F465482

General Info

Members Datasets Scaffolds Average Seq Length
576 344 1152 257

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100262754|Ga0070713_1002627541
Length 286
Sequence MALEPLERLTLVAPQTFLATKRIRASNMTQSNRDPQHSAQDVALIVGGGPGVSSSCARLFAESGMRVCVAARNPEKAVLETLEKMHGVRRYACDASEPAAVEKLFENVAQDIGTPRLVVHNIDGRVAGIFRKSVVEADPVMALETLRNAAFSAFLVGQQAARLMLGNKLDANGAKGTIIFTNASAALKGFASGGAFAMACHAKSGLAQSMARELMPQGIHIANVPIDAAIGWTQEDGTRAHRRAGTTVDDNMADPDSIAETYLHLHRQHRSTWAFEVVLRPWVERW

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
62 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
89 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
90 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
91 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
92 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
93 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
96 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
97 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
109 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
112 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
113 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
177 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
178 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
179 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
180 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
184 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
185 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
191 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
192 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
193 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
194 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
197 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
200 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
201 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
202 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
203 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
204 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
207 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
208 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
209 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
210 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
221 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
222 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
231 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
232 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
233 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
234 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
235 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
243 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
246 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
250 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
251 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
252 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
253 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
254 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
257 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
258 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
259 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
260 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
261 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
264 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
265 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
266 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
267 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
268 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
269 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
270 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
271 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
272 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
273 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
274 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
275 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
276 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
277 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
278 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
279 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
280 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
281 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
282 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
283 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
284 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
285 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
286 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
287 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
288 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
289 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
290 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
291 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
292 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
293 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
294 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
295 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
296 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
297 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
298 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
299 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
300 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
301 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
302 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
303 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
304 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
305 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
306 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
307 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
308 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
309 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
310 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
311 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
312 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
313 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
