0070700_100004761
659 Ga0070700_100006391
660 Ga0070700_100146118
661 Ga0070694_100009452
662 Ga0070694_100280704
663 Ga0070694_101301281
664 Ga0070663_100018472
665 Ga0070663_100045955
666 Ga0070678_100012375
667 Ga0070678_100465663
668 Ga0070678_100567775
669 Ga0070662_100001977
670 Ga0070662_100194060
671 Ga0070662_100287046
672 Ga0070681_10000071
673 Ga0070681_11844442
674 Ga0068867_100005816
675 Ga0068867_100007921
676 Ga0068867_100159911
677 Ga0070685_10219325
678 Ga0070699_100266336
679 Ga0070679_100019932
680 Ga0070684_100012941
681 Ga0070684_100189465
682 Ga0070684_100460752
683 Ga0068853_100005938
684 Ga0068853_100846567
685 Ga0070672_100030245
686 Ga0070672_100055956
687 Ga0070672_100069860
688 Ga0070672_100107648
689 Ga0070672_100136598
690 Ga0070686_100002690
691 Ga0070686_100080770
692 Ga0070686_100311769
693 Ga0070695_100399207
694 Ga0070696_102009842
695 Ga0070693_100280851
696 Ga0070665_100027257
697 Ga0070665_100070707
698 Ga0070665_100216690
699 Ga0070665_100312605
700 Ga0070665_101563868
701 Ga0068855_100065242
702 Ga0068855_100797320
703 Ga0068855_100812272
704 Ga0070664_100003897
705 Ga0070664_100035006
706 Ga0070664_100047635
707 Ga0070664_100104218
708 Ga0070664_100233234
709 Ga0070664_100345831
710 Ga0070664_100501453
711 Ga0070664_100842734
712 Ga0068857_100001111
713 Ga0068857_100009848
714 Ga0068857_100024750
715 Ga0068857_100524398
716 Ga0068857_100968182
717 Ga0068854_100481497
718 Ga0068854_100599858
719 Ga0068854_100650782
720 Ga0070702_100204454
721 Ga0068852_100191255
722 Ga0068852_100342246
723 Ga0068852_100854465
724 Ga0068859_100049859
725 Ga0068864_100017121
726 Ga0068864_100101573
727 Ga0068864_100348244
728 Ga0068864_100989621
729 Ga0068866_10049238
730 Ga0068861_100047490
731 Ga0068861_100057482
732 Ga0068861_100381217
733 Ga0068851_10005406
734 Ga0068851_10119404
735 Ga0068870_10006821
736 Ga0068870_10210992
737 Ga0068870_10271261
738 Ga0068863_100018347
739 Ga0068863_100066749
740 Ga0068863_100127170
741 Ga0068863_100180411
742 Ga0068863_100503984
743 Ga0068858_100009257
744 Ga0068860_100006337
745 Ga0068860_100026281
746 Ga0068862_100006757
747 Ga0068862_100024542
748 Ga0068862_100055414
749 Ga0068862_100057509
750 Ga0070715_10348047
751 Ga0070716_100876651
752 Ga0070712_100259846
753 Ga0075366_10022892
754 Ga0097621_100615149
755 Ga0097621_101165591
756 Ga0097621_101395359
757 Ga0068871_100604895
758 Ga0068871_101028888
759 Ga0068871_101195127
760 Ga0075428_100017888
761 Ga0075428_100322162
762 Ga0075428_100758739
763 Ga0075428_102402956
764 Ga0075430_100002681
765 Ga0075430_100008889
766 Ga0075430_100036407
767 Ga0075431_100052907
768 Ga0075431_100068452
769 Ga0075431_100091994
770 Ga0075431_100095789
771 Ga0075431_100157689
772 Ga0075431_100300705
773 Ga0075431_101333838
774 Ga0075433_10098883
775 Ga0075433_10106362
776 Ga0075433_10230463
777 Ga0075434_100033676
778 Ga0075434_100050471
779 Ga0075434_100885087
780 Ga0075434_101157054
781 Ga0075429_100195030
782 Ga0075429_100434974
783 Ga0075429_100481864
784 Ga0075429_100669010
785 Ga0075429_100853253
786 Ga0068865_100003002
787 Ga0068865_100019195
788 Ga0068865_100115695
789 Ga0097620_100049861
790 Ga0075435_100444256
791 Ga0105250_10266302
792 Ga0111539_10098370
793 Ga0111539_10143600
794 Ga0111539_11104155
795 Ga0105245_10240362
796 Ga0114129_10056761
797 Ga0114129_10069695
798 Ga0114129_10170889
799 Ga0114129_10250341
800 Ga0105243_10115585
801 Ga0105242_10017719
802 Ga0105242_10239509
803 Ga0105242_10443832
804 Ga0105248_10085196
805 Ga0105248_10136807
806 Ga0105248_10189770
807 Ga0105248_10190015
808 Ga0105238_10098988
809 Ga0105249_10005387
810 Ga0105249_10017190
811 Ga0105249_11066213
812 Ga0105239_10009602
813 Ga0105239_10303145
814 Ga0157373_10190687
815 Ga0157371_10029360
816 Ga0157370_11607574
817 Ga0157369_10135062
818 Ga0157374_10064953
819 Ga0157378_10012923
820 Ga0163162_10004238
821 Ga0163162_10124510
