F465466

General Info

Members Datasets Scaffolds Average Seq Length
576 328 539 133

Family's Representative Sequence

Representative Sequence 3300002704|JGI25155J39150_1000008|JGI25155J39150_1000008204
Length 137
Sequence MTIELQRDLGATMAQQVRVRSHVFTADVSEAEGGADSGPSPHDLYDAALGACKALTVMWYARKKGIPVEDVQTRIERDDSQERSGSGVYKLSARLQVKGDLTDAQLRELLAVAQKCPVHKLMTAVTTEISTELERLP

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
3 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
4 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
5 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
6 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
7 2643221570 Acidovorax sp. Root568 Isolate Unclassified
8 2643221596 Acidovorax sp. Root70 Isolate Unclassified
9 2643221652 Acidovorax sp. Root402 Isolate Unclassified
10 2643221658 Variovorax sp. Root411 Isolate Unclassified
11 2643221672 Variovorax sp. Root434 Isolate Unclassified
12 2643221683 Variovorax sp. Root473 Isolate Unclassified
13 2738541277 Variovorax sp. GV051 Isolate Unclassified
14 2738541307 Variovorax sp. GV008 Isolate Unclassified
15 2738543013 Variovorax sp. BT01 Isolate Unclassified
16 2738543019 Variovorax sp. GV040 Isolate Unclassified
17 2818991446 Variovorax sp. 1180 Isolate Unclassified
18 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
19 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
20 2842718218 Acidovorax sp. R-73343 Isolate Unclassified
21 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
22 2885198086 Variovorax sp. 679 Isolate Unclassified
23 2885211737 Variovorax sp. 553 Isolate Unclassified
24 2899924645 Variovorax sp. 369 Isolate Unclassified
25 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
26 2928037797 Variovorax sp. 1126 Isolate Unclassified
27 2928044640 Variovorax sp. 1128 Isolate Unclassified
28 2928051484 Variovorax sp. 1133 Isolate Unclassified
29 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
30 2928070936 Variovorax gossypii 1167 Isolate Unclassified
31 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
32 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
33 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
34 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
35 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
36 2974320154 Acidovorax wautersii SORGH_AS 335 Isolate Unclassified
37 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
38 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
39 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
40 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
41 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
42 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
43 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
44 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
45 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
46 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
47 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
48 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
49 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
50 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
51 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
52 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
53 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
54 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
55 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
56 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
57 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
58 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
59 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
60 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
61 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
62 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
63 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
64 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
65 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
66 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
67 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
68 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
69 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
70 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
71 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
72 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
73 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
74 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
75 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
76 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
77 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
78 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
82 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
83 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
84 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
85 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
97 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
105 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
106 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
110 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
118 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
121 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
122 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
126 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
127 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
128 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
131 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
133 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
137 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
139 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
164 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
170 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
173 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
178 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
181 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
191 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
192 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
193 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
194 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
195 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
196 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
197 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
198 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
199 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
200 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
201 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
202 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
203 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
204 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
205 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
206 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
207 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
208 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
209 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
210 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
211 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
212 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
213 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
214 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
215 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
216 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
217 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
218 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
219 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
220 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
221 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
224 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
225 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
226 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
227 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
228 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
229 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
230 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
231 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
234 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
235 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
239 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
240 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
243 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
244 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
245 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
246 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
247 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
248 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
249 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
250 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
251 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
252 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
253 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
254 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
257 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