314 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
315 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
316 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
317 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
318 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
319 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
320 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
321 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
322 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
323 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
324 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
325 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
326 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
327 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
328 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
329 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
330 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
331 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
332 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
333 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
334 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
335 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
336 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
337 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
338 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
339 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
340 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
341 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
342 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
343 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
344 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.36
Metatranscriptomes 0
Isolates 7.64

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.16
Nodule 5.56
Rhizoplane 5.73
Rhizosphere 73.61
Stem 0
Stem Tuber 0
Unclassified 2.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100262754 3300005436 Bacteria 1578
2 rootH2_10028847 3300003320 Bacteria 2319
3 JGI25404J52841_10003761 3300003659 Bacteria 3025
4 JGI25404J52841_10010731 3300003659 Bacteria 1970
5 JGI25404J52841_10010893 3300003659 Bacteria 1956
6 JGI25404J52841_10019215 3300003659 Bacteria 1480
7 JGI25405J52794_10026005 3300003911 Bacteria 1201
8 Ga0070676_10176704 3300005328 Bacteria 1385
9 Ga0070683_100000135 3300005329 Bacteria 47783
10 Ga0070670_100610930 3300005331 Bacteria 976
11 Ga0070677_10141315 3300005333 Unclassified 1111
12 Ga0068869_100005585 3300005334 Bacteria 7915
13 Ga0070666_10001619 3300005335 Bacteria 13694
14 Ga0070666_10097190 3300005335 Bacteria 2027
15 Ga0068868_100068036 3300005338 Bacteria 2835
16 Ga0068868_100308432 3300005338 Bacteria 1346
17 Ga0068868_100730527 3300005338 Bacteria 888
18 Ga0070689_100039761 3300005340 Bacteria 3602
19 Ga0070689_100248954 3300005340 Unclassified 1466
20 Ga0070691_10022888 3300005341 Bacteria 2900
21 Ga0070687_100024329 3300005343 Bacteria 2890
22 Ga0070668_100023732 3300005347 Bacteria 4642
23 Ga0070668_100032234 3300005347 Bacteria 3987
24 Ga0070668_100137272 3300005347 Bacteria 1968
25 Ga0070668_100279074 3300005347 Bacteria 1395
26 Ga0070669_100001969 3300005353 Bacteria 14839
27 Ga0070671_100022190 3300005355 Bacteria 5186
28 Ga0070671_100041549 3300005355 Bacteria 3822
29 Ga0070671_100235369 3300005355 Bacteria 1554
30 Ga0070674_100005930 3300005356 Bacteria 7103
31 Ga0070688_100028622 3300005365 Bacteria 3328
32 Ga0070667_100006932 3300005367 Bacteria 9414
33 Ga0070667_100198667 3300005367 Unclassified 1779
34 Ga0070667_100239362 3300005367 Bacteria 1620
35 Ga0070709_10015044 3300005434 Bacteria 4393
36 Ga0070709_10067180 3300005434 Bacteria 2302
37 Ga0070714_100038059 3300005435 Bacteria 4045
38 Ga0070714_100067053 3300005435 Bacteria 3093
39 Ga0070714_100480420 3300005435 Bacteria 1183
40 Ga0070713_100000821 3300005436 Bacteria 19927
41 Ga0070713_100075672 3300005436 Bacteria 2856
42 Ga0070713_100080575 3300005436 Bacteria 2776
43 Ga0070713_100178347 3300005436 Bacteria 1908
44 Ga0070710_10018501 3300005437 Bacteria 3585
45 Ga0070701_10023302 3300005438 Bacteria 2980
46 Ga0070711_100018163 3300005439 Bacteria 4486
47 Ga0070711_100020358 3300005439 Bacteria 4275
48 Ga0070711_100054299 3300005439 Bacteria 2764
49 Ga0070694_100642542 3300005444 Bacteria 858
50 Ga0070708_100433489 3300005445 Unclassified 1240
51 Ga0070663_100346422 3300005455 Bacteria 1202
52 Ga0070662_100149701 3300005457 Bacteria 1816
53 Ga0070681_10193844 3300005458 Bacteria 1951
54 Ga0070698_100011442 3300005471 Bacteria 9413
55 Ga0070698_100374003 3300005471 Bacteria 1357
56 Ga0070698_100515856 3300005471 Bacteria 1133
57 Ga0070699_100305596 3300005518 Bacteria 1427
58 Ga0070684_100002657 3300005535 Bacteria 13198
59 Ga0070684_100301153 3300005535 Bacteria 1471
60 Ga0070697_100029453 3300005536 Bacteria 4402
61 Ga0068853_100207778 3300005539 Bacteria 1784
62 Ga0070672_100006393 3300005543 Bacteria 7916
63 Ga0070672_100119603 3300005543 Bacteria 2155
64 Ga0070672_100369624 3300005543 Bacteria 1225
65 Ga0070686_100154715 3300005544 Bacteria 1609
66 Ga0070695_100054727 3300005545 Unclassified 2569
67 Ga0070693_100029241 3300005547 Unclassified 3004
68 Ga0070665_100081918 3300005548 Bacteria 3232
69 Ga0070704_100024496 3300005549 Bacteria 3960
70 Ga0068855_100139497 3300005563 Bacteria 2765
71 Ga0068855_100177640 3300005563 Bacteria 2408
72 Ga0068857_100019401 3300005577 Bacteria 5969
73 Ga0068854_100172432 3300005578 Bacteria 1684
74 Ga0068856_100001161 3300005614 Bacteria 27673
75 Ga0068856_100169877 3300005614 Bacteria 2192
76 Ga0068852_100077336 3300005616 Bacteria 2941
77 Ga0068852_100135186 3300005616 Bacteria 2276
78 Ga0068859_100025251 3300005617 Bacteria 5962
79 Ga0068864_100018509 3300005618 Bacteria 5820
80 Ga0068864_100040105 3300005618 Bacteria 4005
81 Ga0068864_100443047 3300005618 Bacteria 1241
82 Ga0068866_10040355 3300005718 Bacteria 2310
83 Ga0068861_100003756 3300005719 Bacteria 10129
84 Ga0068851_10244880 3300005834 Bacteria 1015
85 Ga0068863_100007705 3300005841 Bacteria 10528
86 Ga0068863_100039775 3300005841 Bacteria 4473
87 Ga0068863_100223705 3300005841 Bacteria 1814
88 Ga0068863_100353593 3300005841 Bacteria 1431
89 Ga0068858_100005972 3300005842 Bacteria 11889
90 Ga0068860_100025127 3300005843 Bacteria 5748
