metagRoot

F465419

General Info

Members	Datasets	Scaffolds	Average Seq Length
575	334	484	286

Family's Representative Sequence

Representative Sequence	3300036459\|Ga0372808_017912\|Ga0372808_017912_138_995
Length	285
Sequence	MRDRSIAGTPVSAIGLGGMPMSIEGRPDEDRSVRTIHAALDAGVTFIDTADAYHLRAGEVGHNERLIAKGLATYGGDTSHVLIATKGGHLRPGDGTWTVDGSPAHLRQAVEASLRALGVDAIGLYQFHRPDPKVPYAESIGALRELHDAGKVALTGISNATVEQIDLARSILGEGRLASVQNQFSPSFRSSEGELEHCARLGIAFLPWSPFGGSSRAGSLGARHPAFQAVADAHSVSPQQVTLAWMLAKAPVVIPIPGASRPESITDSAQAAELELSTEELARLD

Samples

	Sample ID	Description	Type	Environment
1	2558860280	Kutzneria sp. 744	Isolate	Unclassified
2	2582581313	Streptomyces mirabilis OV308	Isolate	Rhizosphere
3	2582581314	Streptomyces mirabilis YR139	Isolate	Rhizosphere
4	2622736626	Micromonospora rhizosphaerae DSM 45431	Isolate	Rhizosphere
5	2643221567	Phycicoccus sp. Root563	Isolate	Unclassified
6	2643221624	Phycicoccus sp. Root101	Isolate	Unclassified
7	2643221632	Leifsonia sp. Root112D2	Isolate	Unclassified
8	2643221647	Streptomyces sp. Root369	Isolate	Unclassified
9	2643221678	Streptomyces sp. Root1310	Isolate	Unclassified
10	2643221679	Angustibacter sp. Root456	Isolate	Unclassified
11	2643221690	Cellulomonas sp. Root485	Isolate	Unclassified
12	2643221711	Terrabacter sp. Root85	Isolate	Unclassified
13	2643221714	Streptomyces sp. Root264	Isolate	Unclassified
14	2675903058	Actinopolymorpha cephalotaxi CPCC 202808	Isolate	Rhizosphere
15	2728369276	Kineococcus rhizosphaerae DSM 19711	Isolate	Rhizosphere
16	2731639228	Motilibacter peucedani DSM 45328	Isolate	Rhizosphere
17	2738541272	Promicromonospora sp. AC04	Isolate	Unclassified
18	2738543027	Promicromonospora sp. CF082	Isolate	Unclassified
19	2739367654	Promicromonospora sp. YR516	Isolate	Unclassified
20	2751185734	Saccharothrix sp. NRRL B-16314	Isolate	Rhizosphere
21	2751185788	Curtobacterium pusillum AA3	Isolate	Unclassified
22	2758568522	Promicromonospora thailandica SAI-039	Isolate	Unclassified
23	2758568621	Promicromonospora sukumoe SAI-064	Isolate	Unclassified
24	2784132148	Streptomyces sp. E5N91 SAI-083	Isolate	Unclassified
25	2784746768	Streptomyces griseorubiginosus SAI-142	Isolate	Unclassified
26	2786546132	Streptomyces sp. W SAI-097	Isolate	Unclassified
27	2791354901	Actinophytocola xanthii 11-183	Isolate	Rhizosphere
28	2799112218	Motilibacter rhizosphaerae DSM 45622	Isolate	Rhizosphere
29	2808606359	Streptomyces sp. RJA2910	Isolate	Unclassified
30	2808606365	Phycicoccus sp. SLBN-51	Isolate	Unclassified
31	2808606372	Agromyces sp. 23-23	Isolate	Unclassified
32	2808606375	Streptomyces sp. SLBN-31	Isolate	Unclassified
33	2808606394	Promicromonospora sp. C35	Isolate	Unclassified
34	2808606448	Streptomyces sp. 193411	Isolate	Unclassified
35	2808606700	Arthrobacter agilis UMCV2	Isolate	Rhizosphere
36	2811994879	Streptomyces sp. 4-17	Isolate	Unclassified
37	2811994880	Cellulomonas sp. SLBN-39	Isolate	Unclassified
38	2811994882	Terrabacter sp. SLBN-196	Isolate	Unclassified
39	2816332119	Kribbella amoyensis DSM 24683	Isolate	Rhizosphere
40	2818991318	Humibacillus xanthopallidus SLBN-155	Isolate	Unclassified
41	2818991458	Terrabacter sp. 3211	Isolate	Rhizosphere
42	2818991462	Terrabacter sp. 3264	Isolate	Rhizosphere
43	2818991469	Terrabacter lapilli 3265	Isolate	Rhizosphere
44	2827628540	Actinopolymorpha cephalotaxi DSM 45117	Isolate	Rhizosphere
45	2833709550	Microbacterium sp. 3290	Isolate	Rhizosphere
46	2835188231	Isoptericola variabilis JZ7	Isolate	Unclassified
47	2839986021	Cellulosimicrobium cellulans JZ5	Isolate	Unclassified
48	2844841374	Leifsonia soli DSM 23871	Isolate	Rhizosphere
49	2852635781	Streptomyces sp. AK010	Isolate	Rhizosphere
50	2852646457	Microbacterium sp. AK031	Isolate	Rhizosphere
51	2862281513	Streptomyces sp. Act143	Isolate	Rhizosphere
52	2867346516	Streptomyces radicis AZ1-7	Isolate	Unclassified
53	2867428634	Streptomyces sp. RP5T	Isolate	Unclassified
54	2870721527	Saccharothrix ecbatanensis DSM 45486	Isolate	Rhizosphere
55	2877676314	Streptomyces griseorubiginosus 3E-1	Isolate	Unclassified
56	2884994152	Cellulomonas sp. H30R-01	Isolate	Rhizosphere
57	2887443736	Ruania rhizosphaerae LNNU 22110	Isolate	Rhizosphere
58	2891326441	Actinokineospora pegani TRM65233	Isolate	Unclassified
59	2899370129	Amycolatopsis alkalitolerans SYSUP0005	Isolate	Stem Tuber
60	2904430863	Curtobacterium oceanosedimentum 1519	Isolate	Rhizosphere
61	2905926851	Arthrobacter sedimenti MIC A30	Isolate	Rhizosphere