258 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
259 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
263 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
264 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
265 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
266 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
267 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
268 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
269 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
274 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
275 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
277 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
278 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
279 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
280 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
281 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
282 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
283 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
284 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
285 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
286 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
287 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
288 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
289 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
290 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
291 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
292 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
293 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
294 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
295 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
296 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
297 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
298 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
299 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
300 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
301 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
302 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
303 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
304 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
305 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
306 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
307 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
308 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
309 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
313 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
314 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
315 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
316 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
317 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
318 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
321 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
322 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
323 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
324 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
325 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
326 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
327 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
328 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.23
Metatranscriptomes 0.35
Isolates 6.42

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 46.01
Nodule 1.04
Rhizoplane 3.12
Rhizosphere 36.11
Stem 0
Stem Tuber 0
Unclassified 13.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10031582 3300001979 Bacteria 1705
2 JGI24739J22299_10088829 3300001989 Bacteria 943
3 JGI25155J39150_1000008 3300002704 Bacteria 236146
4 JGI25156J39149_1000002 3300002705 Bacteria 343501
5 JGI25154J39366_1000010 3300002738 Bacteria 297985
6 JGI25157J39369_1000001 3300002741 Bacteria 363277
7 JGI25152J39213_1009563 3300002773 Bacteria 2293
8 JGI25152J39213_1013215 3300002773 Bacteria 1730
9 JGI25152J39213_1019082 3300002773 Bacteria 1254
10 JGI25150J39212_1000410 3300002774 Bacteria 19909
11 JGI25150J39212_1007763 3300002774 Bacteria 2138
12 JGI25150J39212_1010689 3300002774 Bacteria 1695
13 JGI25150J39212_1032432 3300002774 Bacteria 714
14 JGI25159J45721_1001868 3300002987 Bacteria 8416
15 JGI25159J45721_1002408 3300002987 Bacteria 7114
16 JGI25159J45721_1002497 3300002987 Bacteria 6932
17 JGI25159J45721_1002663 3300002987 Bacteria 6651
18 JGI25159J45721_1011308 3300002987 Bacteria 2197
19 JGI25151J46595_10002993 3300003187 Bacteria 9629
20 JGI25151J46595_10003749 3300003187 Bacteria 8250
21 JGI25151J46595_10004501 3300003187 Bacteria 7364
22 JGI25151J46595_10004776 3300003187 Bacteria 7107
23 JGI25151J46595_10025336 3300003187 Bacteria 2415
24 JGI25151J46595_10027608 3300003187 Bacteria 2272
25 JGI25151J46595_10053813 3300003187 Bacteria 1341
26 JGI25151J46595_10054607 3300003187 Bacteria 1323
27 JGI25153J46596_10001657 3300003215 Bacteria 13197
28 JGI25153J46596_10044214 3300003215 Bacteria 1341
29 JGI25153J46596_10044937 3300003215 Bacteria 1323
30 rootL2_10031911 3300003322 Bacteria 14254
31 JGI25160J50197_1000342 3300003354 Bacteria 31433
32 JGI25160J50197_1003559 3300003354 Bacteria 6932
33 JGI25160J50197_1026858 3300003354 Bacteria 1579
34 JGI25161J50226_1000259 3300003374 Bacteria 31433
35 JGI25161J50226_1002084 3300003374 Bacteria 5404
36 JGI25161J50226_1003187 3300003374 Bacteria 3868
37 JGI25161J50226_1018869 3300003374 Bacteria 710
38 Ga0006562J51391_1110162 3300003578 Bacteria 3760
39 Ga0006562J51391_1110163 3300003578 Bacteria 2090
40 Ga0055535_1000075 3300003761 Bacteria 111667
41 Ga0055542_1000059 3300003762 Bacteria 162670
42 Ga0055526_1001483 3300003771 Bacteria 16653
43 Ga0055526_1003973 3300003771 Bacteria 9110
44 Ga0055526_1014877 3300003771 Bacteria 3166
45 Ga0055526_1021191 3300003771 Bacteria 2272
46 Ga0055537_1000102 3300003773 Bacteria 63809
47 Ga0055537_1004785 3300003773 Bacteria 3788
48 Ga0055537_1008247 3300003773 Bacteria 2422
49 Ga0055537_1013973 3300003773 Bacteria 1479
50 Ga0055524_1000093 3300003775 Bacteria 111953
51 Ga0055524_1000129 3300003775 Bacteria 88836
52 Ga0055524_1003348 3300003775 Bacteria 7810
53 Ga0055524_1004022 3300003775 Bacteria 6932
54 Ga0055536_1006611 3300003781 Bacteria 5351
55 Ga0055536_1011381 3300003781 Bacteria 3417
56 Ga0055536_1029269 3300003781 Bacteria 1483
57 Ga0055536_1042611 3300003781 Bacteria 1060
58 Ga0055534_1001554 3300003784 Bacteria 8955
59 Ga0055534_1002793 3300003784 Bacteria 5830
60 Ga0055528_1000696 3300003790 Bacteria 23933
61 Ga0055528_1003913 3300003790 Bacteria 7316
62 Ga0055528_1016988 3300003790 Bacteria 2543
63 Ga0055528_1029570 3300003790 Bacteria 1479
64 Ga0055530_10000891 3300003791 Bacteria 24561
65 Ga0055530_10001159 3300003791 Bacteria 20427
66 Ga0055530_10007476 3300003791 Bacteria 4588
67 Ga0055530_10029647 3300003791 Bacteria 1460
68 Ga0055540_1000089 3300003792 Bacteria 100214
69 Ga0055540_1000196 3300003792 Bacteria 58476
70 Ga0055540_1003775 3300003792 Bacteria 7142
71 Ga0055540_1005801 3300003792 Bacteria 5074
72 Ga0055540_1012701 3300003792 Bacteria 2624
73 Ga0055531_10004653 3300003794 Bacteria 8237
74 Ga0055531_10009205 3300003794 Bacteria 5082
75 Ga0055531_10015220 3300003794 Bacteria 3408
76 Ga0055531_10023923 3300003794 Bacteria 2272
77 Ga0055543_1000527 3300004625 Bacteria 21646
78 Ga0055543_1004773 3300004625 Bacteria 3609
79 Ga0065165_1000005 3300005262 Bacteria 370361
80 Ga0065165_1005593 3300005262 Bacteria 6970
81 Ga0065165_1005633 3300005262 Bacteria 6928
82 Ga0065165_1006014 3300005262 Bacteria 6540
83 Ga0065165_1019383 3300005262 Bacteria 2431
84 Ga0065165_1022411 3300005262 Bacteria 2166
85 Ga0065165_1056201 3300005262 Bacteria 1095
86 Ga0065714_10377291 3300005288 Bacteria 602
87 Ga0065704_10095727 3300005289 Bacteria 2475
88 Ga0070660_100575043 3300005339 Bacteria 941
89 Ga0070661_100339910 3300005344 Bacteria 1176
90 Ga0070675_101567110 3300005354 Bacteria 608
91 Ga0070673_100382432 3300005364 Bacteria 1255
92 Ga0070659_100655742 3300005366 Bacteria 905
93 Ga0070667_100868924 3300005367 Bacteria 839
94 Ga0070705_100291736 3300005440 Bacteria 1165
95 Ga0070663_100700525 3300005455 Bacteria 861
96 Ga0070662_100005660 3300005457 Bacteria 7995
97 Ga0070707_100154257 3300005468 Bacteria 2237
98 Ga0068853_100391418 3300005539 Bacteria 1299
99 Ga0068853_100513032 3300005539 Bacteria 1133
100 Ga0070665_100099410 3300005548 Bacteria 2913
101 Ga0070665_100625285 3300005548 Bacteria 1090
102 Ga0070704_102030949 3300005549 Bacteria 534
103 Ga0070664_100012673 3300005564 Bacteria 6866
104 Ga0068857_100226282 3300005577 Bacteria 1710
105 Ga0068854_100322160 3300005578 Bacteria 1257
106 Ga0068854_100589395 3300005578 Bacteria 948
107 Ga0068856_100162965 3300005614 Bacteria 2241
108 Ga0068851_10008039 3300005834 Bacteria 4866
109 Ga0068851_10606006 3300005834 Bacteria 667
110 Ga0068862_100096418 3300005844 Bacteria 2582
111 Ga0075365_10506092 3300006038 Bacteria 854
112 Ga0075365_10715964 3300006038 Bacteria 707
113 Ga0075363_100239544 3300006048 Bacteria 1043
114 Ga0075363_100323768 3300006048 Bacteria 897
115 Ga0075364_10048728 3300006051 Bacteria 2761
116 Ga0075364_10352951 3300006051 Bacteria 1002
117 Ga0075432_10004613 3300006058 Bacteria 4691
118 Ga0075362_10006927 3300006177 Bacteria 4252