822 Ga0163162_10636456
823 Ga0157372_10491317
824 Ga0157372_10689934
825 Ga0157372_11088345
826 Ga0157372_11162957
827 Ga0157375_10039536
828 Ga0157375_10163196
829 Ga0157375_10209327
830 Ga0163163_10423086
831 Ga0157380_10013302
832 Ga0157380_10063644
833 Ga0157380_10139281
834 Ga0157380_10468580
835 Ga0157377_10001792
836 Ga0157379_10009584
837 Ga0157379_10015062
838 Ga0182007_10043715
839 Ga0163161_10033955
840 Ga0163161_10094603
841 Ga0213876_10178472
842 Ga0213876_10671658
843 Ga0213875_10006111
844 Ga0207666_1005715
845 Ga0207697_10009089
846 Ga0207656_10012620
847 Ga0207682_10042184
848 Ga0207682_10054212
849 Ga0207682_10200030
850 Ga0207682_10248976
851 Ga0207642_10046804
852 Ga0207642_10076078
853 Ga0207688_10007713
854 Ga0207680_10058362
855 Ga0207647_10046601
856 Ga0207645_10002921
857 Ga0207645_10099347
858 Ga0207643_10004769
859 Ga0207643_10087053
860 Ga0207705_10271055
861 Ga0207705_10725961
862 Ga0207707_10031996
863 Ga0207693_10459282
864 Ga0207693_10474557
865 Ga0207663_10139021
866 Ga0207660_10034639
867 Ga0207662_10001229
868 Ga0207662_10021258
869 Ga0207662_10135042
870 Ga0207657_10048217
871 Ga0207657_10080854
872 Ga0207649_10004669
873 Ga0207649_10061522
874 Ga0207649_10232189
875 Ga0207649_11402083
876 Ga0207652_10008869
877 Ga0207681_10005678
878 Ga0207681_10020526
879 Ga0207681_10057868
880 Ga0207681_10122662
881 Ga0207694_10032791
882 Ga0207650_10017089
883 Ga0207650_10033672
884 Ga0207650_10228827
885 Ga0207650_10461412
886 Ga0207659_10046106
887 Ga0207659_10307241
888 Ga0207644_10177010
889 Ga0207644_10207924
890 Ga0207644_10397548
891 Ga0207644_10593935
892 Ga0207690_10049674
893 Ga0207690_10256054
894 Ga0207690_10487369
895 Ga0207706_10000494
896 Ga0207706_10031168
897 Ga0207706_10059948
898 Ga0207706_10092395
899 Ga0207686_10118593
900 Ga0207686_10259933
901 Ga0207686_11374268
902 Ga0207709_10067455
903 Ga0207670_10067517
904 Ga0207670_10195492
905 Ga0207669_10282198
906 Ga0207669_10540783
907 Ga0207669_10844427
908 Ga0207704_10074487
909 Ga0207691_10004693
910 Ga0207691_10006854
911 Ga0207691_10009140
912 Ga0207691_10018690
913 Ga0207691_10079195
914 Ga0207711_10070629
915 Ga0207711_10222586
916 Ga0207711_10672321
917 Ga0207689_10002099
918 Ga0207689_10094473
919 Ga0207661_10013763
920 Ga0207661_10248760
921 Ga0207661_10594850
922 Ga0207661_10696669
923 Ga0207679_10008713
924 Ga0207679_10010205
925 Ga0207679_10279665
926 Ga0207679_10418129
927 Ga0207679_10891270
928 Ga0207667_10110216
929 Ga0207667_11337892
930 Ga0207651_10238989
931 Ga0207651_11603541
932 Ga0207712_10002553
933 Ga0207712_10004473
934 Ga0207712_10147724
935 Ga0207668_10046195
936 Ga0207668_10086485
937 Ga0207668_10339778
938 Ga0207668_10483824
939 Ga0207668_11341624
940 Ga0207640_10265422
941 Ga0207640_10274154
942 Ga0207658_10141318
943 Ga0207658_10206151
944 Ga0207677_10045606
945 Ga0207677_10187928
946 Ga0207677_10975192
947 Ga0207703_10021846
948 Ga0207703_10202559
949 Ga0207639_10069507
950 Ga0207639_10639296
951 Ga0207678_10021222
952 Ga0207678_10054084
953 Ga0207678_10252416
954 Ga0207708_10007056
955 Ga0207708_10126617
956 Ga0207702_10681123
957 Ga0207641_10012631
958 Ga0207641_10094702
959 Ga0207641_10214606
960 Ga0207641_10230499
961 Ga0207641_10383110
962 Ga0207641_11197559
963 Ga0207648_10004644
964 Ga0207648_10006197
965 Ga0207648_10047705
966 Ga0207648_10462922
967 Ga0207648_11086465
968 Ga0207676_10140459
969 Ga0207676_10154956
970 Ga0207676_10176661
971 Ga0207676_10233917
972 Ga0207676_10629342
973 Ga0207676_11354086
974 Ga0207674_10000434
975 Ga0207674_10001935
976 Ga0207674_10005098
977 Ga0207675_100000284
978 Ga0207675_100002585
979 Ga0207675_100087876
980 Ga0207675_100563950
981 Ga0207683_10007466
982 Ga0207683_10498268
983 Ga0207698_10407353
984 Ga0207698_10543972
985 Ga0207698_11090581
986 Ga0207428_10108759
987 Ga0207428_10256766
988 Ga0207428_11174435
989 Ga0268266_10377300
990 Ga0268266_10724726