91 Ga0068860_100062345 3300005843 Bacteria 3542
92 Ga0068862_100006155 3300005844 Bacteria 9988
93 Ga0068862_100026609 3300005844 Bacteria 4862
94 Ga0068862_100059224 3300005844 Bacteria 3288
95 Ga0068862_100255295 3300005844 Bacteria 1599
96 Ga0081455_10000538 3300005937 Bacteria 49235
97 Ga0081455_10005277 3300005937 Bacteria 14194
98 Ga0081540_1002094 3300005983 Bacteria 16604
99 Ga0081540_1002182 3300005983 Bacteria 16185
100 Ga0081540_1005575 3300005983 Bacteria 9374
101 Ga0081540_1009348 3300005983 Bacteria 6760
102 Ga0081540_1043291 3300005983 Bacteria 2312
103 Ga0081540_1067037 3300005983 Bacteria 1679
104 Ga0081539_10000148 3300005985 Bacteria 163442
105 Ga0081539_10007671 3300005985 Bacteria 9703
106 Ga0081539_10007731 3300005985 Bacteria 9640
107 Ga0081539_10007869 3300005985 Bacteria 9512
108 Ga0081539_10097096 3300005985 Bacteria 1510
109 Ga0070717_10091776 3300006028 Bacteria 2565
110 Ga0070717_10116357 3300006028 Bacteria 2286
111 Ga0070717_10161457 3300006028 Bacteria 1944
112 Ga0075365_10007700 3300006038 Bacteria 6059
113 Ga0075365_10100501 3300006038 Bacteria 1980
114 Ga0075365_10136045 3300006038 Bacteria 1703
115 Ga0075365_10399518 3300006038 Bacteria 970
116 Ga0075363_100114439 3300006048 Bacteria 1502
117 Ga0075364_10060970 3300006051 Bacteria 2473
118 Ga0070715_10056996 3300006163 Bacteria 1701
119 Ga0070715_10059619 3300006163 Bacteria 1670
120 Ga0070716_100005456 3300006173 Bacteria 6164
121 Ga0070716_100205659 3300006173 Bacteria 1312
122 Ga0070712_100000014 3300006175 Bacteria 108668
123 Ga0070712_100005415 3300006175 Bacteria 7901
124 Ga0070712_100013330 3300006175 Bacteria 5251
125 Ga0070712_100050126 3300006175 Bacteria 2903
126 Ga0070712_100192927 3300006175 Bacteria 1595
127 Ga0075362_10061626 3300006177 Bacteria 1698
128 Ga0075367_10015358 3300006178 Bacteria 4160
129 Ga0075367_10138851 3300006178 Bacteria 1505
130 Ga0075367_10232350 3300006178 Bacteria 1155
131 Ga0075369_10000847 3300006186 Bacteria 10092
132 Ga0075369_10031924 3300006186 Bacteria 2226
133 Ga0075366_10018421 3300006195 Bacteria 4030
134 Ga0075366_10068556 3300006195 Bacteria 2111
135 Ga0097621_100756081 3300006237 Bacteria 898
136 Ga0068871_100212613 3300006358 Bacteria 1673
137 Ga0068871_100643640 3300006358 Bacteria 967
138 Ga0075428_100058687 3300006844 Bacteria 4213
139 Ga0075428_100976644 3300006844 Bacteria 897
140 Ga0075431_100012997 3300006847 Bacteria 8406
141 Ga0075434_100004880 3300006871 Bacteria 12149
142 Ga0075434_100119511 3300006871 Bacteria 2649
143 Ga0075434_100126472 3300006871 Bacteria 2573
144 Ga0075429_100002759 3300006880 Bacteria 14847
145 Ga0068865_100004360 3300006881 Bacteria 8535
146 Ga0068865_100168287 3300006881 Bacteria 1678
147 Ga0075436_100010061 3300006914 Bacteria 6470
148 Ga0097620_100025251 3300006931 Bacteria 5962
149 Ga0097620_100099557 3300006931 Bacteria 2962
150 Ga0097620_101009317 3300006931 Bacteria 914
151 Ga0075435_100115988 3300007076 Bacteria 2230
152 Ga0105240_10033325 3300009093 Bacteria 6657
153 Ga0105240_10208394 3300009093 Bacteria 2286
154 Ga0111539_10154193 3300009094 Bacteria 2688
155 Ga0111539_10890939 3300009094 Unclassified 1035
156 Ga0105245_10031280 3300009098 Bacteria 4709
157 Ga0105245_10531147 3300009098 Bacteria 1196
158 Ga0105247_10264350 3300009101 Bacteria 1181
159 Ga0105247_10279696 3300009101 Bacteria 1151
160 Ga0105247_10297672 3300009101 Bacteria 1118
161 Ga0105247_10379400 3300009101 Bacteria 1002
162 Ga0114129_10000710 3300009147 Bacteria 42045
163 Ga0114129_10104339 3300009147 Bacteria 3917
164 Ga0105243_10003021 3300009148 Bacteria 13876
165 Ga0105243_10228489 3300009148 Bacteria 1649
166 Ga0105241_10106884 3300009174 Bacteria 2234
167 Ga0105241_10386192 3300009174 Bacteria 1225
168 Ga0105242_10064020 3300009176 Bacteria 3030
169 Ga0105248_10053051 3300009177 Bacteria 4549
170 Ga0105248_10098241 3300009177 Bacteria 3298
171 Ga0105248_10303608 3300009177 Bacteria 1797
172 Ga0105248_10333577 3300009177 Bacteria 1708
173 Ga0105248_10793950 3300009177 Bacteria 1068
174 Ga0105248_11126495 3300009177 Bacteria 887
175 Ga0105237_10010413 3300009545 Bacteria 9897
176 Ga0105238_10014385 3300009551 Bacteria 7997
177 Ga0105238_10142186 3300009551 Unclassified 2376
178 Ga0105249_10003867 3300009553 Bacteria 12927
179 Ga0105249_10018069 3300009553 Bacteria 6268
180 Ga0105249_10733562 3300009553 Bacteria 1049
181 Ga0099796_10004473 3300010159 Bacteria 3386
182 Ga0099796_10051393 3300010159 Bacteria 1432
183 Ga0105239_10011452 3300010375 Bacteria 9890
184 Ga0105239_10098619 3300010375 Bacteria 3230
185 Ga0105239_10269711 3300010375 Bacteria 1914
186 Ga0105246_10217938 3300011119 Bacteria 1494
187 Ga0157373_10008823 3300013100 Bacteria 7469
188 Ga0157370_10003818 3300013104 Bacteria 17571
189 Ga0157369_10137168 3300013105 Bacteria 2589
190 Ga0157369_10560708 3300013105 Bacteria 1180
191 Ga0157374_10417650 3300013296 Bacteria 1340
192 Ga0157378_10073998 3300013297 Bacteria 3064
193 Ga0163162_10007643 3300013306 Bacteria 10528
194 Ga0163162_10454228 3300013306 Bacteria 1413
195 Ga0163162_10686135 3300013306 Bacteria 1146
196 Ga0157372_10165944 3300013307 Unclassified 2554
197 Ga0157375_10006691 3300013308 Bacteria 10037
198 Ga0157375_10075864 3300013308 Bacteria 3387
199 Ga0163163_10231196 3300014325 Bacteria 1898
200 Ga0163163_10517507 3300014325 Bacteria 1255
201 Ga0163163_10531138 3300014325 Bacteria 1239
202 Ga0157380_10004384 3300014326 Bacteria 9782
203 Ga0157380_10117925 3300014326 Bacteria 2243
204 Ga0182008_10038608 3300014497 Bacteria 2388
205 Ga0157379_10006857 3300014968 Bacteria 9846
206 Ga0157379_10193421 3300014968 Bacteria 1838
207 Ga0157379_10234394 3300014968 Bacteria 1664
208 Ga0157379_10381840 3300014968 Bacteria 1293
209 Ga0157379_10414955 3300014968 Bacteria 1239
210 Ga0157379_10692186 3300014968 Bacteria 956
211 Ga0163161_10006088 3300017792 Bacteria 8357
212 Ga0163161_10398477 3300017792 Bacteria 1103
213 Ga0214544_1003798 3300021320 Bacteria 30812
214 Ga0213873_10035639 3300021358 Bacteria 1260
215 Ga0213872_10015052 3300021361 Bacteria 3599
216 Ga0213872_10080796 3300021361 Bacteria 1461
217 Ga0213875_10089669 3300021388 Bacteria 1434
218 Ga0213871_10001455 3300021441 Bacteria 3982
219 Ga0209257_1007557 3300025304 Bacteria 6520
220 Ga0207682_10059069 3300025893 Bacteria 1602
221 Ga0207692_10070681 3300025898 Bacteria 1838