119 Ga0075362_10593418 3300006177 Bacteria 572
120 Ga0075367_10396324 3300006178 Bacteria 873
121 Ga0075367_10450273 3300006178 Bacteria 816
122 Ga0075366_10114463 3300006195 Bacteria 1624
123 Ga0075366_10132312 3300006195 Bacteria 1505
124 Ga0075366_10171671 3300006195 Bacteria 1316
125 Ga0075366_10236317 3300006195 Bacteria 1114
126 Ga0075366_10522216 3300006195 Bacteria 735
127 Ga0075370_10003008 3300006353 Bacteria 7941
128 Ga0075370_10066314 3300006353 Bacteria 2059
129 Ga0075370_10118462 3300006353 Bacteria 1540
130 Ga0075370_10149566 3300006353 Bacteria 1368
131 Ga0075370_10309881 3300006353 Bacteria 939
132 Ga0075370_10951849 3300006353 Bacteria 526
133 Ga0068871_100142918 3300006358 Bacteria 2036
134 Ga0068871_100297316 3300006358 Bacteria 1416
135 Ga0079104_1075347 3300006946 Bacteria 701
136 Ga0099826_10000001 3300006948 Bacteria 1155201
137 Ga0099826_10499711 3300006948 Bacteria 569
138 Ga0099795_10000040 3300007788 Bacteria 32398
139 Ga0099795_10005769 3300007788 Bacteria 3322
140 Ga0105244_10000885 3300009036 Bacteria 25392
141 Ga0105244_10072907 3300009036 Bacteria 1710
142 Ga0105240_10010486 3300009093 Bacteria 13026
143 Ga0105245_11460290 3300009098 Bacteria 734
144 Ga0105243_10006560 3300009148 Bacteria 8989
145 Ga0105243_10008567 3300009148 Bacteria 7847
146 Ga0105241_10520780 3300009174 Bacteria 1063
147 Ga0105237_10000646 3300009545 Bacteria 48623
148 Ga0105237_10015716 3300009545 Bacteria 7868
149 Ga0105238_10062803 3300009551 Bacteria 3715
150 Ga0105238_10154496 3300009551 Bacteria 2270
151 Ga0099796_10008895 3300010159 Bacteria 2694
152 Ga0099796_10010608 3300010159 Bacteria 2539
153 Ga0105239_10001160 3300010375 Bacteria 36170
154 Ga0105239_10072120 3300010375 Bacteria 3795
155 Ga0105239_10295522 3300010375 Bacteria 1824
156 Ga0105246_10066092 3300011119 Bacteria 2531
157 Ga0105246_10118002 3300011119 Bacteria 1961
158 Ga0105246_10940154 3300011119 Bacteria 778
159 Ga0157322_1002602 3300012490 Bacteria 1032
160 Ga0157347_1000283 3300012502 Bacteria 3057
161 Ga0157373_10132842 3300013100 Bacteria 1750
162 Ga0157370_10028541 3300013104 Bacteria 5487
163 Ga0157370_11109372 3300013104 Bacteria 715
164 Ga0157369_10008062 3300013105 Bacteria 12078
165 Ga0157372_10160319 3300013307 Bacteria 2600
166 Ga0157375_11018052 3300013308 Bacteria 967
167 Ga0182008_10002504 3300014497 Bacteria 11463
168 Ga0182008_10003002 3300014497 Bacteria 10384
169 Ga0182006_1001611 3300015261 Bacteria 13346
170 Ga0182006_1197370 3300015261 Bacteria 667
171 Ga0182007_10000330 3300015262 Bacteria 29991
172 Ga0182007_10001131 3300015262 Bacteria 14464
173 Ga0163161_10000118 3300017792 Bacteria 75123
174 Ga0163161_10096802 3300017792 Bacteria 2191
175 Ga0209435_100001 3300025206 Bacteria 1424171
176 Ga0209436_104299 3300025208 Bacteria 3545
177 Ga0209436_106984 3300025208 Bacteria 2411
178 Ga0209672_100197 3300025228 Bacteria 48105
179 Ga0209147_100669 3300025229 Bacteria 17753
180 Ga0209258_100078 3300025242 Bacteria 263996
181 Ga0207425_1000191 3300025245 Bacteria 49767
182 Ga0207425_1003124 3300025245 Bacteria 5454
183 Ga0207425_1003360 3300025245 Bacteria 5157
184 Ga0207425_1013550 3300025245 Bacteria 1880
185 Ga0209646_1000001 3300025246 Bacteria 3092932
186 Ga0209026_1000001 3300025250 Bacteria 1228671
187 Ga0209148_1000086 3300025254 Bacteria 263996
188 Ga0209759_1000001 3300025256 Bacteria 2799452
189 Ga0209129_1000116 3300025258 Bacteria 140716
190 Ga0209129_1003435 3300025258 Bacteria 6887
191 Ga0209129_1009606 3300025258 Bacteria 2522
192 Ga0209129_1015482 3300025258 Bacteria 1568
193 Ga0209129_1017030 3300025258 Bacteria 1439
194 Ga0209565_1000133 3300025263 Bacteria 104054
195 Ga0209565_1000161 3300025263 Bacteria 90019
196 Ga0209565_1000884 3300025263 Bacteria 16415
197 Ga0209565_1002899 3300025263 Bacteria 5861
198 Ga0209565_1003640 3300025263 Bacteria 4918
199 Ga0209673_1000190 3300025273 Bacteria 123411
200 Ga0209673_1000315 3300025273 Bacteria 89120
201 Ga0209673_1000391 3300025273 Bacteria 78867
202 Ga0209130_1000084 3300025284 Bacteria 160070
203 Ga0209130_1000118 3300025284 Bacteria 129005
204 Ga0209130_1000159 3300025284 Bacteria 101007
205 Ga0209130_1000359 3300025284 Bacteria 52040
206 Ga0209130_1000727 3300025284 Bacteria 29060
207 Ga0209130_1034814 3300025284 Bacteria 1011
208 Ga0209675_1000111 3300025291 Bacteria 114805
209 Ga0209675_1000282 3300025291 Bacteria 48505
210 Ga0209675_1000495 3300025291 Bacteria 29537
211 Ga0209675_1012562 3300025291 Bacteria 2716
212 Ga0209675_1045864 3300025291 Bacteria 927
213 Ga0209675_1047001 3300025291 Bacteria 909
214 Ga0209676_1000054 3300025292 Bacteria 365890
215 Ga0209676_1000125 3300025292 Bacteria 191565
216 Ga0209676_1000732 3300025292 Bacteria 44939
217 Ga0209676_1001799 3300025292 Bacteria 17979
218 Ga0209676_1003774 3300025292 Bacteria 8977
219 Ga0209676_1004341 3300025292 Bacteria 7949
220 Ga0209676_1063707 3300025292 Bacteria 905
221 Ga0209025_1000256 3300025294 Bacteria 125758
222 Ga0209025_1000293 3300025294 Bacteria 111845
223 Ga0209025_1001146 3300025294 Bacteria 37744
224 Ga0209025_1001351 3300025294 Bacteria 32990
225 Ga0209025_1004481 3300025294 Bacteria 12099
226 Ga0209025_1006065 3300025294 Bacteria 9557
227 Ga0209025_1027379 3300025294 Bacteria 2828
228 Ga0209025_1057366 3300025294 Bacteria 1488
229 Ga0209025_1099365 3300025294 Bacteria 926
230 Ga0209564_1000201 3300025295 Bacteria 136907
231 Ga0209564_1000535 3300025295 Bacteria 61415
232 Ga0209564_1000610 3300025295 Bacteria 55376
233 Ga0209564_1000815 3300025295 Bacteria 42475
234 Ga0209564_1006251 3300025295 Bacteria 6494
235 Ga0209564_1011219 3300025295 Bacteria 4037
236 Ga0209758_1000034 3300025297 Bacteria 467637
237 Ga0209758_1006167 3300025297 Bacteria 8777
238 Ga0209758_1023068 3300025297 Bacteria 2828
239 Ga0209758_1023250 3300025297 Bacteria 2810
240 Ga0209758_1042401 3300025297 Bacteria 1688
241 Ga0209050_1000012 3300025298 Bacteria 813717
242 Ga0209050_1000066 3300025298 Bacteria 305458
243 Ga0209050_1001609 3300025298 Bacteria 23243
244 Ga0209050_1005132 3300025298 Bacteria 8406
245 Ga0209050_1008858 3300025298 Bacteria 5274
246 Ga0209050_1014785 3300025298 Bacteria 3333
247 Ga0209050_1072964 3300025298 Bacteria 759
248 Ga0209256_1000003 3300025299 Bacteria 1661127
249 Ga0209256_1000066 3300025299 Bacteria 247534
250 Ga0209256_1000270 3300025299 Bacteria 90996
251 Ga0209256_1000285 3300025299 Bacteria 88890
252 Ga0209256_1015319 3300025299 Bacteria 2690
253 Ga0209256_1032735 3300025299 Bacteria 1407
254 Ga0209256_1058864 3300025299 Bacteria 902
255 Ga0209256_1064281 3300025299 Bacteria 844
256 Ga0207426_1000197 3300025302 Bacteria 146366
257 Ga0207426_1000244 3300025302 Bacteria 120371
258 Ga0207426_1000369 3300025302 Bacteria 79694
259 Ga0207426_1001157 3300025302 Bacteria 23696
260 Ga0207426_1025104 3300025302 Bacteria 2011
261 Ga0209051_1000044 3300025303 Bacteria 305458
262 Ga0209051_1000134 3300025303 Bacteria 138380
263 Ga0209051_1000322 3300025303 Bacteria 72185
264 Ga0209051_1000344 3300025303 Bacteria 69935
265 Ga0209051_1054724 3300025303 Bacteria 1300
266 Ga0209257_1000024 3300025304 Bacteria 726068
267 Ga0209257_1000082 3300025304 Bacteria 305458
268 Ga0209257_1000849 3300025304 Bacteria 43669
269 Ga0209257_1001178 3300025304 Bacteria 33080
270 Ga0209257_1009060 3300025304 Bacteria 5446
271 Ga0209257_1016861 3300025304 Bacteria 2920
272 Ga0207656_10063228 3300025321 Bacteria 1628
273 Ga0207656_10275817 3300025321 Bacteria 828
274 Ga0207655_1019144 3300025728 Bacteria 3594
275 Ga0207695_10010328 3300025913 Bacteria 11432
276 Ga0207695_10199995 3300025913 Bacteria 1912
277 Ga0207695_10448229 3300025913 Bacteria 1174
278 Ga0207671_10003088 3300025914 Bacteria 16998
279 Ga0207671_10032664 3300025914 Bacteria 3872
280 Ga0207657_10144456 3300025919 Bacteria 1942
281 Ga0207649_10099599 3300025920 Bacteria 1921
282 Ga0207694_10036640 3300025924 Bacteria 3765
283 Ga0207694_10131321 3300025924 Bacteria 2007
284 Ga0207694_10226298 3300025924 Bacteria 1527
285 Ga0207687_10597254 3300025927 Bacteria 930
286 Ga0207690_10583356 3300025932 Bacteria 911
287 Ga0207706_10022576 3300025933 Bacteria 5647
288 Ga0207706_10101256 3300025933 Bacteria 2534
289 Ga0207709_10000410 3300025935 Bacteria 41986
290 Ga0207709_10001314 3300025935 Bacteria 17672
291 Ga0207709_10011656 3300025935 Bacteria 4845
292 Ga0207679_10052783 3300025945 Bacteria 2983
293 Ga0207658_10550987 3300025986 Bacteria 1032
294 Ga0207639_10042242 3300026041 Bacteria 3416
295 Ga0207639_10080833 3300026041 Bacteria 2572
296 Ga0207639_11605747 3300026041 Bacteria 610
297 Ga0207678_10707953 3300026067 Bacteria 886
298 Ga0207702_10074001 3300026078 Bacteria 2939
299 Ga0207674_10791075 3300026116 Bacteria 915
300 Ga0207683_10070258 3300026121 Bacteria 3093
301 Ga0207698_10218365 3300026142 Bacteria 1721
302 Ga0209281_1035925 3300027111 Bacteria 859
303 Ga0209179_1000049 3300027512 Bacteria 23231
304 Ga0209282_1000001 3300027666 Bacteria 2450367
305 Ga0207428_10354119 3300027907 Bacteria 1080
306 Ga0268266_10088324 3300028379 Bacteria 2713
307 Ga0268266_11092718 3300028379 Bacteria 772
308 Ga0268265_10080320 3300028380 Bacteria 2571
309 Ga0307515_10002860 3300028794 Bacteria 36720
310 Ga0307511_10000873 3300030521 Bacteria 32069
311 Ga0265327_10001501 3300031251 Bacteria 28923
312 Ga0307513_10000021 3300031456 Bacteria 228078