62	2919042368	Curtobacterium sp. 320	Isolate	Rhizosphere
63	2919055335	Leifsonia sp. 1010	Isolate	Rhizosphere
64	2919446982	Phycicoccus sp. 3266	Isolate	Rhizosphere
65	2919468124	Streptomyces sp. 3330	Isolate	Rhizosphere
66	2919523602	Leifsonia shinshuensis 3821	Isolate	Unclassified
67	2928104781	Curtobacterium sp. 1544	Isolate	Rhizosphere
68	2928153084	Leifsonia sp. 563	Isolate	Unclassified
69	2945968032	Microbacterium murale W2I7	Isolate	Rhizosphere
70	2946003308	Arthrobacter agilis W3I6	Isolate	Rhizosphere
71	2946064051	Streptomyces luteogriseus W4I19-1	Isolate	Rhizosphere
72	2947224130	Streptomyces afghaniensis W1I20	Isolate	Rhizosphere
73	2954002825	Streptomyces turgidiscabies W2I16	Isolate	Rhizosphere
74	2954380949	Streptomyces ciscaucasicus W1I15	Isolate	Rhizosphere
75	2954673503	Streptomyces sp. SAI-119	Isolate	Rhizosphere
76	2954682443	Streptomyces sp. SAI-149	Isolate	Rhizosphere
77	2954691527	Streptomyces sp. SAI-127	Isolate	Rhizosphere
78	2954701450	Streptomyces sp. SAI-144	Isolate	Rhizosphere
79	2954711539	Streptomyces sp. SAI-090	Isolate	Rhizosphere
80	2954721474	Streptomyces sp. SAI-117	Isolate	Rhizosphere
81	2954731030	Streptomyces sp. SAI-133	Isolate	Rhizosphere
82	2954740390	Streptomyces sp. SAI-041	Isolate	Rhizosphere
83	2954749733	Streptomyces sp. SAI-135	Isolate	Rhizosphere
84	2954759201	Streptomyces sp. SAI-208	Isolate	Rhizosphere
85	2964326757	Planctomonas psychrotolerans J5903	Isolate	Rhizosphere
86	2966924647	Frigoribacterium sp. 2355	Isolate	Rhizosphere
87	2984551494	Curtobacterium sp. SORGH_AS776	Isolate	Aerial Root
88	2984592036	Aeromicrobium sp. SORGH_AS981	Isolate	Aerial Root
89	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
90	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
91	3300003203	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
92	3300003285	Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
93	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
94	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
95	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
96	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
97	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
98	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
99	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
100	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
101	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
102	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
103	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
104	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
105	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
106	3300006038	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5	Metagenome	Endosphere
107	3300006042	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3	Metagenome	Endosphere
108	3300006048	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3	Metagenome	Endosphere
109	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
110	3300006178	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2	Metagenome	Endosphere
111	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
112	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
113	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
114	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
115	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
116	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
117	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
118	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
119	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
120	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
121	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
122	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
123	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
124	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
125	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
126	3300015688	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01	Metagenome	Rhizosphere
127	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
128	3300020081	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
129	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
130	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
131	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
132	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