991 Ga0268265_10006533
992 Ga0268265_10021432
993 Ga0268265_10146511
994 Ga0268265_10854629
995 Ga0268264_10065175
996 Ga0268264_10150705
997 Ga0307408_100005129
998 Ga0307410_10349226
999 Ga0307410_10412087
1000 Ga0307406_10004181
1001 Ga0307412_10475400
1002 Ga0307412_11717696
1003 Ga0307409_100764522
1004 Ga0307409_101838452
1005 Ga0307416_100441673
1006 Ga0307414_10571948
1007 Ga0307411_10168041
1008 Ga0307415_100389762
1009 Ga0373959_0154999
1010 Ga0373926_0231641
1011 Ga0373929_0205036
1012 Ga0373940_0040218
1013 Ga0373940_0059423
1014 Ga0373949_0118712
1015 Ga0373932_0012226
1016 Ga0373941_0386324
1017 Ga0373953_0332002
1018 Ga0373956_0153141
1019 Ga0373960_0018290
1020 Ga0373960_0039688
1021 Ga0373943_0061750
1022 Ga0373931_0015755
1023 Ga0373931_0027125
1024 Ga0373927_0184385
1025 Ga0373937_0037638
1026 Ga0373925_1131104
1027 Ga0395905_0245811
1028 Ga0436364_0997863
1029 Ga0242420_002187
1030 Ga0242420_013502
1031 Ga0436365_1252851
1032 Ga0436360_0820004
1033 Ga0439450_127487
1034 Ga0450894_010903
1035 Ga0439446_0101589
1036 Ga0439440_0027169
1037 Ga0466963_0344859
1038 Ga0466963_1185737
1039 Ga0466964_0374808
1040 Ga0466957_0943586
1041 Ga0466960_0581140
1042 Ga0451576_0042383
1043 Ga0451576_0105657
1044 Ga0466967_1044608
1045 Ga0466967_1820620
1046 Ga0495638_0025056
1047 Ga0495580_0073034
1048 Ga0495665_0036016
1049 Ga0495586_0473973
1050 Ga0495621_0007520
1051 Ga0495615_0015830
1052 Ga0496100_0565232
1053 Ga0496101_0360644
1054 Ga0496102_0858703
1055 Ga0496102_1592727
1056 Ga0496102_1677247
1057 Ga0496104_0008395
1058 Ga0496104_0291547
1059 Ga0496105_0224050
1060 Ga0496106_0292714
1061 Ga0496106_0777690
1062 Ga0496107_0840905
1063 Ga0496107_0962152
1064 Ga0496108_0003121
1065 Ga0496108_0057902
1066 Ga0496108_0221662
1067 Ga0496109_0006679
1068 Ga0496109_0007588
1069 Ga0496110_0013765
1070 Ga0496110_0121633
1071 Ga0496111_0013654
1072 Ga0496112_0000138
1073 Ga0496112_0002896
1074 Ga0496113_0001970
1075 Ga0496113_0923654
1076 Ga0496115_0274769
1077 Ga0501291_023738
1078 Ga0501033_0407687
1079 Ga0501036_0237515
1080 Ga0501037_0288131
1081 Ga0501038_0303423
1082 Ga0501039_0171603
1083 Ga0501040_0032868
1084 Ga0501040_0248019
1085 Ga0501041_0026368
1086 Ga0501042_0113985
1087 Ga0501042_0245698
1088 Ga0501043_0707547
1089 Ga0501046_0110357
1090 Ga0501048_0031956
1091 Ga0501067_0105479
1092 Ga0501068_0115890
1093 Ga0501068_0135468
1094 Ga0501070_0112595
1095 Ga0501070_0208698
1096 Ga0501071_0371605
1097 Ga0501072_0025532
1098 Ga0501074_0181930
1099 Ga0501074_0292695
1100 Ga0501075_0038328
1101 Ga0501075_0062038
1102 Ga0501076_0067612
1103 Ga0501077_0031668
1104 Ga0501227_101091
1105 Ga0501233_084698
1106 Ga0501249_052164
1107 Ga0501258_072838
1108 Ga0501259_006064
1109 Ga0501079_0043869
1110 Ga0501080_0058922
1111 Ga0501080_0736320
1112 Ga0501081_0036164
1113 Ga0501081_0198349
1114 Ga0501044_1149932
1115 Ga0501045_0062276
1116 nmdc:mga05p37_145741_c1
1117 nmdc:mga05p37_206306_c1
1118 nmdc:mga05p37_219368_c1
1119 nmdc:mga05p37_523720_c1
1120 nmdc:mga09592_1173059_c1
1121 nmdc:mga09592_1251658_c1
1122 nmdc:mga09592_199776_c1
1123 nmdc:mga09592_424152_c1
1124 nmdc:mga09592_469193_c1
1125 nmdc:mga0qj67_32050_c1
1126 nmdc:mga0qj67_4888_c1
1127 nmdc:mga0qj67_6071_c1
1128 nmdc:mga06r32_1464311_c1
1129 nmdc:mga06r32_17889_c1
1130 nmdc:mga06r32_236445_c1
1131 nmdc:mga06r32_624494_c1
1132 nmdc:mga06r32_64592_c1
1133 nmdc:mga06r32_70789_c1
1134 nmdc:mga06r32_83733_c1
1135 nmdc:mga08y16_115616_c1
1136 nmdc:mga08y16_1378393_c1
1137 nmdc:mga08y16_273285_c1
1138 nmdc:mga0n895_299097_c1
1139 nmdc:mga0n895_51941_c1
1140 nmdc:mga0n895_5543_c1
1141 nmdc:mga0n895_921994_c1
1142 nmdc:mga0a205_110257_c1
1143 nmdc:mga0a205_111008_c1
1144 nmdc:mga0a205_536520_c1
1145 Ga0500641_0125158
1146 Ga0500556_0007544
1147 Ga0501084_0005436
1148 Ga0590074_058471
1149 Ga0590077_004480
1150 Ga0501082_0012821
1151 Ga0501082_0207832
1152 Ga0530510_0094243