313 Ga0307513_10020368 3300031456 Bacteria 7869
314 Ga0307513_10090961 3300031456 Bacteria 3111
315 Ga0307513_10715357 3300031456 Bacteria 707
316 Ga0307509_10422140 3300031507 Bacteria 1034
317 Ga0307408_100000460 3300031548 Bacteria 35652
318 Ga0307408_100061367 3300031548 Bacteria 2744
319 Ga0307408_100063676 3300031548 Bacteria 2698
320 Ga0307408_101317324 3300031548 Bacteria 677
321 Ga0307514_10000225 3300031649 Bacteria 151002
322 Ga0265314_10222442 3300031711 Bacteria 1101
323 Ga0307516_10022395 3300031730 Bacteria 6489
324 Ga0307405_10040296 3300031731 Bacteria 2828
325 Ga0307405_10154875 3300031731 Bacteria 1616
326 Ga0307405_10168673 3300031731 Bacteria 1559
327 Ga0307406_10000206 3300031901 Bacteria 35426
328 Ga0307406_10045524 3300031901 Bacteria 2755
329 Ga0307407_10451946 3300031903 Bacteria 933
330 Ga0307412_10036202 3300031911 Bacteria 3159
331 Ga0307416_100010326 3300032002 Bacteria 6163
332 Ga0307416_100667870 3300032002 Bacteria 1125
333 Ga0307416_102386019 3300032002 Bacteria 629
334 Ga0307414_10414787 3300032004 Bacteria 1173
335 Ga0307411_10157012 3300032005 Bacteria 1698
336 Ga0307507_10054918 3300033179 Bacteria 3784
337 Ga0307507_10250938 3300033179 Bacteria 1143
338 Ga0373935_0093610 3300035692 Bacteria 1971
339 Ga0373937_0303541 3300036401 Bacteria 1509
340 Ga0373925_0287327 3300037068 Unclassified 1326
341 Ga0373925_1088037 3300037068 Bacteria 658
342 Ga0395905_0252882 3300037471 Bacteria 1646
343 Ga0436361_0779710 3300039447 Bacteria 1166
344 Ga0439436_0003562 3300041404 Bacteria 4734
345 Ga0439439_0011972 3300041406 Bacteria 2092
346 Ga0439447_026632 3300041407 Bacteria 1481
347 Ga0439461_0013155 3300041410 Bacteria 1558
348 Ga0439466_0041215 3300041411 Bacteria 1541
349 Ga0451787_342467 3300041441 Bacteria 561
350 Ga0451789_1281421 3300041443 Bacteria 734
351 Ga0451791_0633116 3300041451 Bacteria 1173
352 Ga0451791_1168171 3300041451 Bacteria 882
353 Ga0451791_1636384 3300041451 Bacteria 1722
354 Ga0451791_1939879 3300041451 Bacteria 503
355 Ga0451795_0049646 3300041456 Bacteria 886
356 Ga0451800_0930862 3300041459 Bacteria 1376
357 Ga0451800_1028473 3300041459 Bacteria 724
358 Ga0451807_2398603 3300041486 Bacteria 1387
359 Ga0451833_0428506 3300041491 Bacteria 529
360 Ga0451837_0486304 3300041494 Bacteria 1143
361 Ga0451841_0814763 3300041498 Bacteria 504
362 Ga0451843_1032885 3300041509 Bacteria 985
363 Ga0451855_0891853 3300041511 Bacteria 749
364 Ga0451853_2477644 3300041512 Bacteria 970
365 Ga0451853_2494333 3300041512 Bacteria 1271
366 Ga0439433_0010805 3300041999 Bacteria 1996
367 Ga0439442_001844 3300042002 Bacteria 4149
368 Ga0439432_009049 3300042006 Bacteria 3480
369 Ga0439449_0004695 3300042007 Bacteria 5274
370 Ga0439452_019459 3300042010 Bacteria 1794
371 Ga0439457_019515 3300042014 Bacteria 1506
372 Ga0450911_029262 3300042115 Bacteria 715
373 Ga0450923_091540 3300042125 Bacteria 694
374 Ga0450923_112175 3300042125 Bacteria 637
375 Ga0450896_015414 3300042133 Bacteria 1095
376 Ga0450906_004323 3300042145 Bacteria 2981
377 Ga0450907_031491 3300042146 Bacteria 902
378 Ga0450910_010912 3300042147 Bacteria 1299
379 Ga0439446_0012305 3300042156 Bacteria 2336
380 Ga0450908_005014 3300042184 Bacteria 2542
381 Ga0439434_0021022 3300042435 Bacteria 1960
382 Ga0439459_0049724 3300042438 Bacteria 917
383 Ga0450893_0017896 3300042532 Bacteria 1205
384 Ga0466981_0082575 3300044669 Bacteria 2294
385 Ga0466982_0331005 3300044672 Bacteria 854
386 Ga0466970_0009890 3300044765 Bacteria 4830
387 Ga0495627_021974 3300046453 Bacteria 2105
388 Ga0495627_025194 3300046453 Bacteria 1931
389 Ga0495638_0004315 3300046460 Bacteria 10790
390 Ga0495650_0000432 3300046471 Bacteria 67492
391 Ga0495639_0567772 3300046475 Bacteria 582
392 Ga0495610_0017589 3300046512 Bacteria 4071
393 Ga0495616_0004379 3300046513 Bacteria 8907
394 Ga0495620_0077387 3300046515 Bacteria 1350
395 Ga0495630_0504273 3300046517 Unclassified 928
396 Ga0495631_0004436 3300046518 Bacteria 7473
397 Ga0495643_0102731 3300046522 Bacteria 1463
398 Ga0495648_0263251 3300046524 Bacteria 826
399 Ga0495654_0024188 3300046530 Bacteria 3140
400 Ga0495609_0127728 3300046538 Bacteria 1090
401 Ga0495621_0000251 3300046539 Bacteria 12786
402 Ga0495597_0053109 3300046542 Bacteria 1782
403 Ga0495668_0148888 3300046616 Bacteria 1282
404 Ga0495625_0102410 3300046660 Bacteria 1965
405 Ga0495625_0171530 3300046660 Bacteria 1448
406 Ga0495625_0480441 3300046660 Bacteria 763
407 Ga0495588_0003378 3300046674 Bacteria 6937
408 Ga0495588_0030122 3300046674 Bacteria 2726
409 Ga0495658_0634725 3300046683 Bacteria 684
410 Ga0495658_0655434 3300046683 Bacteria 672
411 Ga0495624_0095782 3300046690 Bacteria 1829
412 Ga0495670_0161994 3300046691 Bacteria 1175
413 Ga0495671_0011916 3300046692 Bacteria 4764
414 Ga0495649_0020378 3300046694 Bacteria 3720
415 Ga0495649_0022534 3300046694 Bacteria 3524
416 Ga0495660_0013639 3300046810 Bacteria 4711
417 Ga0495660_0502080 3300046810 Bacteria 518
418 Ga0495676_0065522 3300047321 Bacteria 2819
419 Ga0495683_0246183 3300047323 Bacteria 786
420 Ga0495677_0198669 3300047445 Bacteria 779
421 Ga0495681_0176527 3300047470 Bacteria 880
422 Ga0495686_0593930 3300047472 Bacteria 574
423 Ga0495593_0019038 3300047673 Bacteria 3853
424 Ga0495593_0232368 3300047673 Bacteria 925
425 Ga0495602_0162023 3300048088 Bacteria 1745
426 Ga0495614_0085585 3300048089 Bacteria 1368
427 Ga0496101_0014165 3300048904 Bacteria 5356
428 Ga0496102_0054472 3300048905 Bacteria 3647
429 Ga0496102_0277751 3300048905 Bacteria 1579
430 Ga0496102_1407665 3300048905 Bacteria 616
431 Ga0496114_0202484 3300048917 Bacteria 1739
432 Ga0496116_0035113 3300048919 Bacteria 3526
433 Ga0496116_0051394 3300048919 Bacteria 2738
434 Ga0496116_0100421 3300048919 Bacteria 1730
435 Ga0496117_0010561 3300048920 Bacteria 8394
436 Ga0496117_0025122 3300048920 Bacteria 4690
437 Ga0496117_0037835 3300048920 Bacteria 3588
438 Ga0496118_0059574 3300048921 Bacteria 2841
439 Ga0496118_0087842 3300048921 Bacteria 2153
440 Ga0496119_0092631 3300048922 Bacteria 1714
441 Ga0496121_0100734 3300048924 Bacteria 2229
442 Ga0496122_0078197 3300048925 Bacteria 2318
443 Ga0496122_0088316 3300048925 Bacteria 2125
444 Ga0496122_0094219 3300048925 Bacteria 2028
445 Ga0496123_0017885 3300048926 Bacteria 5676
446 Ga0496123_0157206 3300048926 Bacteria 1217
447 Ga0496123_0215242 3300048926 Bacteria 973
448 Ga0496123_0535562 3300048926 Bacteria 505
449 Ga0496124_0002373 3300048927 Bacteria 24822
450 Ga0496124_0239932 3300048927 Bacteria 1349
451 Ga0496125_0013794 3300048928 Bacteria 7916
452 Ga0496125_0088318 3300048928 Bacteria 2337
453 Ga0496125_0324351 3300048928 Bacteria 932
454 Ga0496125_0347702 3300048928 Bacteria 887
455 Ga0496125_0392238 3300048928 Bacteria 814
456 Ga0496126_0665253 3300048929 Bacteria 813
457 Ga0496126_1000702 3300048929 Bacteria 627
458 Ga0495678_001521 3300049459 Bacteria 17986
459 Ga0495678_249813 3300049459 Bacteria 527
460 Ga0501292_063350 3300049515 Bacteria 675
461 Ga0501037_0175418 3300049573 Bacteria 1522
462 Ga0501238_003455 3300049671 Bacteria 1940
463 Ga0501279_008492 3300049775 Bacteria 1372
464 nmdc:mga03683_20048_c1 3300050489 Bacteria 2560
465 nmdc:mga03683_645072_c1 3300050489 Bacteria 521
466 nmdc:mga03683_94053_c1 3300050489 Bacteria 1310
467 nmdc:mga03n38_147010_c1 3300050490 Bacteria 1182
468 nmdc:mga03n38_445021_c1 3300050490 Bacteria 720
469 nmdc:mga00v17_306162_c1 3300050491 Bacteria 1032
470 nmdc:mga00v17_51926_c1 3300050491 Bacteria 2493
471 nmdc:mga0yw44_928158_c1 3300050492 Bacteria 590
472 nmdc:mga0k408_115061_c1 3300050493 Bacteria 1591
473 nmdc:mga0k408_118232_c1 3300050493 Bacteria 1569
474 nmdc:mga0k408_296369_c1 3300050493 Bacteria 965
475 nmdc:mga06z11_226762_c1 3300050494 Bacteria 1093
476 nmdc:mga07m45_142918_c1 3300050496 Bacteria 1386
477 nmdc:mga07m45_162320_c1 3300050496 Bacteria 1297
478 nmdc:mga07m45_57980_c1 3300050496 Bacteria 2191
479 nmdc:mga07m45_617066_c1 3300050496 Bacteria 626
480 nmdc:mga07m45_789_c1 3300050496 Bacteria 13618
481 nmdc:mga07m45_9876_c1 3300050496 Bacteria 4965
482 nmdc:mga08x19_485435_c1 3300050514 Bacteria 871
483 Ga0500610_0001125 3300053079 Bacteria 8805
484 Ga0495619_0949270 3300053085 Bacteria 577
485 Ga0500643_003509 3300053087 Bacteria 7512
486 Ga0500644_0001943 3300053088 Bacteria 5277
487 Ga0500646_0000648 3300053090 Bacteria 9940
488 Ga0500583_0026830 3300053092 Bacteria 2479
489 Ga0500583_0415983 3300053092 Bacteria 643
490 Ga0500651_0000028 3300053093 Bacteria 114592
491 Ga0500651_0126994 3300053093 Bacteria 1544
492 Ga0500566_0055001 3300053094 Bacteria 2268
493 Ga0500566_0134029 3300053094 Bacteria 1322
494 Ga0500641_0036329 3300053096 Bacteria 1971
495 Ga0500650_0061414 3300053098 Bacteria 1755
496 Ga0500555_051799 3300053103 Bacteria 1122
497 Ga0500562_021271 3300053108 Bacteria 1687
498 Ga0500569_019177 3300053109 Bacteria 1777
499 Ga0500571_000016 3300053110 Bacteria 64989
500 Ga0500592_011688 3300053116 Bacteria 1404
501 Ga0500593_000343 3300053117 Bacteria 18732
502 Ga0500593_048801 3300053117 Bacteria 1883
503 Ga0500594_0000281 3300053118 Bacteria 11866
504 Ga0500597_075072 3300053120 Bacteria 1464
505 Ga0500607_002724 3300053121 Bacteria 13842
506 Ga0500607_014670 3300053121 Bacteria 4538
507 Ga0500607_025274 3300053121 Bacteria 3308
508 Ga0500608_024419 3300053122 Bacteria 2822
509 Ga0500626_110185 3300053128 Bacteria 1189