222 Ga0207688_10016451 3300025901 Bacteria 4011
223 Ga0207688_10085600 3300025901 Bacteria 1805
224 Ga0207680_10000930 3300025903 Bacteria 13824
225 Ga0207680_10002326 3300025903 Bacteria 8842
226 Ga0207647_10027484 3300025904 Bacteria 3708
227 Ga0207647_10091946 3300025904 Bacteria 1809
228 Ga0207699_10001813 3300025906 Bacteria 10042
229 Ga0207699_10026206 3300025906 Bacteria 3210
230 Ga0207699_10058019 3300025906 Bacteria 2314
231 Ga0207699_10148413 3300025906 Bacteria 1548
232 Ga0207645_10034028 3300025907 Bacteria 3274
233 Ga0207643_10023472 3300025908 Bacteria 3400
234 Ga0207684_10298560 3300025910 Bacteria 1389
235 Ga0207654_10262837 3300025911 Bacteria 1161
236 Ga0207695_10194471 3300025913 Bacteria 1945
237 Ga0207671_10108480 3300025914 Bacteria 2110
238 Ga0207671_10199027 3300025914 Bacteria 1564
239 Ga0207693_10000239 3300025915 Bacteria 50617
240 Ga0207693_10000270 3300025915 Bacteria 47905
241 Ga0207693_10007859 3300025915 Bacteria 8757
242 Ga0207693_10008137 3300025915 Bacteria 8592
243 Ga0207693_10025977 3300025915 Bacteria 4639
244 Ga0207693_10215107 3300025915 Bacteria 1510
245 Ga0207663_10089519 3300025916 Bacteria 2038
246 Ga0207663_10298734 3300025916 Bacteria 1202
247 Ga0207663_10313560 3300025916 Bacteria 1176
248 Ga0207662_10115666 3300025918 Unclassified 1676
249 Ga0207657_10140863 3300025919 Bacteria 1970
250 Ga0207646_10426466 3300025922 Bacteria 1197
251 Ga0207681_10002186 3300025923 Bacteria 12458
252 Ga0207694_10153752 3300025924 Bacteria 1854
253 Ga0207694_10183239 3300025924 Bacteria 1699
254 Ga0207659_10079208 3300025926 Bacteria 2423
255 Ga0207700_10000005 3300025928 Bacteria 394836
256 Ga0207700_10147161 3300025928 Bacteria 1943
257 Ga0207700_10188799 3300025928 Bacteria 1730
258 Ga0207664_10009697 3300025929 Bacteria 6769
259 Ga0207664_10242249 3300025929 Bacteria 1571
260 Ga0207664_10793782 3300025929 Bacteria 852
261 Ga0207644_10063005 3300025931 Bacteria 2691
262 Ga0207644_10331968 3300025931 Bacteria 1231
263 Ga0207706_10006394 3300025933 Bacteria 10945
264 Ga0207706_10098248 3300025933 Bacteria 2575
265 Ga0207706_10241805 3300025933 Bacteria 1578
266 Ga0207686_10633636 3300025934 Bacteria 844
267 Ga0207709_10156830 3300025935 Bacteria 1583
268 Ga0207709_10509628 3300025935 Bacteria 940
269 Ga0207670_10202509 3300025936 Unclassified 1509
270 Ga0207670_10440258 3300025936 Bacteria 1049
271 Ga0207670_10642871 3300025936 Bacteria 874
272 Ga0207669_10004751 3300025937 Bacteria 6015
273 Ga0207669_10487259 3300025937 Bacteria 984
274 Ga0207704_10035820 3300025938 Bacteria 2848
275 Ga0207665_10031129 3300025939 Bacteria 3529
276 Ga0207665_10124687 3300025939 Bacteria 1822
277 Ga0207691_10008032 3300025940 Bacteria 10145
278 Ga0207691_10056565 3300025940 Bacteria 3573
279 Ga0207711_10015547 3300025941 Bacteria 6315
280 Ga0207711_10220669 3300025941 Bacteria 1734
281 Ga0207711_10387551 3300025941 Bacteria 1297
282 Ga0207711_10426650 3300025941 Bacteria 1233
283 Ga0207689_10003059 3300025942 Bacteria 15407
284 Ga0207689_10005979 3300025942 Bacteria 10765
285 Ga0207661_10000041 3300025944 Bacteria 122817
286 Ga0207667_10016217 3300025949 Bacteria 8420
287 Ga0207712_10029510 3300025961 Bacteria 3680
288 Ga0207712_10033260 3300025961 Bacteria 3484
289 Ga0207668_10027756 3300025972 Bacteria 3691
290 Ga0207668_10038521 3300025972 Bacteria 3209
291 Ga0207668_10242463 3300025972 Bacteria 1459
292 Ga0207640_10490701 3300025981 Bacteria 1021
293 Ga0207658_10002049 3300025986 Bacteria 15037
294 Ga0207658_10226731 3300025986 Bacteria 1575
295 Ga0207677_10049551 3300026023 Bacteria 2835
296 Ga0207703_10007887 3300026035 Bacteria 8419
297 Ga0207703_10445275 3300026035 Bacteria 1209
298 Ga0207708_10489479 3300026075 Bacteria 1029
299 Ga0207702_10000159 3300026078 Bacteria 79906
300 Ga0207702_10008460 3300026078 Bacteria 8678
301 Ga0207702_10107059 3300026078 Bacteria 2478
302 Ga0207702_10199591 3300026078 Bacteria 1853
303 Ga0207702_10253476 3300026078 Bacteria 1654
304 Ga0207702_10399362 3300026078 Bacteria 1325
305 Ga0207641_10160977 3300026088 Bacteria 2041
306 Ga0207641_10167331 3300026088 Bacteria 2003
307 Ga0207648_10015032 3300026089 Bacteria 7130
308 Ga0207648_10029335 3300026089 Bacteria 4879
309 Ga0207676_10013186 3300026095 Bacteria 5934
310 Ga0207676_10222822 3300026095 Bacteria 1681
311 Ga0207676_10827893 3300026095 Bacteria 904
312 Ga0207676_10914979 3300026095 Bacteria 861
313 Ga0207674_10001683 3300026116 Bacteria 28386
314 Ga0207674_10124037 3300026116 Bacteria 2549
315 Ga0207674_10166587 3300026116 Bacteria 2158
316 Ga0207675_100071305 3300026118 Bacteria 3248
317 Ga0207675_100389746 3300026118 Bacteria 1371
318 Ga0207675_100684426 3300026118 Bacteria 1034
319 Ga0207683_10256042 3300026121 Bacteria 1598
320 Ga0207698_10054917 3300026142 Bacteria 3067
321 Ga0207698_10693886 3300026142 Unclassified 1012
322 Ga0268266_10001950 3300028379 Bacteria 23192
323 Ga0268266_10056795 3300028379 Bacteria 3367
324 Ga0268265_10054394 3300028380 Bacteria 3037
325 Ga0268265_10109516 3300028380 Bacteria 2251
326 Ga0268265_10129617 3300028380 Bacteria 2094
327 Ga0268265_10147715 3300028380 Bacteria 1978
328 Ga0268265_10281330 3300028380 Bacteria 1489
329 Ga0268264_10000030 3300028381 Bacteria 418542
330 Ga0268264_10005050 3300028381 Bacteria 11171
331 Ga0268264_10075330 3300028381 Bacteria 2869
332 Ga0268264_10094580 3300028381 Bacteria 2584
333 Ga0265338_10302917 3300028800 Bacteria 1161
334 Ga0265330_10112018 3300031235 Bacteria 1165
335 Ga0265325_10003386 3300031241 Bacteria 10440
336 Ga0265329_10016763 3300031242 Bacteria 2533
337 Ga0265340_10034763 3300031247 Bacteria 2506
338 Ga0265339_10048201 3300031249 Bacteria 2336
339 Ga0265316_10032159 3300031344 Bacteria 4284
340 Ga0307509_10003502 3300031507 Bacteria 23683
341 Ga0307509_10297342 3300031507 Bacteria 1365
342 Ga0307408_100360850 3300031548 Bacteria 1236
343 Ga0307408_100644002 3300031548 Bacteria 947
344 Ga0265313_10008258 3300031595 Bacteria 6948
345 Ga0265314_10103579 3300031711 Bacteria 1824
346 Ga0265342_10117798 3300031712 Unclassified 1498
347 Ga0307516_10007313 3300031730 Bacteria 12710
348 Ga0307516_10018028 3300031730 Bacteria 7344
349 Ga0307516_10067887 3300031730 Bacteria 3435
350 Ga0307516_10184018 3300031730 Bacteria 1820
351 Ga0307405_10385640 3300031731 Bacteria 1092
352 Ga0307409_100332849 3300031995 Bacteria 1426