133	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
134	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
135	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
136	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
155	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
159	3300028786	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM	Metagenome	Unclassified
160	3300028794	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM	Metagenome	Unclassified
161	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
162	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
163	3300030522	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM	Metagenome	Unclassified
164	3300030734	Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5	Metagenome	Rhizosphere
165	3300031247	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG	Metagenome	Rhizosphere
166	3300031456	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM	Metagenome	Unclassified
167	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
168	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
169	3300031649	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM	Metagenome	Unclassified
170	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
171	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
172	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
173	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
174	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
175	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
176	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
177	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
178	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
179	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
180	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
181	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
182	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
183	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
184	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
185	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
186	3300033529	Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
187	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
188	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
189	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
190	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
191	3300036459	Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome)	Metatranscriptome	Unclassified
192	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
193	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
194	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
195	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
196	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
197	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
198	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
199	3300041413	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839	Metagenome	Rhizosphere
200	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
201	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
202	3300041494	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG	Metagenome	Unclassified
203	3300041496	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG	Metagenome	Unclassified
204	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
205	3300041999	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297	Metagenome	Rhizosphere
206	3300042002	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616	Metagenome	Rhizosphere
207	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
208	3300042007	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290	Metagenome	Rhizosphere
209	3300042012	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213	Metagenome	Rhizosphere
210	3300042014	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275	Metagenome	Rhizosphere
211	3300042138	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379	Metagenome	Rhizosphere
212	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
213	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
214	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
215	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
216	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
217	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
218	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