510 Ga0500628_009864 3300053129 Bacteria 1694
511 Ga0500642_0079837 3300053130 Bacteria 1501
512 Ga0500642_0307155 3300053130 Bacteria 715
513 Ga0500655_001705 3300053133 Bacteria 4137
514 Ga0500658_0002382 3300053134 Bacteria 7282
515 Ga0500658_0004990 3300053134 Bacteria 4943
516 Ga0500559_0006557 3300053136 Bacteria 5252
517 Ga0500561_0015181 3300053137 Bacteria 1704
518 Ga0500564_007037 3300053138 Bacteria 4743
519 Ga0500564_020166 3300053138 Bacteria 3051
520 Ga0500568_0012540 3300053139 Bacteria 3892
521 Ga0500568_0105892 3300053139 Bacteria 1053
522 Ga0500579_167899 3300053143 Bacteria 903
523 Ga0500586_271047 3300053145 Bacteria 523
524 Ga0500588_0249054 3300053146 Bacteria 667
525 Ga0500604_0001163 3300053151 Bacteria 7306
526 Ga0500616_0042049 3300053153 Bacteria 2448
527 Ga0500624_004208 3300053157 Bacteria 1889
528 Ga0500627_0003274 3300053158 Bacteria 4987
529 Ga0500627_0243121 3300053158 Bacteria 798
530 Ga0500634_0017832 3300053161 Bacteria 3805
531 Ga0500638_008414 3300053162 Bacteria 4397
532 Ga0500636_0000128 3300053177 Bacteria 39607
533 Ga0500636_0169461 3300053177 Bacteria 1182
534 Ga0500637_0059405 3300053178 Bacteria 2189
535 Ga0500637_0290456 3300053178 Bacteria 896
536 Ga0500625_034763 3300053729 Bacteria 2389
537 Ga0500645_000214 3300053730 Bacteria 44143
538 Ga0500645_002912 3300053730 Bacteria 7294
539 Ga0500661_038375 3300055283 Bacteria 847

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025321 Ga0207656_10275817 Ga0207656_102758171 118
2 3300003322 rootL2_10031911 rootL2_1003191110 119
3 3300046542 Ga0495597_0053109 Ga0495597_0053109_1396_1758 120
4 3300046660 Ga0495625_0480441 Ga0495625_0480441_390_752 120
5 3300046691 Ga0495670_0161994 Ga0495670_0161994_25_387 120
6 3300046810 Ga0495660_0502080 Ga0495660_0502080_126_488 120
7 3300047323 Ga0495683_0246183 Ga0495683_0246183_59_421 120
8 3300048905 Ga0496102_1407665 Ga0496102_1407665_242_604 120
9 3300048919 Ga0496116_0035113 Ga0496116_0035113_13_375 120
10 3300049515 Ga0501292_063350 Ga0501292_063350_134_496 120
11 3300049775 Ga0501279_008492 Ga0501279_008492_1000_1362 120
12 3300007788 Ga0099795_10000040 Ga0099795_1000004023 121
13 3300007788 Ga0099795_10005769 Ga0099795_100057693 121
14 3300010159 Ga0099796_10008895 Ga0099796_100088952 121
15 3300010159 Ga0099796_10010608 Ga0099796_100106082 121
16 3300037068 Ga0373925_0287327 Ga0373925_0287327_830_1195 121
17 3300037471 Ga0395905_0252882 Ga0395905_0252882_296_664 121
18 3300046517 Ga0495630_0504273 Ga0495630_0504273_65_430 121
19 3300048917 Ga0496114_0202484 Ga0496114_0202484_1326_1700 121
20 3300049459 Ga0495678_249813 Ga0495678_249813_11_382 121
21 3300050492 nmdc:mga0yw44_928158_c1 nmdc:mga0yw44_928158_c1_20_391 121
22 3300053085 Ga0495619_0949270 Ga0495619_0949270_188_553 121
23 3300053178 Ga0500637_0059405 Ga0500637_0059405_17_382 121
24 iso_pu_bacteria 2885192300 2885194880 128
25 3300006048 Ga0075363_100239544 Ga0075363_1002395442 129
26 3300006353 Ga0075370_10149566 Ga0075370_101495662 129
27 3300011119 Ga0105246_10940154 Ga0105246_109401541 129
28 3300015261 Ga0182006_1197370 Ga0182006_11973702 129
29 3300031548 Ga0307408_100063676 Ga0307408_1000636762 129
30 3300031731 Ga0307405_10040296 Ga0307405_100402962 129
31 3300032002 Ga0307416_100667870 Ga0307416_1006678702 129
32 3300041404 Ga0439436_0003562 Ga0439436_0003562_1032_1421 129
33 3300041406 Ga0439439_0011972 Ga0439439_0011972_193_582 129
34 3300041407 Ga0439447_026632 Ga0439447_026632_1034_1423 129
35 3300041410 Ga0439461_0013155 Ga0439461_0013155_684_1073 129
36 3300041411 Ga0439466_0041215 Ga0439466_0041215_386_775 129
37 3300041999 Ga0439433_0010805 Ga0439433_0010805_502_891 129
38 3300042002 Ga0439442_001844 Ga0439442_001844_3719_4108 129
39 3300042006 Ga0439432_009049 Ga0439432_009049_876_1265 129
40 3300042007 Ga0439449_0004695 Ga0439449_0004695_3218_3607 129
41 3300042010 Ga0439452_019459 Ga0439452_019459_485_874 129
42 3300042014 Ga0439457_019515 Ga0439457_019515_395_784 129
43 3300042115 Ga0450911_029262 Ga0450911_029262_67_456 129
44 3300042125 Ga0450923_091540 Ga0450923_091540_284_673 129
45 3300042125 Ga0450923_112175 Ga0450923_112175_66_455 129
46 3300042133 Ga0450896_015414 Ga0450896_015414_561_950 129
47 3300042145 Ga0450906_004323 Ga0450906_004323_970_1359 129
48 3300042146 Ga0450907_031491 Ga0450907_031491_400_789 129
49 3300042147 Ga0450910_010912 Ga0450910_010912_883_1272 129
50 3300042156 Ga0439446_0012305 Ga0439446_0012305_1861_2250 129
51 3300042184 Ga0450908_005014 Ga0450908_005014_2127_2516 129
52 3300042435 Ga0439434_0021022 Ga0439434_0021022_359_748 129
53 3300042438 Ga0439459_0049724 Ga0439459_0049724_14_403 129
54 3300042532 Ga0450893_0017896 Ga0450893_0017896_116_505 129
55 3300050489 nmdc:mga03683_94053_c1 nmdc:mga03683_94053_c1_23_412 129
56 3300050490 nmdc:mga03n38_147010_c1 nmdc:mga03n38_147010_c1_131_520 129
57 3300050493 nmdc:mga0k408_296369_c1 nmdc:mga0k408_296369_c1_196_585 129
58 3300050496 nmdc:mga07m45_57980_c1 nmdc:mga07m45_57980_c1_549_938 129
59 iso_pu_bacteria 2511231002 2511246219 129
60 iso_pu_bacteria 2513020051 2513230514 129
61 iso_pu_bacteria 2599185214 2599623058 129
62 iso_pu_bacteria 2599185226 2599674705 129
63 iso_pu_bacteria 2599185227 2599680662 129
64 iso_pu_bacteria 2599185229 2599692677 129
65 iso_pu_bacteria 2643221570 2643865692 129
66 iso_pu_bacteria 2643221596 2643992986 129
67 iso_pu_bacteria 2643221652 2644294430 129
68 iso_pu_bacteria 2643221658 2644325320 129
69 iso_pu_bacteria 2643221672 2644399054 129
70 iso_pu_bacteria 2643221683 2644467278 129
71 iso_pu_bacteria 2738541277 2738720955 129
72 iso_pu_bacteria 2738541307 2738886313 129
73 iso_pu_bacteria 2738543013 2739248928 129
74 iso_pu_bacteria 2738543019 2739280154 129
75 iso_pu_bacteria 2818991446 2819602502 129
76 iso_pu_bacteria 2831265667 2831272020 129
77 iso_pu_bacteria 2838054893 2838059849 129
78 iso_pu_bacteria 2842718218 2842719181 129
79 iso_pu_bacteria 2885198086 2885198509 129
80 iso_pu_bacteria 2885211737 2885212111 129
81 iso_pu_bacteria 2899924645 2899928643 129
82 iso_pu_bacteria 2904541872 2904547428 129
83 iso_pu_bacteria 2928037797 2928043405 129
84 iso_pu_bacteria 2928044640 2928050847 129
85 iso_pu_bacteria 2928051484 2928056244 129
86 iso_pu_bacteria 2928064002 2928066277 129
87 iso_pu_bacteria 2928070936 2928075926 129
88 iso_pu_bacteria 2928084124 2928090127 129
89 iso_pu_bacteria 2928115317 2928115693 129
90 iso_pu_bacteria 2929160207 2929165071 129
91 iso_pu_bacteria 2945909444 2945910324 129
92 iso_pu_bacteria 2945984333 2945987632 129
93 iso_pu_bacteria 2974320154 2974323676 129
94 iso_pu_bacteria 2990710928 2990712591 129
95 3300003187 JGI25151J46595_10004776 JGI25151J46595_100047763 132
96 3300003775 Ga0055524_1000129 Ga0055524_100012969 132
97 3300005262 Ga0065165_1056201 Ga0065165_10562012 132
98 3300005288 Ga0065714_10377291 Ga0065714_103772912 132
99 3300005354 Ga0070675_101567110 Ga0070675_1015671101 132
100 3300005364 Ga0070673_100382432 Ga0070673_1003824322 132
101 3300005548 Ga0070665_100099410 Ga0070665_1000994103 132
102 3300005834 Ga0068851_10606006 Ga0068851_106060062 132
103 3300005844 Ga0068862_100096418 Ga0068862_1000964182 132
104 3300006038 Ga0075365_10506092 Ga0075365_105060922 132
105 3300006195 Ga0075366_10132312 Ga0075366_101323123 132
106 3300006353 Ga0075370_10003008 Ga0075370_100030087 132
107 3300006358 Ga0068871_100297316 Ga0068871_1002973163 132
108 3300006948 Ga0099826_10000001 Ga0099826_10000001296 132
109 3300009093 Ga0105240_10010486 Ga0105240_100104868 132
110 3300009545 Ga0105237_10000646 Ga0105237_1000064640 132
111 3300009551 Ga0105238_10062803 Ga0105238_100628034 132
112 3300010375 Ga0105239_10001160 Ga0105239_1000116017 132
113 3300013104 Ga0157370_10028541 Ga0157370_100285416 132
114 3300014497 Ga0182008_10003002 Ga0182008_1000300212 132
115 3300015262 Ga0182007_10001131 Ga0182007_100011316 132
116 3300017792 Ga0163161_10000118 Ga0163161_1000011861 132
117 3300025258 Ga0209129_1003435 Ga0209129_10034353 132
118 3300025294 Ga0209025_1001146 Ga0209025_100114620 132
119 3300025295 Ga0209564_1011219 Ga0209564_10112192 132
120 3300025299 Ga0209256_1000285 Ga0209256_100028569 132
121 3300025913 Ga0207695_10010328 Ga0207695_100103286 132
122 3300025914 Ga0207671_10003088 Ga0207671_100030889 132
123 3300025924 Ga0207694_10036640 Ga0207694_100366404 132
124 3300025935 Ga0207709_10011656 Ga0207709_100116565 132
125 3300026041 Ga0207639_11605747 Ga0207639_116057471 132
126 3300026121 Ga0207683_10070258 Ga0207683_100702583 132
127 3300027666 Ga0209282_1000001 Ga0209282_10000011434 132
128 3300028379 Ga0268266_10088324 Ga0268266_100883242 132
129 3300028380 Ga0268265_10080320 Ga0268265_100803202 132
130 3300031251 Ga0265327_10001501 Ga0265327_100015016 132
131 3300031456 Ga0307513_10090961 Ga0307513_100909613 132
132 3300031456 Ga0307513_10715357 Ga0307513_107153572 132
133 3300032002 Ga0307416_100010326 Ga0307416_1000103265 132
134 3300044669 Ga0466981_0082575 Ga0466981_0082575_1498_1896 132
135 3300044672 Ga0466982_0331005 Ga0466982_0331005_286_684 132
136 3300044765 Ga0466970_0009890 Ga0466970_0009890_1152_1550 132
137 3300046453 Ga0495627_021974 Ga0495627_021974_1090_1488 132
138 3300046471 Ga0495650_0000432 Ga0495650_0000432_3344_3742 132
139 3300046475 Ga0495639_0567772 Ga0495639_0567772_89_487 132
140 3300046515 Ga0495620_0077387 Ga0495620_0077387_456_854 132