353 Ga0307416_100314845 3300032002 Bacteria 1564
354 Ga0307416_101063443 3300032002 Bacteria 913
355 Ga0307415_100282619 3300032126 Bacteria 1365
356 Ga0307510_10008288 3300033180 Bacteria 12388
357 Ga0373936_0100850 3300035113 Bacteria 1218
358 Ga0373936_0118942 3300035113 Bacteria 1127
359 Ga0373936_0169666 3300035113 Bacteria 954
360 Ga0373954_0101164 3300035118 Bacteria 1391
361 Ga0373956_0186531 3300035119 Bacteria 981
362 Ga0373960_0019388 3300035121 Bacteria 1787
363 Ga0373946_0182894 3300035171 Bacteria 996
364 Ga0373931_0041882 3300035691 Bacteria 2407
365 Ga0373935_0088825 3300035692 Bacteria 2020
366 Ga0373935_0214715 3300035692 Bacteria 1334
367 Ga0373927_0224091 3300035695 Bacteria 1235
368 Ga0373933_0172149 3300035724 Bacteria 1378
369 Ga0373937_0008167 3300036401 Bacteria 9090
370 Ga0373937_0352047 3300036401 Bacteria 1395
371 Ga0373925_0035822 3300037068 Bacteria 3663
372 Ga0373925_0142438 3300037068 Bacteria 1877
373 Ga0373925_0518551 3300037068 Bacteria 979
374 Ga0395905_0427509 3300037471 Bacteria 1221
375 Ga0436364_0000271 3300037853 Bacteria 4303
376 Ga0436364_0008873 3300037853 Bacteria 1017
377 Ga0436364_0122756 3300037853 Bacteria 4271
378 Ga0436365_0002530 3300039437 Bacteria 4099
379 Ga0436365_0421282 3300039437 Bacteria 4931
380 Ga0436365_0447731 3300039437 Bacteria 979
381 Ga0436360_1192580 3300039438 Bacteria 11215
382 Ga0436360_1271205 3300039438 Bacteria 1763
383 Ga0436360_1314342 3300039438 Bacteria 1053
384 Ga0436361_0024840 3300039447 Bacteria 4989
385 Ga0436361_0153430 3300039447 Bacteria 13513
386 Ga0436363_0506551 3300039450 Bacteria 1727
387 Ga0436363_1024931 3300039450 Unclassified 952
388 Ga0436363_1106854 3300039450 Bacteria 1836
389 Ga0436362_0109288 3300039453 Bacteria 1446
390 Ga0436362_0605786 3300039453 Bacteria 4247
391 Ga0436362_0913767 3300039453 Bacteria 978
392 Ga0439466_0086527 3300041411 Bacteria 985
393 Ga0439465_0058318 3300041413 Bacteria 1276
394 Ga0439444_0042263 3300042437 Bacteria 899
395 Ga0466967_0842434 3300045976 Unclassified 911
396 Ga0495592_0137027 3300046454 Bacteria 1706
397 Ga0495603_0002708 3300046455 Bacteria 10442
398 Ga0495629_0240994 3300046459 Bacteria 1245
399 Ga0495641_0049398 3300046461 Bacteria 1926
400 Ga0495651_0020578 3300046462 Bacteria 5123
401 Ga0495653_0319261 3300046463 Bacteria 1007
402 Ga0495580_0011596 3300046472 Bacteria 6818
403 Ga0495639_0169887 3300046475 Bacteria 1058
404 Ga0495585_0028154 3300046492 Bacteria 3206
405 Ga0495607_0143986 3300046501 Bacteria 1227
406 Ga0495620_0059979 3300046515 Bacteria 1588
407 Ga0495628_0082847 3300046516 Bacteria 2491
408 Ga0495628_0144785 3300046516 Bacteria 1812
409 Ga0495630_0151957 3300046517 Bacteria 1762
410 Ga0495631_0012348 3300046518 Bacteria 4175
411 Ga0495631_0142615 3300046518 Bacteria 1029
412 Ga0495643_0198240 3300046522 Bacteria 965
413 Ga0495642_0067586 3300046528 Bacteria 1491
414 Ga0495652_0166045 3300046529 Bacteria 1708
415 Ga0495621_0020164 3300046539 Bacteria 2185
416 Ga0495621_0091802 3300046539 Bacteria 1145
417 Ga0495597_0110504 3300046542 Bacteria 1153
418 Ga0495633_0051091 3300046558 Bacteria 1948
419 Ga0495667_0026103 3300046559 Bacteria 3935
420 Ga0495656_0016407 3300046615 Bacteria 2809
421 Ga0495656_0090384 3300046615 Bacteria 1399
422 Ga0495668_0099012 3300046616 Bacteria 1595
423 Ga0495668_0131112 3300046616 Bacteria 1372
424 Ga0495661_0160354 3300046665 Bacteria 1208
425 Ga0495588_0092990 3300046674 Bacteria 1580
426 Ga0495588_0158515 3300046674 Bacteria 1197
427 Ga0495599_0064353 3300046678 Bacteria 2291
428 Ga0495599_0110598 3300046678 Bacteria 1712
429 Ga0495623_0132212 3300046679 Bacteria 1493
430 Ga0495647_0021484 3300046681 Bacteria 2324
431 Ga0495658_0082095 3300046683 Bacteria 1894
432 Ga0495658_0101550 3300046683 Bacteria 1718
433 Ga0495669_0013138 3300046684 Bacteria 3527
434 Ga0495669_0070898 3300046684 Bacteria 1588
435 Ga0495660_0189299 3300046810 Bacteria 990
436 Ga0495581_0199235 3300047315 Bacteria 1171
437 Ga0495604_0035652 3300047317 Bacteria 3927
438 Ga0495636_0044525 3300047318 Bacteria 1848
439 Ga0495674_0167353 3300047319 Bacteria 1836
440 Ga0495674_0200962 3300047319 Bacteria 1653
441 Ga0495680_0138014 3300047322 Bacteria 1786
442 Ga0495687_142833 3300047443 Bacteria 830
443 Ga0495675_0052660 3300047444 Bacteria 2584
444 Ga0495677_0045669 3300047445 Bacteria 1607
445 Ga0495681_0101923 3300047470 Bacteria 1254
446 Ga0495684_0061852 3300047471 Bacteria 2848
447 Ga0495602_0064941 3300048088 Bacteria 3153
448 Ga0495615_0055598 3300048090 Bacteria 1031
449 Ga0496101_0053725 3300048904 Bacteria 2908
450 Ga0496101_0111683 3300048904 Bacteria 2058
451 Ga0496102_0026295 3300048905 Bacteria 5189
452 Ga0496102_0092495 3300048905 Bacteria 2801
453 Ga0496102_0094336 3300048905 Bacteria 2773
454 Ga0496102_0390189 3300048905 Bacteria 1310
455 Ga0496103_0023521 3300048906 Bacteria 3716
456 Ga0496104_0024662 3300048907 Bacteria 5534
457 Ga0496104_0045074 3300048907 Bacteria 4146
458 Ga0496104_0045243 3300048907 Bacteria 4139
459 Ga0496105_0027522 3300048908 Bacteria 4646
460 Ga0496106_0236332 3300048909 Unclassified 1460
461 Ga0496106_0245776 3300048909 Bacteria 1430
462 Ga0496108_0028176 3300048911 Bacteria 4646
463 Ga0496108_0086443 3300048911 Bacteria 2662
464 Ga0496109_0038647 3300048912 Bacteria 4315
465 Ga0496109_0076036 3300048912 Bacteria 3088
466 Ga0496109_0253677 3300048912 Bacteria 1657
467 Ga0496110_0023261 3300048913 Bacteria 5269
468 Ga0496110_0032606 3300048913 Bacteria 4500
469 Ga0496111_0020409 3300048914 Bacteria 4612
470 Ga0496111_0095013 3300048914 Bacteria 2187
471 Ga0496112_0039395 3300048915 Bacteria 4618
472 Ga0496112_0288982 3300048915 Bacteria 1586
473 Ga0496112_0383661 3300048915 Bacteria 1346
474 Ga0496112_0489221 3300048915 Bacteria 1166
475 Ga0496113_0003707 3300048916 Bacteria 9210
476 Ga0496113_0173086 3300048916 Bacteria 1710
477 Ga0496113_0194739 3300048916 Bacteria 1610
478 Ga0496114_0033204 3300048917 Bacteria 4251
479 Ga0496114_0057257 3300048917 Bacteria 3254
480 Ga0496115_0018652 3300048918 Bacteria 5333
481 Ga0496115_0022405 3300048918 Bacteria 4893
482 Ga0496119_0071331 3300048922 Bacteria 2034
483 Ga0496121_0000191 3300048924 Bacteria 136529
484 Ga0496121_0020114 3300048924 Bacteria 6628
485 Ga0496121_0062023 3300048924 Bacteria 3065
486 Ga0496122_0177268 3300048925 Bacteria 1276
487 Ga0496123_0059548 3300048926 Bacteria 2468