219	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
220	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
221	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
222	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
223	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
224	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
225	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
226	3300046453	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere	Metagenome	Rhizosphere
227	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
228	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
229	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
230	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
231	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
232	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
233	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
234	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
235	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
236	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
237	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
238	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
239	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
240	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
241	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
242	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
243	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
244	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
245	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
246	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
247	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
248	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
249	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
250	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
251	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
252	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
253	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
254	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
255	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
256	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
257	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
258	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
259	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
260	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
261	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
262	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
263	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
264	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
265	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
266	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
267	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
268	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
269	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
270	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
271	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
272	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
273	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
274	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
275	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
276	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
277	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
278	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
279	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
280	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
281	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
282	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
283	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
284	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
285	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
286	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
287	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
288	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
289	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
290	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
291	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
292	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
293	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
294	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
295	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
296	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
297	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
298	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
299	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
300	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
301	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
302	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
303	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
304	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
305	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
306	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
307	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
308	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
309	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
310	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
311	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
312	3300050490	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation	Metagenome	Endosphere
313	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
314	3300050495	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation	Metagenome	Endosphere
315	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
316	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
317	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
318	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
319	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
320	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
321	3300053092	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere	Metagenome	Endosphere
322	3300053095	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere	Metagenome	Endosphere
323	3300053107	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere	Metagenome	Endosphere
324	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
325	3300053123	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere	Metagenome	Endosphere
326	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
327	3300053157	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere	Metagenome	Endosphere
328	3300053159	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere	Metagenome	Endosphere
329	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
330	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
331	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
332	8023623736	Streptomyces sp. 111WW2	Isolate	Unclassified
333	8056579771	Promicromonospora iranensis UTMC 00792	Isolate	Rhizosphere
334	8056829672	Streptomyces barringtoniae JA03	Isolate	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	82.61
Metatranscriptomes	1.57
Isolates	15.83

Biome Distribution

Category	Percentage (%)
Aerial Root	0.35
Bulb	0
Endosphere	4.52
Nodule	0
Rhizoplane	9.74
Rhizosphere	66.96
Stem	0
Stem Tuber	0.17
Unclassified	18.26

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24739J22299_10067448	3300001989	Bacteria	1118
2	JGI24735J21928_10041767	3300002067	Bacteria	1336
3	JGI24735J21928_10057631	3300002067	Bacteria	1118
4	JGI25406J46586_10028762	3300003203	Bacteria	2113
5	Ga0007423J48922_100876	3300003285	Bacteria	2092
6	Ga0006562J51391_1070716	3300003578	Bacteria	2706
7	Ga0006562J51391_1080470	3300003578	Bacteria	7730
8	Ga0006562J51391_1080471	3300003578	Bacteria	7370
9	Ga0070658_10001069	3300005327	Bacteria	23399
10	Ga0070658_10494362	3300005327	Bacteria	1056
11	Ga0070683_100178621	3300005329	Bacteria	2015
12	Ga0070660_100036397	3300005339	Bacteria	3728
13	Ga0070668_100033382	3300005347	Bacteria	3919
14	Ga0070714_100014410	3300005435	Bacteria	6352
15	Ga0070711_100018593	3300005439	Bacteria	4441
16	Ga0070695_100140312	3300005545	Bacteria	1675
17	Ga0068855_100198036	3300005563	Bacteria	2262
18	Ga0068856_100330591	3300005614	Bacteria	1542
19	Ga0068863_100255095	3300005841	Bacteria	1695
20	Ga0081455_10046204	3300005937	Bacteria	3780
21	Ga0081455_10101709	3300005937	Bacteria	2306
22	Ga0081455_10234115	3300005937	Bacteria	1353
23	Ga0081539_10000456	3300005985	Bacteria	86722
24	Ga0081539_10003079	3300005985	Bacteria	21456
25	Ga0081539_10005632	3300005985	Bacteria	12600
26	Ga0075365_10069339	3300006038	Bacteria	2370
27	Ga0075368_10021760	3300006042	Bacteria	2437
28	Ga0075363_100002996	3300006048	Bacteria	7061
29	Ga0070712_100181839	3300006175	Bacteria	1639