141 3300046522 Ga0495643_0102731 Ga0495643_0102731_114_512 132
142 3300046524 Ga0495648_0263251 Ga0495648_0263251_333_731 132
143 3300046538 Ga0495609_0127728 Ga0495609_0127728_92_490 132
144 3300046660 Ga0495625_0171530 Ga0495625_0171530_1019_1417 132
145 3300046674 Ga0495588_0003378 Ga0495588_0003378_3456_3854 132
146 3300046683 Ga0495658_0655434 Ga0495658_0655434_144_542 132
147 3300046692 Ga0495671_0011916 Ga0495671_0011916_1616_2014 132
148 3300046694 Ga0495649_0020378 Ga0495649_0020378_962_1360 132
149 3300046694 Ga0495649_0022534 Ga0495649_0022534_2496_2894 132
150 3300046810 Ga0495660_0013639 Ga0495660_0013639_2753_3151 132
151 3300047470 Ga0495681_0176527 Ga0495681_0176527_214_612 132
152 3300047673 Ga0495593_0232368 Ga0495593_0232368_420_818 132
153 3300048905 Ga0496102_0054472 Ga0496102_0054472_2790_3188 132
154 3300048928 Ga0496125_0324351 Ga0496125_0324351_133_531 132
155 3300048929 Ga0496126_0665253 Ga0496126_0665253_201_599 132
156 3300049671 Ga0501238_003455 Ga0501238_003455_297_695 132
157 3300050493 nmdc:mga0k408_118232_c1 nmdc:mga0k408_118232_c1_982_1380 132
158 3300050496 nmdc:mga07m45_789_c1 nmdc:mga07m45_789_c1_452_850 132
159 3300053079 Ga0500610_0001125 Ga0500610_0001125_7654_8052 132
160 3300053109 Ga0500569_019177 Ga0500569_019177_824_1222 132
161 3300053117 Ga0500593_048801 Ga0500593_048801_413_811 132
162 3300053121 Ga0500607_002724 Ga0500607_002724_1088_1486 132
163 3300053122 Ga0500608_024419 Ga0500608_024419_745_1143 132
164 3300053130 Ga0500642_0307155 Ga0500642_0307155_307_705 132
165 3300053138 Ga0500564_020166 Ga0500564_020166_1088_1486 132
166 3300053158 Ga0500627_0003274 Ga0500627_0003274_1786_2184 132
167 3300001979 JGI24740J21852_10031582 JGI24740J21852_100315822 133
168 3300001989 JGI24739J22299_10088829 JGI24739J22299_100888291 133
169 3300002704 JGI25155J39150_1000008 JGI25155J39150_1000008204 133
170 3300002705 JGI25156J39149_1000002 JGI25156J39149_100000250 133
171 3300002738 JGI25154J39366_1000010 JGI25154J39366_1000010267 133
172 3300002741 JGI25157J39369_1000001 JGI25157J39369_100000171 133
173 3300002773 JGI25152J39213_1009563 JGI25152J39213_10095634 133
174 3300002773 JGI25152J39213_1013215 JGI25152J39213_10132153 133
175 3300002773 JGI25152J39213_1019082 JGI25152J39213_10190823 133
176 3300002774 JGI25150J39212_1000410 JGI25150J39212_10004104 133
177 3300002774 JGI25150J39212_1007763 JGI25150J39212_10077634 133
178 3300002774 JGI25150J39212_1010689 JGI25150J39212_10106892 133
179 3300002774 JGI25150J39212_1032432 JGI25150J39212_10324321 133
180 3300002987 JGI25159J45721_1001868 JGI25159J45721_10018687 133
181 3300002987 JGI25159J45721_1002408 JGI25159J45721_10024085 133
182 3300002987 JGI25159J45721_1002497 JGI25159J45721_10024976 133
183 3300002987 JGI25159J45721_1002663 JGI25159J45721_10026637 133
184 3300002987 JGI25159J45721_1011308 JGI25159J45721_10113082 133
185 3300003187 JGI25151J46595_10002993 JGI25151J46595_100029935 133
186 3300003187 JGI25151J46595_10003749 JGI25151J46595_100037495 133
187 3300003187 JGI25151J46595_10004501 JGI25151J46595_100045016 133
188 3300003187 JGI25151J46595_10025336 JGI25151J46595_100253364 133
189 3300003187 JGI25151J46595_10027608 JGI25151J46595_100276082 133
190 3300003187 JGI25151J46595_10053813 JGI25151J46595_100538132 133
191 3300003187 JGI25151J46595_10054607 JGI25151J46595_100546072 133
192 3300003215 JGI25153J46596_10001657 JGI25153J46596_100016572 133
193 3300003215 JGI25153J46596_10044214 JGI25153J46596_100442142 133
194 3300003215 JGI25153J46596_10044937 JGI25153J46596_100449372 133
195 3300003354 JGI25160J50197_1000342 JGI25160J50197_100034211 133
196 3300003354 JGI25160J50197_1003559 JGI25160J50197_10035594 133
197 3300003354 JGI25160J50197_1026858 JGI25160J50197_10268582 133
198 3300003374 JGI25161J50226_1000259 JGI25161J50226_100025911 133
199 3300003374 JGI25161J50226_1002084 JGI25161J50226_10020842 133
200 3300003374 JGI25161J50226_1003187 JGI25161J50226_10031874 133
201 3300003374 JGI25161J50226_1018869 JGI25161J50226_10188692 133
202 3300003578 Ga0006562J51391_1110162 Ga0006562J51391_11101625 133
203 3300003578 Ga0006562J51391_1110163 Ga0006562J51391_11101632 133
204 3300003761 Ga0055535_1000075 Ga0055535_100007522 133
205 3300003762 Ga0055542_1000059 Ga0055542_100005969 133
206 3300003771 Ga0055526_1001483 Ga0055526_10014836 133
207 3300003771 Ga0055526_1003973 Ga0055526_10039737 133
208 3300003771 Ga0055526_1014877 Ga0055526_10148772 133
209 3300003771 Ga0055526_1021191 Ga0055526_10211912 133
210 3300003773 Ga0055537_1000102 Ga0055537_100010214 133
211 3300003773 Ga0055537_1004785 Ga0055537_10047855 133
212 3300003773 Ga0055537_1008247 Ga0055537_10082473 133
213 3300003773 Ga0055537_1013973 Ga0055537_10139733 133
214 3300003775 Ga0055524_1000093 Ga0055524_100009364 133
215 3300003775 Ga0055524_1003348 Ga0055524_10033487 133
216 3300003775 Ga0055524_1004022 Ga0055524_10040226 133
217 3300003781 Ga0055536_1006611 Ga0055536_10066113 133
218 3300003781 Ga0055536_1011381 Ga0055536_10113814 133
219 3300003781 Ga0055536_1029269 Ga0055536_10292692 133
220 3300003781 Ga0055536_1042611 Ga0055536_10426112 133
221 3300003784 Ga0055534_1001554 Ga0055534_10015546 133
222 3300003784 Ga0055534_1002793 Ga0055534_10027935 133
223 3300003790 Ga0055528_1000696 Ga0055528_100069614 133
224 3300003790 Ga0055528_1003913 Ga0055528_10039134 133
225 3300003790 Ga0055528_1016988 Ga0055528_10169883 133
226 3300003790 Ga0055528_1029570 Ga0055528_10295703 133
227 3300003791 Ga0055530_10000891 Ga0055530_100008916 133
228 3300003791 Ga0055530_10001159 Ga0055530_100011594 133
229 3300003791 Ga0055530_10007476 Ga0055530_100074767 133
230 3300003791 Ga0055530_10029647 Ga0055530_100296472 133
231 3300003792 Ga0055540_1000089 Ga0055540_100008990 133
232 3300003792 Ga0055540_1000196 Ga0055540_10001966 133
233 3300003792 Ga0055540_1003775 Ga0055540_10037754 133
234 3300003792 Ga0055540_1005801 Ga0055540_10058013 133
235 3300003792 Ga0055540_1012701 Ga0055540_10127013 133
236 3300003794 Ga0055531_10004653 Ga0055531_100046536 133
237 3300003794 Ga0055531_10009205 Ga0055531_100092053 133
238 3300003794 Ga0055531_10015220 Ga0055531_100152204 133
239 3300003794 Ga0055531_10023923 Ga0055531_100239232 133
240 3300004625 Ga0055543_1000527 Ga0055543_100052713 133
241 3300004625 Ga0055543_1004773 Ga0055543_10047732 133
242 3300005262 Ga0065165_1000005 Ga0065165_1000005214 133
243 3300005262 Ga0065165_1005593 Ga0065165_10055934 133
244 3300005262 Ga0065165_1005633 Ga0065165_10056335 133
245 3300005262 Ga0065165_1006014 Ga0065165_10060145 133
246 3300005262 Ga0065165_1019383 Ga0065165_10193832 133
247 3300005262 Ga0065165_1022411 Ga0065165_10224113 133
248 3300005289 Ga0065704_10095727 Ga0065704_100957272 133
249 3300005339 Ga0070660_100575043 Ga0070660_1005750432 133
250 3300005344 Ga0070661_100339910 Ga0070661_1003399102 133
251 3300005366 Ga0070659_100655742 Ga0070659_1006557422 133
252 3300005367 Ga0070667_100868924 Ga0070667_1008689241 133
253 3300005440 Ga0070705_100291736 Ga0070705_1002917361 133
254 3300005455 Ga0070663_100700525 Ga0070663_1007005251 133
255 3300005457 Ga0070662_100005660 Ga0070662_1000056608 133
256 3300005468 Ga0070707_100154257 Ga0070707_1001542571 133
257 3300005539 Ga0068853_100391418 Ga0068853_1003914181 133
258 3300005539 Ga0068853_100513032 Ga0068853_1005130322 133
259 3300005548 Ga0070665_100625285 Ga0070665_1006252852 133
260 3300005549 Ga0070704_102030949 Ga0070704_1020309491 133
261 3300005564 Ga0070664_100012673 Ga0070664_1000126734 133
262 3300005577 Ga0068857_100226282 Ga0068857_1002262822 133
263 3300005578 Ga0068854_100322160 Ga0068854_1003221602 133
264 3300005578 Ga0068854_100589395 Ga0068854_1005893952 133
265 3300005614 Ga0068856_100162965 Ga0068856_1001629652 133
266 3300005834 Ga0068851_10008039 Ga0068851_100080395 133
267 3300006038 Ga0075365_10715964 Ga0075365_107159641 133
268 3300006048 Ga0075363_100323768 Ga0075363_1003237682 133
269 3300006051 Ga0075364_10048728 Ga0075364_100487283 133
270 3300006051 Ga0075364_10352951 Ga0075364_103529512 133
271 3300006058 Ga0075432_10004613 Ga0075432_100046135 133
272 3300006177 Ga0075362_10006927 Ga0075362_100069274 133
273 3300006177 Ga0075362_10593418 Ga0075362_105934182 133
274 3300006178 Ga0075367_10396324 Ga0075367_103963242 133
275 3300006178 Ga0075367_10450273 Ga0075367_104502731 133
276 3300006195 Ga0075366_10114463 Ga0075366_101144631 133
277 3300006195 Ga0075366_10171671 Ga0075366_101716712 133
278 3300006195 Ga0075366_10236317 Ga0075366_102363172 133
279 3300006195 Ga0075366_10522216 Ga0075366_105222162 133
280 3300006353 Ga0075370_10066314 Ga0075370_100663143 133
281 3300006353 Ga0075370_10118462 Ga0075370_101184622 133
282 3300006353 Ga0075370_10309881 Ga0075370_103098812 133
283 3300006353 Ga0075370_10951849 Ga0075370_109518492 133
284 3300006358 Ga0068871_100142918 Ga0068871_1001429184 133
285 3300006946 Ga0079104_1075347 Ga0079104_10753472 133
286 3300006948 Ga0099826_10499711 Ga0099826_104997112 133
287 3300009036 Ga0105244_10000885 Ga0105244_1000088517 133
288 3300009036 Ga0105244_10072907 Ga0105244_100729072 133
289 3300009098 Ga0105245_11460290 Ga0105245_114602902 133
290 3300009148 Ga0105243_10006560 Ga0105243_100065609 133
291 3300009148 Ga0105243_10008567 Ga0105243_100085676 133
292 3300009174 Ga0105241_10520780 Ga0105241_105207802 133