488 Ga0496124_0002311 3300048927 Bacteria 25168
489 Ga0496125_0030695 3300048928 Bacteria 4803
490 Ga0496126_0019687 3300048929 Bacteria 6641
491 nmdc:mga03683_143682_c1 3300050489 Bacteria 1074
492 nmdc:mga03683_22549_c1 3300050489 Bacteria 2442
493 nmdc:mga03n38_91512_c1 3300050490 Bacteria 1449
494 nmdc:mga00v17_153132_c1 3300050491 Bacteria 1482
495 nmdc:mga00v17_63355_c1 3300050491 Bacteria 2277
496 nmdc:mga0yw44_10586_c1 3300050492 Bacteria 4720
497 nmdc:mga0yw44_45771_c2 3300050492 Bacteria 2307
498 nmdc:mga0yw44_9527_c1 3300050492 Bacteria 4919
499 nmdc:mga06z11_148359_c1 3300050494 Bacteria 1331
500 nmdc:mga06z11_22063_c1 3300050494 Bacteria 2967
501 nmdc:mga06z11_24309_c1 3300050494 Bacteria 2856
502 nmdc:mga06z11_94751_c1 3300050494 Bacteria 1627
503 nmdc:mga05p37_2235_c1 3300050507 Bacteria 22561
504 nmdc:mga05p37_843493_c1 3300050507 Bacteria 996
505 nmdc:mga09592_142_c1 3300050508 Bacteria 24140
506 nmdc:mga06r32_7017_c1 3300050510 Bacteria 10130
507 nmdc:mga0rr50_136047_c1 3300050513 Bacteria 1972
508 nmdc:mga0rr50_86985_c1 3300050513 Unclassified 2425
509 nmdc:mga08x19_11699_c1 3300050514 Bacteria 5285
510 nmdc:mga0sz30_1024_c1 3300050516 Bacteria 10039
511 nmdc:mga0sz30_31490_c1 3300050516 Bacteria 2195
512 Ga0495601_0157895 3300053077 Bacteria 1481
513 Ga0495612_0030519 3300053078 Bacteria 2171
514 Ga0500610_0243449 3300053079 Bacteria 835
515 Ga0495619_0031662 3300053085 Bacteria 3428
516 Ga0500647_0112069 3300053091 Bacteria 1296
517 Ga0500583_0013492 3300053092 Bacteria 3163
518 Ga0500651_0065442 3300053093 Bacteria 2265
519 Ga0500650_0118626 3300053098 Bacteria 1234
520 Ga0500650_0150602 3300053098 Bacteria 1076
521 Ga0500557_000013 3300053105 Bacteria 108649
522 Ga0500562_051370 3300053108 Bacteria 1103
523 Ga0500569_016972 3300053109 Bacteria 1853
524 Ga0500595_024961 3300053119 Bacteria 2080
525 Ga0500573_0077033 3300053140 Bacteria 1898
526 Ga0500590_044561 3300053148 Bacteria 2273
527 Ga0500616_0003466 3300053153 Bacteria 12025
528 Ga0500634_0040923 3300053161 Bacteria 2518
529 Ga0500636_0073449 3300053177 Bacteria 1981
530 Ga0500611_062182 3300053727 Bacteria 888
531 Ga0500625_032091 3300053729 Bacteria 2492
532 Ga0500609_019560 3300053731 Bacteria 923
533 2513621576 2513237092 Bacteria 8341956
534 2513698381 2513237101 Bacteria 7952346
535 2513703341 2513237102 Bacteria 7703324
536 2514011624 2513237161 Bacteria 8871253
537 2617375250 2617270741 Bacteria 8201522
538 2643998142 2643221598 Bacteria 4578346
539 2644001304 2643221598 Bacteria 4578346
540 2824627405 2824626560 Bacteria 8813858
541 2824637626 2824635225 Bacteria 8785348
542 2824644569 2824644064 Bacteria 8743947
543 2824680195 2824679649 Bacteria 8248951
544 2824715986 2824714736 Bacteria 8717648
545 2824724289 2824723954 Bacteria 8758240
546 2842040919 2842038055 Bacteria 8002051
547 2842046136 2842045827 Bacteria 8006841
548 2857511296 2857509624 Bacteria 7472071
549 2876815590 2876808645 Bacteria 8824342
550 2879116502 2879110137 Bacteria 8907982
551 2906632007 2906626472 Bacteria 8826946
552 2906645444 2906643746 Bacteria 8722424
553 2935609090 2935608549 Bacteria 8203142
554 2935708194 2935703347 Bacteria 10242284
555 2935785687 2935785616 Bacteria 7962367
556 2935794385 2935793552 Bacteria 8012592
557 2935822250 2935819856 Bacteria 8261050
558 2935847832 2935847175 Bacteria 8228321
559 2935923700 2935916978 Bacteria 9113783
560 2936009430 2936002035 Bacteria 9362176
561 3005719877 3005718088 Bacteria 8283608
562 8006968522 8006964411 Bacteria 8966052
563 8006987202 8006984368 Bacteria 9651211
564 8007001457 8006994254 Bacteria 8309700
565 8016528274 8016522445 Bacteria 8156687
566 8016533419 8016530956 Bacteria 8155261
567 8016546654 8016539877 Bacteria 8155419
568 8016555473 8016548790 Bacteria 8155074
569 8016563831 8016557553 Bacteria 8154380
570 8016575971 8016575299 Bacteria 8154085
571 8016601551 8016595262 Bacteria 8149947
572 8019533212 8019530166 Bacteria 8155624
573 8019568938 8019565922 Bacteria 9639779
574 8019645813 8019638758 Bacteria 9062356
575 8019656910 8019648815 Bacteria 10014479
576 8056680763 8056673599 Bacteria 7871253
577 Ga0070713_100262754
578 rootH2_10028847
579 JGI25404J52841_10003761
580 JGI25404J52841_10010731
581 JGI25404J52841_10010893
582 JGI25404J52841_10019215
583 JGI25405J52794_10026005
584 Ga0070676_10176704
585 Ga0070683_100000135
586 Ga0070670_100610930
587 Ga0070677_10141315
588 Ga0068869_100005585
589 Ga0070666_10001619
590 Ga0070666_10097190
591 Ga0068868_100068036
592 Ga0068868_100308432
593 Ga0068868_100730527
594 Ga0070689_100039761
595 Ga0070689_100248954
596 Ga0070691_10022888
597 Ga0070687_100024329
598 Ga0070668_100023732
599 Ga0070668_100032234
600 Ga0070668_100137272
601 Ga0070668_100279074
602 Ga0070669_100001969
603 Ga0070671_100022190
604 Ga0070671_100041549
605 Ga0070671_100235369
606 Ga0070674_100005930
607 Ga0070688_100028622
608 Ga0070667_100006932
609 Ga0070667_100198667
610 Ga0070667_100239362
611 Ga0070709_10015044
612 Ga0070709_10067180
613 Ga0070714_100038059
614 Ga0070714_100067053
615 Ga0070714_100480420
616 Ga0070713_100000821
617 Ga0070713_100075672
618 Ga0070713_100080575
619 Ga0070713_100178347
620 Ga0070710_10018501
621 Ga0070701_10023302
622 Ga0070711_100018163
623 Ga0070711_100020358
624 Ga0070711_100054299
625 Ga0070694_100642542
626 Ga0070708_100433489
627 Ga0070663_100346422
628 Ga0070662_100149701
629 Ga0070681_10193844
630 Ga0070698_100011442
631 Ga0070698_100374003
632 Ga0070698_100515856
633 Ga0070699_100305596
634 Ga0070684_100002657
635 Ga0070684_100301153
636 Ga0070697_100029453
637 Ga0068853_100207778
638 Ga0070672_100006393
639 Ga0070672_100119603
640 Ga0070672_100369624
641 Ga0070686_100154715
642 Ga0070695_100054727
643 Ga0070693_100029241
644 Ga0070665_100081918
645 Ga0070704_100024496
646 Ga0068855_100139497
647 Ga0068855_100177640
648 Ga0068857_100019401
649 Ga0068854_100172432
650 Ga0068856_100001161
651 Ga0068856_100169877
652 Ga0068852_100077336
653 Ga0068852_100135186
654 Ga0068859_100025251
655 Ga0068864_100018509
656 Ga0068864_100040105
657 Ga0068864_100443047
658 Ga0068866_10040355
659 Ga0068861_100003756
660 Ga0068851_10244880
661 Ga0068863_100007705
662 Ga0068863_100039775
663 Ga0068863_100223705
664 Ga0068863_100353593
665 Ga0068858_100005972
666 Ga0068860_100025127
667 Ga0068860_100062345
668 Ga0068862_100006155
669 Ga0068862_100026609