30	Ga0075367_10002772	3300006178	Bacteria	8117
31	Ga0105245_10017944	3300009098	Bacteria	6179
32	Ga0114129_10449254	3300009147	Bacteria	1691
33	Ga0105243_10017865	3300009148	Bacteria	5365
34	Ga0105243_10069913	3300009148	Bacteria	2833
35	Ga0105242_10329406	3300009176	Bacteria	1403
36	Ga0105248_10589212	3300009177	Bacteria	1255
37	Ga0105238_10571583	3300009551	Bacteria	1136
38	Ga0105238_10605235	3300009551	Bacteria	1104
39	Ga0105239_10217419	3300010375	Bacteria	2142
40	Ga0157370_10452020	3300013104	Bacteria	1181
41	Ga0157370_10504841	3300013104	Bacteria	1110
42	Ga0157369_10021585	3300013105	Bacteria	7201
43	Ga0157369_10053529	3300013105	Bacteria	4361
44	Ga0157369_10314206	3300013105	Bacteria	1629
45	Ga0157369_10326303	3300013105	Bacteria	1595
46	Ga0163162_10110914	3300013306	Bacteria	2840
47	Ga0157372_10013448	3300013307	Bacteria	8744
48	Ga0157372_10023430	3300013307	Bacteria	6692
49	Ga0157372_10199728	3300013307	Bacteria	2316
50	Ga0157375_10040361	3300013308	Bacteria	4498
51	Ga0157375_10118289	3300013308	Bacteria	2756
52	Ga0157375_10178440	3300013308	Bacteria	2275
53	Ga0157380_10022259	3300014326	Bacteria	4767
54	Ga0182008_10000508	3300014497	Bacteria	29268
55	Ga0157376_10005448	3300014969	Bacteria	8897
56	Ga0183367_1004	3300015688	Bacteria	716880
57	Ga0163161_10048684	3300017792	Bacteria	3061
58	Ga0163161_10125936	3300017792	Bacteria	1929
59	Ga0163161_10261295	3300017792	Bacteria	1352
60	Ga0163161_10444033	3300017792	Bacteria	1047
61	Ga0206354_10375450	3300020081	Bacteria	1247
62	Ga0206353_11675873	3300020082	Bacteria	1595
63	Ga0224712_10003789	3300022467	Bacteria	3986
64	Ga0209566_100013	3300025225	Bacteria	474033
65	Ga0209674_100001	3300025226	Bacteria	4013750
66	Ga0209563_100001	3300025230	Bacteria	4013775
67	Ga0209563_100196	3300025230	Bacteria	33198
68	Ga0209677_100001	3300025253	Bacteria	4013787
69	Ga0209677_100631	3300025253	Bacteria	18838
70	Ga0209758_1002460	3300025297	Bacteria	18871
71	Ga0207692_10297295	3300025898	Bacteria	981
72	Ga0207647_10003533	3300025904	Bacteria	11727
73	Ga0207647_10027197	3300025904	Bacteria	3732
74	Ga0207705_10000001	3300025909	Bacteria	2061880
75	Ga0207705_10078184	3300025909	Bacteria	2407
76	Ga0207654_10163808	3300025911	Bacteria	1439
77	Ga0207695_10000951	3300025913	Bacteria	51574
78	Ga0207671_10000182	3300025914	Bacteria	96156
79	Ga0207693_10443919	3300025915	Bacteria	1014
80	Ga0207663_10278783	3300025916	Bacteria	1241
81	Ga0207657_10213315	3300025919	Bacteria	1548
82	Ga0207694_10001573	3300025924	Bacteria	19328
83	Ga0207664_10031055	3300025929	Bacteria	4084
84	Ga0207709_10418984	3300025935	Bacteria	1028
85	Ga0207704_10117793	3300025938	Bacteria	1810
86	Ga0207667_10105578	3300025949	Bacteria	2906
87	Ga0207668_10024122	3300025972	Bacteria	3921
88	Ga0207640_10010692	3300025981	Bacteria	5177
89	Ga0207639_10193800	3300026041	Bacteria	1738
90	Ga0207678_10041951	3300026067	Bacteria	3966
91	Ga0207678_10125628	3300026067	Bacteria	2188
92	Ga0207678_10229840	3300026067	Bacteria	1588
93	Ga0207678_10281907	3300026067	Bacteria	1426
94	Ga0207678_10490170	3300026067	Bacteria	1071
95	Ga0207708_10502299	3300026075	Bacteria	1017
96	Ga0207702_10028046	3300026078	Bacteria	4678
97	Ga0207674_10345738	3300026116	Bacteria	1438
98	Ga0207683_10013342	3300026121	Bacteria	7007
99	Ga0207683_10196502	3300026121	Bacteria	1833
100	Ga0207698_10012344	3300026142	Bacteria	5587
101	Ga0207698_10422032	3300026142	Bacteria	1280
102	Ga0307517_10023329	3300028786	Bacteria	7696
103	Ga0307515_10000050	3300028794	Bacteria	275624
104	Ga0307515_10267852	3300028794	Bacteria	1434
105	Ga0268256_1036463	3300030500	Bacteria	1134
106	Ga0307511_10001277	3300030521	Bacteria	26678
107	Ga0307512_10000766	3300030522	Bacteria	47681
108	Ga0307512_10023379	3300030522	Bacteria	5520
109	Ga0307512_10025255	3300030522	Bacteria	5269
110	Ga0307512_10179017	3300030522	Bacteria	1196
111	Ga0316179_1012522	3300030734	Bacteria	2800
112	Ga0265340_10013411	3300031247	Bacteria	4302
113	Ga0307513_10000248	3300031456	Bacteria	78312
114	Ga0307513_10003014	3300031456	Bacteria	22977
115	Ga0307513_10008986	3300031456	Bacteria	12678
116	Ga0307513_10026185	3300031456	Bacteria	6731
117	Ga0307513_10128838	3300031456	Bacteria	2480
118	Ga0307513_10157434	3300031456	Bacteria	2169
119	Ga0307513_10160786	3300031456	Bacteria	2139
120	Ga0307509_10066709	3300031507	Bacteria	3774
121	Ga0307509_10078928	3300031507	Bacteria	3409
122	Ga0307509_10086369	3300031507	Bacteria	3226