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02518

HATPase_c

Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase

46

137

0.81

Structural Annotation

Top 5 Hits

ID Description Score Start End
3j9x-assembly1.cif.gz_A a virus that infects a hyperthermophile encapsidates a-form dna 0.8637 13 56
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.816 7 128
6m36-assembly1.cif.gz_E the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8136 5 127
6m36-assembly2.cif.gz_O the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8084 7 128
6m36-assembly1.cif.gz_G the crystal structure of b. subtilis rsbv/rsbw complex in the monoclinic crystal form 0.8066 5 127
ID Description Score Start End Superfamily
af_P37366_98_210_1.10.472.10 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.9475 17 48 1.10.472.10
3j9x101 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1; 0.8873 17 56 1.20.58.800
5n9gF01 Mainly Alpha;Orthogonal Bundle;Cyclin A; domain 1;Cyclin-like 0.8505 17 53 1.10.472.10
af_Q54JB3_152_315_1.10.357.140 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;UbiA prenyltransferase 0.8417 11 56 1.10.357.140
af_I1L4E2_30_205_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.788 13 57 1.20.1070.10
ID Description Score Start End GO Terms
AF-A0A7J5EXS5-F1-model_v4 Anti-sigma regulatory factor 0.9771 2 78
AF-A0A1Q7EIC2-F1-model_v4 Histidine kinase/HSP90-like ATPase domain-containing protein 0.9692 5 84
AF-A0A4Q3PC47-F1-model_v4 deleted 0.9667 2 87
AF-A0A6J4NXT3-F1-model_v4 Anti-sigma B factor RsbT 0.9563 5 97
AF-A0A2V9K0T1-F1-model_v4 ATP-binding protein 0.9563 5 91 GO:0005524

Map