670 Ga0068862_100059224
671 Ga0068862_100255295
672 Ga0081455_10000538
673 Ga0081455_10005277
674 Ga0081540_1002094
675 Ga0081540_1002182
676 Ga0081540_1005575
677 Ga0081540_1009348
678 Ga0081540_1043291
679 Ga0081540_1067037
680 Ga0081539_10000148
681 Ga0081539_10007671
682 Ga0081539_10007731
683 Ga0081539_10007869
684 Ga0081539_10097096
685 Ga0070717_10091776
686 Ga0070717_10116357
687 Ga0070717_10161457
688 Ga0075365_10007700
689 Ga0075365_10100501
690 Ga0075365_10136045
691 Ga0075365_10399518
692 Ga0075363_100114439
693 Ga0075364_10060970
694 Ga0070715_10056996
695 Ga0070715_10059619
696 Ga0070716_100005456
697 Ga0070716_100205659
698 Ga0070712_100000014
699 Ga0070712_100005415
700 Ga0070712_100013330
701 Ga0070712_100050126
702 Ga0070712_100192927
703 Ga0075362_10061626
704 Ga0075367_10015358
705 Ga0075367_10138851
706 Ga0075367_10232350
707 Ga0075369_10000847
708 Ga0075369_10031924
709 Ga0075366_10018421
710 Ga0075366_10068556
711 Ga0097621_100756081
712 Ga0068871_100212613
713 Ga0068871_100643640
714 Ga0075428_100058687
715 Ga0075428_100976644
716 Ga0075431_100012997
717 Ga0075434_100004880
718 Ga0075434_100119511
719 Ga0075434_100126472
720 Ga0075429_100002759
721 Ga0068865_100004360
722 Ga0068865_100168287
723 Ga0075436_100010061
724 Ga0097620_100025251
725 Ga0097620_100099557
726 Ga0097620_101009317
727 Ga0075435_100115988
728 Ga0105240_10033325
729 Ga0105240_10208394
730 Ga0111539_10154193
731 Ga0111539_10890939
732 Ga0105245_10031280
733 Ga0105245_10531147
734 Ga0105247_10264350
735 Ga0105247_10279696
736 Ga0105247_10297672
737 Ga0105247_10379400
738 Ga0114129_10000710
739 Ga0114129_10104339
740 Ga0105243_10003021
741 Ga0105243_10228489
742 Ga0105241_10106884
743 Ga0105241_10386192
744 Ga0105242_10064020
745 Ga0105248_10053051
746 Ga0105248_10098241
747 Ga0105248_10303608
748 Ga0105248_10333577
749 Ga0105248_10793950
750 Ga0105248_11126495
751 Ga0105237_10010413
752 Ga0105238_10014385
753 Ga0105238_10142186
754 Ga0105249_10003867
755 Ga0105249_10018069
756 Ga0105249_10733562
757 Ga0099796_10004473
758 Ga0099796_10051393
759 Ga0105239_10011452
760 Ga0105239_10098619
761 Ga0105239_10269711
762 Ga0105246_10217938
763 Ga0157373_10008823
764 Ga0157370_10003818
765 Ga0157369_10137168
766 Ga0157369_10560708
767 Ga0157374_10417650
768 Ga0157378_10073998
769 Ga0163162_10007643
770 Ga0163162_10454228
771 Ga0163162_10686135
772 Ga0157372_10165944
773 Ga0157375_10006691
774 Ga0157375_10075864
775 Ga0163163_10231196
776 Ga0163163_10517507
777 Ga0163163_10531138
778 Ga0157380_10004384
779 Ga0157380_10117925
780 Ga0182008_10038608
781 Ga0157379_10006857
782 Ga0157379_10193421
783 Ga0157379_10234394
784 Ga0157379_10381840
785 Ga0157379_10414955
786 Ga0157379_10692186
787 Ga0163161_10006088
788 Ga0163161_10398477
789 Ga0214544_1003798
790 Ga0213873_10035639
791 Ga0213872_10015052
792 Ga0213872_10080796
793 Ga0213875_10089669
794 Ga0213871_10001455
795 Ga0209257_1007557
796 Ga0207682_10059069
797 Ga0207692_10070681
798 Ga0207688_10016451
799 Ga0207688_10085600
800 Ga0207680_10000930
801 Ga0207680_10002326
802 Ga0207647_10027484
803 Ga0207647_10091946
804 Ga0207699_10001813
805 Ga0207699_10026206
806 Ga0207699_10058019
807 Ga0207699_10148413
808 Ga0207645_10034028
809 Ga0207643_10023472
810 Ga0207684_10298560
811 Ga0207654_10262837
812 Ga0207695_10194471
813 Ga0207671_10108480
814 Ga0207671_10199027
815 Ga0207693_10000239
816 Ga0207693_10000270
817 Ga0207693_10007859
818 Ga0207693_10008137
819 Ga0207693_10025977
820 Ga0207693_10215107
821 Ga0207663_10089519
822 Ga0207663_10298734
823 Ga0207663_10313560
824 Ga0207662_10115666
825 Ga0207657_10140863
826 Ga0207646_10426466
827 Ga0207681_10002186
828 Ga0207694_10153752
829 Ga0207694_10183239
830 Ga0207659_10079208
831 Ga0207700_10000005
832 Ga0207700_10147161
833 Ga0207700_10188799
834 Ga0207664_10009697
835 Ga0207664_10242249
836 Ga0207664_10793782
837 Ga0207644_10063005
838 Ga0207644_10331968
839 Ga0207706_10006394
840 Ga0207706_10098248
841 Ga0207706_10241805
842 Ga0207686_10633636
843 Ga0207709_10156830
844 Ga0207709_10509628
845 Ga0207670_10202509
846 Ga0207670_10440258
847 Ga0207670_10642871
848 Ga0207669_10004751
849 Ga0207669_10487259
850 Ga0207704_10035820
851 Ga0207665_10031129
852 Ga0207665_10124687
853 Ga0207691_10008032
854 Ga0207691_10056565
855 Ga0207711_10015547
856 Ga0207711_10220669
857 Ga0207711_10387551
858 Ga0207711_10426650
859 Ga0207689_10003059
860 Ga0207689_10005979
861 Ga0207661_10000041
862 Ga0207667_10016217
863 Ga0207712_10029510
864 Ga0207712_10033260
865 Ga0207668_10027756
866 Ga0207668_10038521
867 Ga0207668_10242463
868 Ga0207640_10490701
869 Ga0207658_10002049
870 Ga0207658_10226731
871 Ga0207677_10049551
872 Ga0207703_10007887
873 Ga0207703_10445275
874 Ga0207708_10489479
875 Ga0207702_10000159
876 Ga0207702_10008460
877 Ga0207702_10107059
878 Ga0207702_10199591
879 Ga0207702_10253476
880 Ga0207702_10399362
881 Ga0207641_10160977
882 Ga0207641_10167331
883 Ga0207648_10015032
884 Ga0207648_10029335
885 Ga0207676_10013186
886 Ga0207676_10222822
887 Ga0207676_10827893
888 Ga0207676_10914979
889 Ga0207674_10001683
890 Ga0207674_10124037
891 Ga0207674_10166587
892 Ga0207675_100071305
893 Ga0207675_100389746
894 Ga0207675_100684426
895 Ga0207683_10256042
896 Ga0207698_10054917
897 Ga0207698_10693886
898 Ga0268266_10001950
899 Ga0268266_10056795
900 Ga0268265_10054394
901 Ga0268265_10109516
902 Ga0268265_10129617
903 Ga0268265_10147715
904 Ga0268265_10281330
905 Ga0268264_10000030
906 Ga0268264_10005050
907 Ga0268264_10075330
908 Ga0268264_10094580
909 Ga0265338_10302917
910 Ga0265330_10112018
911 Ga0265325_10003386
912 Ga0265329_10016763
913 Ga0265340_10034763
914 Ga0265339_10048201
915 Ga0265316_10032159
916 Ga0307509_10003502
917 Ga0307509_10297342
918 Ga0307408_100360850
919 Ga0307408_100644002
920 Ga0265313_10008258
921 Ga0265314_10103579
922 Ga0265342_10117798
923 Ga0307516_10007313
924 Ga0307516_10018028
925 Ga0307516_10067887
926 Ga0307516_10184018
927 Ga0307405_10385640
928 Ga0307409_100332849
929 Ga0307416_100314845
930 Ga0307416_101063443
931 Ga0307415_100282619
932 Ga0307510_10008288
933 Ga0373936_0100850
934 Ga0373936_0118942
935 Ga0373936_0169666
936 Ga0373954_0101164
937 Ga0373956_0186531
938 Ga0373960_0019388
939 Ga0373946_0182894
940 Ga0373931_0041882
941 Ga0373935_0088825
942 Ga0373935_0214715
943 Ga0373927_0224091