123	Ga0307508_10007757	3300031616	Bacteria	9972
124	Ga0307508_10007850	3300031616	Bacteria	9907
125	Ga0307508_10017255	3300031616	Bacteria	6562
126	Ga0307514_10002314	3300031649	Bacteria	20060
127	Ga0307514_10051462	3300031649	Bacteria	3191
128	Ga0307514_10100970	3300031649	Bacteria	2071
129	Ga0316575_10000006	3300031665	Bacteria	85686
130	Ga0316575_10002734	3300031665	Bacteria	5953
131	Ga0316579_10002384	3300031691	Bacteria	7088
132	Ga0316578_10050201	3300031728	Bacteria	2440
133	Ga0307516_10002791	3300031730	Bacteria	23053
134	Ga0307516_10003999	3300031730	Bacteria	18498
135	Ga0307405_10000708	3300031731	Bacteria	12920
136	Ga0307405_10229322	3300031731	Bacteria	1368
137	Ga0307413_10070729	3300031824	Bacteria	2196
138	Ga0307518_10083130	3300031838	Bacteria	2310
139	Ga0307518_10090270	3300031838	Bacteria	2205
140	Ga0307518_10126131	3300031838	Bacteria	1805
141	Ga0307410_10004486	3300031852	Bacteria	7228
142	Ga0307410_10032631	3300031852	Bacteria	3354
143	Ga0307406_10027142	3300031901	Bacteria	3447
144	Ga0307406_10071947	3300031901	Bacteria	2268
145	Ga0307407_10125095	3300031903	Bacteria	1636
146	Ga0307409_100000227	3300031995	Bacteria	22616
147	Ga0307409_100070571	3300031995	Bacteria	2773
148	Ga0307416_100011839	3300032002	Bacteria	5845
149	Ga0307416_100321344	3300032002	Bacteria	1550
150	Ga0307415_100000037	3300032126	Bacteria	57345
151	Ga0307415_100087634	3300032126	Bacteria	2244
152	Ga0307415_100425640	3300032126	Bacteria	1141
153	Ga0316585_10012482	3300032137	Bacteria	2518
154	Ga0307507_10021507	3300033179	Bacteria	7176
155	Ga0307507_10025919	3300033179	Bacteria	6338
156	Ga0307510_10001630	3300033180	Bacteria	24885
157	Ga0316587_1010315	3300033529	Bacteria	1493
158	Ga0373951_0000158	3300035091	Bacteria	24721
159	Ga0373956_0023290	3300035119	Bacteria	2656
160	Ga0373962_0000454	3300035242	Bacteria	9007
161	Ga0316574_0013717	3300035398	Bacteria	4665
162	Ga0372808_017912	3300036459	Bacteria	1017
163	Ga0316582_0000615	3300036647	Bacteria	13869
164	Ga0316582_0213500	3300036647	Bacteria	1319
165	Ga0316584_0060211	3300036712	Bacteria	2843
166	Ga0395899_0017732	3300037312	Bacteria	5421
167	Ga0395899_0021314	3300037312	Bacteria	4916
168	Ga0395900_0040168	3300037418	Bacteria	4821
169	Ga0395900_0056932	3300037418	Bacteria	4024
170	Ga0395900_0333200	3300037418	Bacteria	1495
171	Ga0395898_0000158	3300037466	Bacteria	172981
172	Ga0395898_0001167	3300037466	Bacteria	40110
173	Ga0395898_0004472	3300037466	Bacteria	15283
174	Ga0395898_0085383	3300037466	Bacteria	3042
175	Ga0395898_0295287	3300037466	Bacteria	1546
176	Ga0395901_0008340	3300038443	Bacteria	10472
177	Ga0395901_0066951	3300038443	Bacteria	3741
178	Ga0395901_0126573	3300038443	Bacteria	2685
179	Ga0439436_0002600	3300041404	Bacteria	5433
180	Ga0439465_0099900	3300041413	Bacteria	1001
181	Ga0451791_1372276	3300041451	Bacteria	2340
182	Ga0451793_0161858	3300041452	Bacteria	2213
183	Ga0451793_1069513	3300041452	Bacteria	3349
184	Ga0451837_0746329	3300041494	Bacteria	1411
185	Ga0451839_1296375	3300041496	Bacteria	1646
186	Ga0451853_1234429	3300041512	Bacteria	1624
187	Ga0451853_3393842	3300041512	Bacteria	1509
188	Ga0439433_0006710	3300041999	Bacteria	2479
189	Ga0439442_018724	3300042002	Bacteria	1432
190	Ga0439448_0025876	3300042005	Bacteria	1842
191	Ga0439449_0006879	3300042007	Bacteria	4335
192	Ga0439449_0029766	3300042007	Bacteria	2034
193	Ga0439449_0063600	3300042007	Bacteria	1361
194	Ga0439455_0033911	3300042012	Bacteria	1282
195	Ga0439457_035592	3300042014	Bacteria	1107
196	Ga0450903_000063	3300042138	Bacteria	21886
197	Ga0466969_0007032	3300044656	Bacteria	5981
198	Ga0466972_0011615	3300044658	Bacteria	4422
199	Ga0466972_0018856	3300044658	Bacteria	3448
200	Ga0466972_0089977	3300044658	Bacteria	1456
201	Ga0466972_0177100	3300044658	Bacteria	1000
202	Ga0466965_0017992	3300044683	Bacteria	3382
203	Ga0466965_0070448	3300044683	Bacteria	1757
204	Ga0466965_0106993	3300044683	Bacteria	1435
205	Ga0466966_0015406	3300044684	Bacteria	5055
206	Ga0466966_0028704	3300044684	Bacteria	3621
207	Ga0466966_0034716	3300044684	Bacteria	3260
208	Ga0466966_0125244	3300044684	Bacteria	1576
209	Ga0466961_0007204	3300044693	Bacteria	7073
210	Ga0466961_0034666	3300044693	Bacteria	3240
211	Ga0466961_0071458	3300044693	Bacteria	2202
212	Ga0466961_0134607	3300044693	Bacteria	1548
213	Ga0466961_0235349	3300044693	Bacteria	1126
214	Ga0466963_0000550	3300044694	Bacteria	17615
215	Ga0466971_0000378	3300044719	Bacteria	17084