293 3300009545 Ga0105237_10015716 Ga0105237_100157164 133
294 3300009551 Ga0105238_10154496 Ga0105238_101544962 133
295 3300010375 Ga0105239_10072120 Ga0105239_100721202 133
296 3300010375 Ga0105239_10295522 Ga0105239_102955223 133
297 3300011119 Ga0105246_10066092 Ga0105246_100660923 133
298 3300011119 Ga0105246_10118002 Ga0105246_101180022 133
299 3300012490 Ga0157322_1002602 Ga0157322_10026022 133
300 3300012502 Ga0157347_1000283 Ga0157347_10002834 133
301 3300013100 Ga0157373_10132842 Ga0157373_101328422 133
302 3300013104 Ga0157370_11109372 Ga0157370_111093722 133
303 3300013105 Ga0157369_10008062 Ga0157369_100080626 133
304 3300013307 Ga0157372_10160319 Ga0157372_101603193 133
305 3300013308 Ga0157375_11018052 Ga0157375_110180522 133
306 3300014497 Ga0182008_10002504 Ga0182008_100025042 133
307 3300015261 Ga0182006_1001611 Ga0182006_100161113 133
308 3300015262 Ga0182007_10000330 Ga0182007_1000033014 133
309 3300017792 Ga0163161_10096802 Ga0163161_100968023 133
310 3300025206 Ga0209435_100001 Ga0209435_1000011245 133
311 3300025208 Ga0209436_104299 Ga0209436_1042992 133
312 3300025208 Ga0209436_106984 Ga0209436_1069842 133
313 3300025228 Ga0209672_100197 Ga0209672_10019736 133
314 3300025229 Ga0209147_100669 Ga0209147_1006694 133
315 3300025242 Ga0209258_100078 Ga0209258_10007878 133
316 3300025245 Ga0207425_1000191 Ga0207425_100019117 133
317 3300025245 Ga0207425_1003124 Ga0207425_10031245 133
318 3300025245 Ga0207425_1003360 Ga0207425_10033603 133
319 3300025245 Ga0207425_1013550 Ga0207425_10135503 133
320 3300025246 Ga0209646_1000001 Ga0209646_10000011614 133
321 3300025250 Ga0209026_1000001 Ga0209026_1000001267 133
322 3300025254 Ga0209148_1000086 Ga0209148_100008678 133
323 3300025256 Ga0209759_1000001 Ga0209759_10000011245 133
324 3300025258 Ga0209129_1000116 Ga0209129_100011686 133
325 3300025258 Ga0209129_1009606 Ga0209129_10096064 133
326 3300025258 Ga0209129_1015482 Ga0209129_10154822 133
327 3300025258 Ga0209129_1017030 Ga0209129_10170303 133
328 3300025263 Ga0209565_1000133 Ga0209565_100013379 133
329 3300025263 Ga0209565_1000161 Ga0209565_100016170 133
330 3300025263 Ga0209565_1000884 Ga0209565_100088410 133
331 3300025263 Ga0209565_1002899 Ga0209565_10028997 133
332 3300025263 Ga0209565_1003640 Ga0209565_10036403 133
333 3300025273 Ga0209673_1000190 Ga0209673_100019052 133
334 3300025273 Ga0209673_1000315 Ga0209673_100031566 133
335 3300025273 Ga0209673_1000391 Ga0209673_100039145 133
336 3300025284 Ga0209130_1000084 Ga0209130_10000846 133
337 3300025284 Ga0209130_1000118 Ga0209130_100011831 133
338 3300025284 Ga0209130_1000159 Ga0209130_100015923 133
339 3300025284 Ga0209130_1000359 Ga0209130_100035941 133
340 3300025284 Ga0209130_1000727 Ga0209130_10007275 133
341 3300025284 Ga0209130_1034814 Ga0209130_10348142 133
342 3300025291 Ga0209675_1000111 Ga0209675_1000111104 133
343 3300025291 Ga0209675_1000282 Ga0209675_100028224 133
344 3300025291 Ga0209675_1000495 Ga0209675_100049514 133
345 3300025291 Ga0209675_1012562 Ga0209675_10125624 133
346 3300025291 Ga0209675_1045864 Ga0209675_10458642 133
347 3300025291 Ga0209675_1047001 Ga0209675_10470012 133
348 3300025292 Ga0209676_1000054 Ga0209676_100005491 133
349 3300025292 Ga0209676_1000125 Ga0209676_100012590 133
350 3300025292 Ga0209676_1000732 Ga0209676_10007328 133
351 3300025292 Ga0209676_1001799 Ga0209676_100179914 133
352 3300025292 Ga0209676_1003774 Ga0209676_10037747 133
353 3300025292 Ga0209676_1004341 Ga0209676_10043413 133
354 3300025292 Ga0209676_1063707 Ga0209676_10637072 133
355 3300025294 Ga0209025_1000256 Ga0209025_100025630 133
356 3300025294 Ga0209025_1000293 Ga0209025_100029354 133
357 3300025294 Ga0209025_1001351 Ga0209025_100135121 133
358 3300025294 Ga0209025_1004481 Ga0209025_10044819 133
359 3300025294 Ga0209025_1006065 Ga0209025_10060655 133
360 3300025294 Ga0209025_1027379 Ga0209025_10273793 133
361 3300025294 Ga0209025_1057366 Ga0209025_10573663 133
362 3300025294 Ga0209025_1099365 Ga0209025_10993653 133
363 3300025295 Ga0209564_1000201 Ga0209564_100020154 133
364 3300025295 Ga0209564_1000535 Ga0209564_100053558 133
365 3300025295 Ga0209564_1000610 Ga0209564_100061026 133
366 3300025295 Ga0209564_1000815 Ga0209564_100081528 133
367 3300025295 Ga0209564_1006251 Ga0209564_10062517 133
368 3300025297 Ga0209758_1000034 Ga0209758_100003454 133
369 3300025297 Ga0209758_1006167 Ga0209758_10061678 133
370 3300025297 Ga0209758_1023068 Ga0209758_10230683 133
371 3300025297 Ga0209758_1023250 Ga0209758_10232503 133
372 3300025297 Ga0209758_1042401 Ga0209758_10424013 133
373 3300025298 Ga0209050_1000012 Ga0209050_1000012694 133
374 3300025298 Ga0209050_1000066 Ga0209050_100006691 133
375 3300025298 Ga0209050_1001609 Ga0209050_10016095 133
376 3300025298 Ga0209050_1005132 Ga0209050_10051324 133
377 3300025298 Ga0209050_1008858 Ga0209050_10088583 133
378 3300025298 Ga0209050_1014785 Ga0209050_10147854 133
379 3300025298 Ga0209050_1072964 Ga0209050_10729641 133
380 3300025299 Ga0209256_1000003 Ga0209256_10000031364 133
381 3300025299 Ga0209256_1000066 Ga0209256_100006618 133
382 3300025299 Ga0209256_1000270 Ga0209256_100027068 133
383 3300025299 Ga0209256_1015319 Ga0209256_10153192 133
384 3300025299 Ga0209256_1032735 Ga0209256_10327352 133
385 3300025299 Ga0209256_1058864 Ga0209256_10588642 133
386 3300025299 Ga0209256_1064281 Ga0209256_10642812 133
387 3300025302 Ga0207426_1000197 Ga0207426_100019751 133
388 3300025302 Ga0207426_1000244 Ga0207426_100024450 133
389 3300025302 Ga0207426_1000369 Ga0207426_100036921 133
390 3300025302 Ga0207426_1001157 Ga0207426_100115715 133
391 3300025302 Ga0207426_1025104 Ga0207426_10251042 133
392 3300025303 Ga0209051_1000044 Ga0209051_100004491 133
393 3300025303 Ga0209051_1000134 Ga0209051_100013428 133
394 3300025303 Ga0209051_1000322 Ga0209051_100032218 133
395 3300025303 Ga0209051_1000344 Ga0209051_100034469 133
396 3300025303 Ga0209051_1054724 Ga0209051_10547242 133
397 3300025304 Ga0209257_1000024 Ga0209257_1000024640 133
398 3300025304 Ga0209257_1000082 Ga0209257_100008291 133
399 3300025304 Ga0209257_1000849 Ga0209257_100084916 133
400 3300025304 Ga0209257_1001178 Ga0209257_100117814 133
401 3300025304 Ga0209257_1009060 Ga0209257_10090604 133
402 3300025304 Ga0209257_1016861 Ga0209257_10168613 133
403 3300025321 Ga0207656_10063228 Ga0207656_100632283 133
404 3300025728 Ga0207655_1019144 Ga0207655_10191445 133
405 3300025913 Ga0207695_10199995 Ga0207695_101999952 133
406 3300025913 Ga0207695_10448229 Ga0207695_104482291 133
407 3300025914 Ga0207671_10032664 Ga0207671_100326644 133
408 3300025919 Ga0207657_10144456 Ga0207657_101444562 133
409 3300025920 Ga0207649_10099599 Ga0207649_100995992 133
410 3300025924 Ga0207694_10131321 Ga0207694_101313211 133
411 3300025924 Ga0207694_10226298 Ga0207694_102262982 133
412 3300025927 Ga0207687_10597254 Ga0207687_105972541 133
413 3300025932 Ga0207690_10583356 Ga0207690_105833562 133
414 3300025933 Ga0207706_10022576 Ga0207706_100225765 133
415 3300025933 Ga0207706_10101256 Ga0207706_101012564 133
416 3300025935 Ga0207709_10000410 Ga0207709_100004109 133
417 3300025935 Ga0207709_10001314 Ga0207709_1000131412 133
418 3300025945 Ga0207679_10052783 Ga0207679_100527832 133
419 3300025986 Ga0207658_10550987 Ga0207658_105509872 133
420 3300026041 Ga0207639_10042242 Ga0207639_100422425 133
421 3300026041 Ga0207639_10080833 Ga0207639_100808332 133
422 3300026067 Ga0207678_10707953 Ga0207678_107079532 133
423 3300026078 Ga0207702_10074001 Ga0207702_100740014 133
424 3300026116 Ga0207674_10791075 Ga0207674_107910752 133
425 3300026142 Ga0207698_10218365 Ga0207698_102183653 133
426 3300027111 Ga0209281_1035925 Ga0209281_10359252 133
427 3300027512 Ga0209179_1000049 Ga0209179_10000492 133
428 3300027907 Ga0207428_10354119 Ga0207428_103541192 133
429 3300028379 Ga0268266_11092718 Ga0268266_110927181 133
430 3300028794 Ga0307515_10002860 Ga0307515_1000286033 133
431 3300030521 Ga0307511_10000873 Ga0307511_1000087320 133
432 3300031456 Ga0307513_10000021 Ga0307513_10000021197 133
433 3300031456 Ga0307513_10020368 Ga0307513_100203686 133
434 3300031507 Ga0307509_10422140 Ga0307509_104221402 133
435 3300031548 Ga0307408_100000460 Ga0307408_10000046036 133
436 3300031548 Ga0307408_100061367 Ga0307408_1000613672 133
437 3300031548 Ga0307408_101317324 Ga0307408_1013173242 133
438 3300031649 Ga0307514_10000225 Ga0307514_1000022592 133
439 3300031711 Ga0265314_10222442 Ga0265314_102224421 133
440 3300031730 Ga0307516_10022395 Ga0307516_100223958 133
441 3300031731 Ga0307405_10154875 Ga0307405_101548752 133
442 3300031731 Ga0307405_10168673 Ga0307405_101686733 133
443 3300031901 Ga0307406_10000206 Ga0307406_100002064 133
444 3300031901 Ga0307406_10045524 Ga0307406_100455244 133
445 3300031903 Ga0307407_10451946 Ga0307407_104519462 133
446 3300031911 Ga0307412_10036202 Ga0307412_100362024 133
447 3300032002 Ga0307416_102386019 Ga0307416_1023860191 133
448 3300032004 Ga0307414_10414787 Ga0307414_104147872 133
449 3300032005 Ga0307411_10157012 Ga0307411_101570122 133
450 3300033179 Ga0307507_10054918 Ga0307507_100549182 133
451 3300033179 Ga0307507_10250938 Ga0307507_102509382 133
452 3300035692 Ga0373935_0093610 Ga0373935_0093610_573_974 133
453 3300036401 Ga0373937_0303541 Ga0373937_0303541_298_699 133
454 3300037068 Ga0373925_1088037 Ga0373925_1088037_51_452 133
455 3300039447 Ga0436361_0779710 Ga0436361_0779710_684_1091 133