944 Ga0373933_0172149
945 Ga0373937_0008167
946 Ga0373937_0352047
947 Ga0373925_0035822
948 Ga0373925_0142438
949 Ga0373925_0518551
950 Ga0395905_0427509
951 Ga0436364_0000271
952 Ga0436364_0008873
953 Ga0436364_0122756
954 Ga0436365_0002530
955 Ga0436365_0421282
956 Ga0436365_0447731
957 Ga0436360_1192580
958 Ga0436360_1271205
959 Ga0436360_1314342
960 Ga0436361_0024840
961 Ga0436361_0153430
962 Ga0436363_0506551
963 Ga0436363_1024931
964 Ga0436363_1106854
965 Ga0436362_0109288
966 Ga0436362_0605786
967 Ga0436362_0913767
968 Ga0439466_0086527
969 Ga0439465_0058318
970 Ga0439444_0042263
971 Ga0466967_0842434
972 Ga0495592_0137027
973 Ga0495603_0002708
974 Ga0495629_0240994
975 Ga0495641_0049398
976 Ga0495651_0020578
977 Ga0495653_0319261
978 Ga0495580_0011596
979 Ga0495639_0169887
980 Ga0495585_0028154
981 Ga0495607_0143986
982 Ga0495620_0059979
983 Ga0495628_0082847
984 Ga0495628_0144785
985 Ga0495630_0151957
986 Ga0495631_0012348
987 Ga0495631_0142615
988 Ga0495643_0198240
989 Ga0495642_0067586
990 Ga0495652_0166045
991 Ga0495621_0020164
992 Ga0495621_0091802
993 Ga0495597_0110504
994 Ga0495633_0051091
995 Ga0495667_0026103
996 Ga0495656_0016407
997 Ga0495656_0090384
998 Ga0495668_0099012
999 Ga0495668_0131112
1000 Ga0495661_0160354
1001 Ga0495588_0092990
1002 Ga0495588_0158515
1003 Ga0495599_0064353
1004 Ga0495599_0110598
1005 Ga0495623_0132212
1006 Ga0495647_0021484
1007 Ga0495658_0082095
1008 Ga0495658_0101550
1009 Ga0495669_0013138
1010 Ga0495669_0070898
1011 Ga0495660_0189299
1012 Ga0495581_0199235
1013 Ga0495604_0035652
1014 Ga0495636_0044525
1015 Ga0495674_0167353
1016 Ga0495674_0200962
1017 Ga0495680_0138014
1018 Ga0495687_142833
1019 Ga0495675_0052660
1020 Ga0495677_0045669
1021 Ga0495681_0101923
1022 Ga0495684_0061852
1023 Ga0495602_0064941
1024 Ga0495615_0055598
1025 Ga0496101_0053725
1026 Ga0496101_0111683
1027 Ga0496102_0026295
1028 Ga0496102_0092495
1029 Ga0496102_0094336
1030 Ga0496102_0390189
1031 Ga0496103_0023521
1032 Ga0496104_0024662
1033 Ga0496104_0045074
1034 Ga0496104_0045243
1035 Ga0496105_0027522
1036 Ga0496106_0236332
1037 Ga0496106_0245776
1038 Ga0496108_0028176
1039 Ga0496108_0086443
1040 Ga0496109_0038647
1041 Ga0496109_0076036
1042 Ga0496109_0253677
1043 Ga0496110_0023261
1044 Ga0496110_0032606
1045 Ga0496111_0020409
1046 Ga0496111_0095013
1047 Ga0496112_0039395
1048 Ga0496112_0288982
1049 Ga0496112_0383661
1050 Ga0496112_0489221
1051 Ga0496113_0003707
1052 Ga0496113_0173086
1053 Ga0496113_0194739
1054 Ga0496114_0033204
1055 Ga0496114_0057257
1056 Ga0496115_0018652
1057 Ga0496115_0022405
1058 Ga0496119_0071331
1059 Ga0496121_0000191
1060 Ga0496121_0020114
1061 Ga0496121_0062023
1062 Ga0496122_0177268
1063 Ga0496123_0059548
1064 Ga0496124_0002311
1065 Ga0496125_0030695
1066 Ga0496126_0019687
1067 nmdc:mga03683_143682_c1
1068 nmdc:mga03683_22549_c1
1069 nmdc:mga03n38_91512_c1
1070 nmdc:mga00v17_153132_c1
1071 nmdc:mga00v17_63355_c1
1072 nmdc:mga0yw44_10586_c1
1073 nmdc:mga0yw44_45771_c2
1074 nmdc:mga0yw44_9527_c1
1075 nmdc:mga06z11_148359_c1
1076 nmdc:mga06z11_22063_c1
1077 nmdc:mga06z11_24309_c1
1078 nmdc:mga06z11_94751_c1
1079 nmdc:mga05p37_2235_c1
1080 nmdc:mga05p37_843493_c1
1081 nmdc:mga09592_142_c1
1082 nmdc:mga06r32_7017_c1
1083 nmdc:mga0rr50_136047_c1
1084 nmdc:mga0rr50_86985_c1
1085 nmdc:mga08x19_11699_c1
1086 nmdc:mga0sz30_1024_c1
1087 nmdc:mga0sz30_31490_c1
1088 Ga0495601_0157895
1089 Ga0495612_0030519
1090 Ga0500610_0243449
1091 Ga0495619_0031662
1092 Ga0500647_0112069
1093 Ga0500583_0013492
1094 Ga0500651_0065442
1095 Ga0500650_0118626
1096 Ga0500650_0150602
1097 Ga0500557_000013
1098 Ga0500562_051370
1099 Ga0500569_016972
1100 Ga0500595_024961
1101 Ga0500573_0077033
1102 Ga0500590_044561
1103 Ga0500616_0003466
1104 Ga0500634_0040923
1105 Ga0500636_0073449
1106 Ga0500611_062182
1107 Ga0500625_032091
1108 Ga0500609_019560
1109 2513621576
1110 2513698381
1111 2513703341
1112 2514011624
1113 2617375250
1114 2643998142
1115 2644001304
1116 2824627405
1117 2824637626
1118 2824644569
1119 2824680195
1120 2824715986
1121 2824724289
1122 2842040919
1123 2842046136
1124 2857511296
1125 2876815590
1126 2879116502
1127 2906632007
1128 2906645444
1129 2935609090
1130 2935708194
1131 2935785687
1132 2935794385
1133 2935822250
1134 2935847832
1135 2935923700
1136 2936009430
1137 3005719877
1138 8006968522
1139 8006987202
1140 8007001457
1141 8016528274
1142 8016533419
1143 8016546654
1144 8016555473
1145 8016563831
1146 8016575971
1147 8016601551
1148 8019533212
1149 8019568938
1150 8019645813
1151 8019656910
1152 8056680763

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

41

230

0.92

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

48

275

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3l6e-assembly1.cif.gz_A crystal structure of putative short chain dehydrogenase/reductase family oxidoreductase from aeromonas hydrophila subsp. hydrophila atcc 7966 0.8441 14 252
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.841 14 251
3lls-assembly1.cif.gz_B crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium tuberculosis 0.8407 14 198
3lls-assembly1.cif.gz_A crystal structure of 3-ketoacyl-(acyl-carrier-protein) reductase from mycobacterium tuberculosis 0.8401 14 198
4kms-assembly1.cif.gz_B-2 crystal structure of acetoacetyl-coa reductase from rickettsia felis 0.8307 13 252
ID Description Score Start End Superfamily
af_Q0D7W4_71_358_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8894 13 47 3.50.50.60
5nahA01 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.8772 14 48 3.50.50.60
af_A0A0P0WC51_15_133_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8574 12 91 3.40.50.720
af_I1KVW6_141_273_3.40.50.20 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8462 12 137 3.40.50.20
2ehdA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.8445 14 254 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4V2V8L2-F1-model_v4 Short-subunit dehydrogenase 0.8803 13 259 GO:0016020
AF-A0A2G5PFP4-F1-model_v4 NAD(P)-dependent oxidoreductase 0.8633 14 198 GO:0016020
GO:0016491
AF-A0A7Y8VGN1-F1-model_v4 deleted 0.8495 13 198
AF-A0A1B8P1J7-F1-model_v4 2-(R)-hydroxypropyl-CoM dehydrogenase (EC 1.1.1.268) 0.8482 13 199 GO:0050574
AF-A0A7J7F624-F1-model_v4 3-ketoacyl-[acyl-carrier-protein] reductase beta subunit (Quinone reductase CBR4) 0.8428 13 198 GO:0006633
GO:0016616
GO:0048038

Map