456 3300041441 Ga0451787_342467 Ga0451787_342467_66_479 133
457 3300041443 Ga0451789_1281421 Ga0451789_1281421_92_499 133
458 3300041451 Ga0451791_0633116 Ga0451791_0633116_165_572 133
459 3300041451 Ga0451791_1168171 Ga0451791_1168171_242_643 133
460 3300041451 Ga0451791_1636384 Ga0451791_1636384_263_670 133
461 3300041451 Ga0451791_1939879 Ga0451791_1939879_60_467 133
462 3300041456 Ga0451795_0049646 Ga0451795_0049646_212_619 133
463 3300041459 Ga0451800_0930862 Ga0451800_0930862_827_1234 133
464 3300041459 Ga0451800_1028473 Ga0451800_1028473_296_697 133
465 3300041486 Ga0451807_2398603 Ga0451807_2398603_302_703 133
466 3300041491 Ga0451833_0428506 Ga0451833_0428506_94_501 133
467 3300041494 Ga0451837_0486304 Ga0451837_0486304_507_914 133
468 3300041498 Ga0451841_0814763 Ga0451841_0814763_27_428 133
469 3300041509 Ga0451843_1032885 Ga0451843_1032885_51_458 133
470 3300041511 Ga0451855_0891853 Ga0451855_0891853_115_522 133
471 3300041512 Ga0451853_2477644 Ga0451853_2477644_47_454 133
472 3300041512 Ga0451853_2494333 Ga0451853_2494333_540_947 133
473 3300046453 Ga0495627_025194 Ga0495627_025194_881_1282 133
474 3300046460 Ga0495638_0004315 Ga0495638_0004315_93_494 133
475 3300046512 Ga0495610_0017589 Ga0495610_0017589_1342_1743 133
476 3300046513 Ga0495616_0004379 Ga0495616_0004379_1044_1445 133
477 3300046518 Ga0495631_0004436 Ga0495631_0004436_3543_3944 133
478 3300046530 Ga0495654_0024188 Ga0495654_0024188_755_1156 133
479 3300046539 Ga0495621_0000251 Ga0495621_0000251_11485_11886 133
480 3300046616 Ga0495668_0148888 Ga0495668_0148888_444_845 133
481 3300046660 Ga0495625_0102410 Ga0495625_0102410_826_1227 133
482 3300046674 Ga0495588_0030122 Ga0495588_0030122_172_573 133
483 3300046683 Ga0495658_0634725 Ga0495658_0634725_222_623 133
484 3300046690 Ga0495624_0095782 Ga0495624_0095782_882_1283 133
485 3300047321 Ga0495676_0065522 Ga0495676_0065522_492_893 133
486 3300047445 Ga0495677_0198669 Ga0495677_0198669_357_758 133
487 3300047472 Ga0495686_0593930 Ga0495686_0593930_14_415 133
488 3300047673 Ga0495593_0019038 Ga0495593_0019038_546_947 133
489 3300048088 Ga0495602_0162023 Ga0495602_0162023_1196_1597 133
490 3300048089 Ga0495614_0085585 Ga0495614_0085585_56_457 133
491 3300048904 Ga0496101_0014165 Ga0496101_0014165_1700_2101 133
492 3300048905 Ga0496102_0277751 Ga0496102_0277751_439_840 133
493 3300048919 Ga0496116_0051394 Ga0496116_0051394_14_415 133
494 3300048919 Ga0496116_0100421 Ga0496116_0100421_746_1147 133
495 3300048920 Ga0496117_0010561 Ga0496117_0010561_7652_8053 133
496 3300048920 Ga0496117_0025122 Ga0496117_0025122_3686_4087 133
497 3300048920 Ga0496117_0037835 Ga0496117_0037835_395_796 133
498 3300048921 Ga0496118_0059574 Ga0496118_0059574_1397_1798 133
499 3300048921 Ga0496118_0087842 Ga0496118_0087842_667_1068 133
500 3300048922 Ga0496119_0092631 Ga0496119_0092631_205_606 133
501 3300048924 Ga0496121_0100734 Ga0496121_0100734_772_1173 133
502 3300048925 Ga0496122_0078197 Ga0496122_0078197_1763_2164 133
503 3300048925 Ga0496122_0088316 Ga0496122_0088316_1192_1629 133
504 3300048925 Ga0496122_0094219 Ga0496122_0094219_23_424 133
505 3300048926 Ga0496123_0017885 Ga0496123_0017885_4184_4585 133
506 3300048926 Ga0496123_0157206 Ga0496123_0157206_709_1122 133
507 3300048926 Ga0496123_0215242 Ga0496123_0215242_68_508 133
508 3300048926 Ga0496123_0535562 Ga0496123_0535562_36_437 133
509 3300048927 Ga0496124_0002373 Ga0496124_0002373_8421_8861 133
510 3300048927 Ga0496124_0239932 Ga0496124_0239932_46_447 133
511 3300048928 Ga0496125_0013794 Ga0496125_0013794_2048_2449 133
512 3300048928 Ga0496125_0088318 Ga0496125_0088318_1287_1688 133
513 3300048928 Ga0496125_0347702 Ga0496125_0347702_143_544 133
514 3300048928 Ga0496125_0392238 Ga0496125_0392238_286_687 133
515 3300048929 Ga0496126_1000702 Ga0496126_1000702_25_426 133
516 3300049459 Ga0495678_001521 Ga0495678_001521_6092_6496 133
517 3300049573 Ga0501037_0175418 Ga0501037_0175418_1036_1443 133
518 3300050489 nmdc:mga03683_20048_c1 nmdc:mga03683_20048_c1_2018_2425 133
519 3300050489 nmdc:mga03683_645072_c1 nmdc:mga03683_645072_c1_104_511 133
520 3300050490 nmdc:mga03n38_445021_c1 nmdc:mga03n38_445021_c1_55_462 133
521 3300050491 nmdc:mga00v17_306162_c1 nmdc:mga00v17_306162_c1_136_543 133
522 3300050491 nmdc:mga00v17_51926_c1 nmdc:mga00v17_51926_c1_543_980 133
523 3300050493 nmdc:mga0k408_115061_c1 nmdc:mga0k408_115061_c1_44_445 133
524 3300050494 nmdc:mga06z11_226762_c1 nmdc:mga06z11_226762_c1_228_629 133
525 3300050496 nmdc:mga07m45_142918_c1 nmdc:mga07m45_142918_c1_260_661 133
526 3300050496 nmdc:mga07m45_162320_c1 nmdc:mga07m45_162320_c1_714_1121 133
527 3300050496 nmdc:mga07m45_617066_c1 nmdc:mga07m45_617066_c1_15_416 133
528 3300050496 nmdc:mga07m45_9876_c1 nmdc:mga07m45_9876_c1_2056_2457 133
529 3300050514 nmdc:mga08x19_485435_c1 nmdc:mga08x19_485435_c1_258_659 133
530 3300053087 Ga0500643_003509 Ga0500643_003509_2388_2789 133
531 3300053088 Ga0500644_0001943 Ga0500644_0001943_1943_2350 133
532 3300053090 Ga0500646_0000648 Ga0500646_0000648_8623_9024 133
533 3300053092 Ga0500583_0026830 Ga0500583_0026830_1091_1492 133
534 3300053092 Ga0500583_0415983 Ga0500583_0415983_36_443 133
535 3300053093 Ga0500651_0000028 Ga0500651_0000028_56221_56622 133
536 3300053093 Ga0500651_0126994 Ga0500651_0126994_341_748 133
537 3300053094 Ga0500566_0055001 Ga0500566_0055001_1611_2018 133
538 3300053094 Ga0500566_0134029 Ga0500566_0134029_678_1085 133
539 3300053096 Ga0500641_0036329 Ga0500641_0036329_36_443 133
540 3300053098 Ga0500650_0061414 Ga0500650_0061414_176_583 133
541 3300053103 Ga0500555_051799 Ga0500555_051799_250_657 133
542 3300053108 Ga0500562_021271 Ga0500562_021271_1223_1624 133
543 3300053110 Ga0500571_000016 Ga0500571_000016_17120_17521 133
544 3300053116 Ga0500592_011688 Ga0500592_011688_226_627 133
545 3300053117 Ga0500593_000343 Ga0500593_000343_9264_9671 133
546 3300053118 Ga0500594_0000281 Ga0500594_0000281_4526_4927 133
547 3300053120 Ga0500597_075072 Ga0500597_075072_912_1313 133
548 3300053121 Ga0500607_014670 Ga0500607_014670_3229_3630 133
549 3300053121 Ga0500607_025274 Ga0500607_025274_2128_2529 133
550 3300053128 Ga0500626_110185 Ga0500626_110185_63_464 133
551 3300053129 Ga0500628_009864 Ga0500628_009864_947_1354 133
552 3300053130 Ga0500642_0079837 Ga0500642_0079837_452_853 133
553 3300053133 Ga0500655_001705 Ga0500655_001705_2833_3234 133
554 3300053134 Ga0500658_0002382 Ga0500658_0002382_6440_6841 133
555 3300053134 Ga0500658_0004990 Ga0500658_0004990_4098_4499 133
556 3300053136 Ga0500559_0006557 Ga0500559_0006557_2560_2961 133
557 3300053137 Ga0500561_0015181 Ga0500561_0015181_933_1334 133
558 3300053138 Ga0500564_007037 Ga0500564_007037_1355_1756 133
559 3300053139 Ga0500568_0012540 Ga0500568_0012540_2547_2948 133
560 3300053139 Ga0500568_0105892 Ga0500568_0105892_446_847 133
561 3300053143 Ga0500579_167899 Ga0500579_167899_392_793 133
562 3300053145 Ga0500586_271047 Ga0500586_271047_102_503 133
563 3300053146 Ga0500588_0249054 Ga0500588_0249054_13_414 133
564 3300053151 Ga0500604_0001163 Ga0500604_0001163_4350_4751 133
565 3300053153 Ga0500616_0042049 Ga0500616_0042049_338_739 133
566 3300053157 Ga0500624_004208 Ga0500624_004208_246_647 133
567 3300053158 Ga0500627_0243121 Ga0500627_0243121_120_527 133
568 3300053161 Ga0500634_0017832 Ga0500634_0017832_1094_1495 133
569 3300053162 Ga0500638_008414 Ga0500638_008414_2145_2546 133
570 3300053177 Ga0500636_0000128 Ga0500636_0000128_23405_23806 133
571 3300053177 Ga0500636_0169461 Ga0500636_0169461_25_426 133
572 3300053178 Ga0500637_0290456 Ga0500637_0290456_116_517 133
573 3300053729 Ga0500625_034763 Ga0500625_034763_1275_1676 133
574 3300053730 Ga0500645_000214 Ga0500645_000214_27267_27674 133
575 3300053730 Ga0500645_002912 Ga0500645_002912_1789_2196 133
576 3300055283 Ga0500661_038375 Ga0500661_038375_386_793 133

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

33

132

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2pn2-assembly1.cif.gz_A-2 crystal structure of a putative osmotic stress induced and detoxification response protein (psyc_0566) from psychrobacter arcticus 273-4 at 2.15 a resolution 0.8375 1 118
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8176 2 122
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.7979 1 120
2opl-assembly1.cif.gz_A crystal structure of an osmc-like protein (gsu2788) from geobacter sulfurreducens at 1.50 a resolution 0.7977 2 130
1ml8-assembly1.cif.gz_A-2 structural genomics 0.7956 4 122
ID Description Score Start End Superfamily
2egtA02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8595 40 121 3.30.300.20
2pn2A00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8366 1 118 3.30.300.20
1ml8A02 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8366 40 122 3.30.300.20
af_Q55E30_8_160_3.30.300.20 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7994 2 122 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.7987 1 120 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A173J086-F1-model_v4 deleted 0.9831 1 132
AF-A0A3G7X086-F1-model_v4 deleted 0.9807 1 133
AF-A0A2V4TEK2-F1-model_v4 deleted 0.9795 1 132
AF-A0A1U9XYM2-F1-model_v4 deleted 0.9791 2 132
AF-F7NU13-F1-model_v4 Pirin-related protein 0.9775 1 132

Feature Viewer

pLDDT pTM Quality
95.53 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map