216	Ga0466971_0046875	3300044719	Bacteria	1942
217	Ga0466968_0026898	3300044735	Bacteria	2365
218	Ga0466968_0029741	3300044735	Bacteria	2260
219	Ga0466968_0160351	3300044735	Bacteria	1038
220	Ga0466970_0004128	3300044765	Bacteria	7141
221	Ga0466970_0005703	3300044765	Bacteria	6182
222	Ga0466970_0083567	3300044765	Bacteria	1728
223	Ga0466970_0150225	3300044765	Bacteria	1286
224	Ga0466970_0288659	3300044765	Bacteria	923
225	Ga0466957_0027506	3300044842	Bacteria	3381
226	Ga0466957_0055835	3300044842	Bacteria	2414
227	Ga0466957_0085994	3300044842	Bacteria	1965
228	Ga0466957_0138806	3300044842	Bacteria	1564
229	Ga0466957_0140359	3300044842	Bacteria	1556
230	Ga0466957_0161434	3300044842	Bacteria	1456
231	Ga0466957_0309763	3300044842	Bacteria	1063
232	Ga0466960_0051499	3300044901	Bacteria	1989
233	Ga0466960_0063546	3300044901	Bacteria	1817
234	Ga0466960_0075347	3300044901	Bacteria	1688
235	Ga0466960_0084527	3300044901	Bacteria	1606
236	Ga0466959_0014765	3300045049	Bacteria	5685
237	Ga0466959_0035882	3300045049	Bacteria	3663
238	Ga0466959_0082155	3300045049	Bacteria	2321
239	Ga0466958_0062091	3300045836	Bacteria	2277
240	Ga0466967_0050374	3300045976	Bacteria	3646
241	Ga0466967_0230550	3300045976	Bacteria	1763
242	Ga0495627_023001	3300046453	Bacteria	2046
243	Ga0495592_0039453	3300046454	Bacteria	3547
244	Ga0495592_0117069	3300046454	Bacteria	1879
245	Ga0495603_0129292	3300046455	Bacteria	1471
246	Ga0495629_0007501	3300046459	Bacteria	8041
247	Ga0495629_0162508	3300046459	Bacteria	1551
248	Ga0495651_0030923	3300046462	Bacteria	4175
249	Ga0495651_0056860	3300046462	Bacteria	3004
250	Ga0495662_0004559	3300046476	Bacteria	6950
251	Ga0495664_0003281	3300046477	Bacteria	8797
252	Ga0495594_0059145	3300046499	Bacteria	2119
253	Ga0495608_0101492	3300046511	Bacteria	1855
254	Ga0495618_0134756	3300046514	Bacteria	1580
255	Ga0495628_0023656	3300046516	Bacteria	5040
256	Ga0495628_0060196	3300046516	Bacteria	2980
257	Ga0495666_0029104	3300046526	Bacteria	2718
258	Ga0495652_0129647	3300046529	Bacteria	1998
259	Ga0495652_0319401	3300046529	Bacteria	1122
260	Ga0495640_0192531	3300046533	Bacteria	1295
261	Ga0495609_0133032	3300046538	Bacteria	1064
262	Ga0495645_0007300	3300046543	Bacteria	7688
263	Ga0495645_0010625	3300046543	Bacteria	6463
264	Ga0495622_0044213	3300046557	Bacteria	2070
265	Ga0495667_0167267	3300046559	Bacteria	1413
266	Ga0495634_0014054	3300046642	Bacteria	5780
267	Ga0495634_0040295	3300046642	Bacteria	3177
268	Ga0495625_0023464	3300046660	Bacteria	4712
269	Ga0495625_0213680	3300046660	Bacteria	1267
270	Ga0495635_0002671	3300046663	Bacteria	12184
271	Ga0495657_0001323	3300046675	Bacteria	21588
272	Ga0495657_0167095	3300046675	Bacteria	1357
273	Ga0495646_0008081	3300046680	Bacteria	6687
274	Ga0495658_0391758	3300046683	Bacteria	885
275	Ga0495613_0017614	3300046689	Bacteria	5319
276	Ga0495613_0045361	3300046689	Bacteria	3251
277	Ga0495613_0141313	3300046689	Bacteria	1720
278	Ga0495671_0016300	3300046692	Bacteria	3969
279	Ga0495649_0064097	3300046694	Bacteria	1974
280	Ga0495600_0036102	3300046809	Bacteria	3211
281	Ga0495600_0352014	3300046809	Bacteria	922
282	Ga0495581_0001816	3300047315	Bacteria	11947
283	Ga0495604_0016530	3300047317	Bacteria	5898
284	Ga0495674_0438412	3300047319	Bacteria	1051
285	Ga0495676_0013352	3300047321	Bacteria	7378
286	Ga0495687_014833	3300047443	Bacteria	3986
287	Ga0495675_0029975	3300047444	Bacteria	3471
288	Ga0495681_0006924	3300047470	Bacteria	7351
289	Ga0495686_0082634	3300047472	Bacteria	1960
290	Ga0495593_0032345	3300047673	Bacteria	2853
291	Ga0495593_0160666	3300047673	Bacteria	1134
292	Ga0495614_0046765	3300048089	Bacteria	1855
293	Ga0496100_0000514	3300048903	Bacteria	18599
294	Ga0496100_0017473	3300048903	Bacteria	4234
295	Ga0496100_0099681	3300048903	Bacteria	1999
296	Ga0496101_0003079	3300048904	Bacteria	10311
297	Ga0496101_0021740	3300048904	Bacteria	4410
298	Ga0496101_0130610	3300048904	Bacteria	1907
299	Ga0496102_0014925	3300048905	Bacteria	6759
300	Ga0496102_0018297	3300048905	Bacteria	6156
301	Ga0496102_0210903	3300048905	Bacteria	1831
302	Ga0496102_0229806	3300048905	Bacteria	1749
303	Ga0496102_0411022	3300048905	Bacteria	1271
304	Ga0496103_0001872	3300048906	Bacteria	13673
305	Ga0496104_0014064	3300048907	Bacteria	7224
306	Ga0496104_0035363	3300048907	Bacteria	4664
307	Ga0496104_0044538	3300048907	Bacteria	4169
308	Ga0496104_0101146	3300048907	Bacteria	2759
309	Ga0496104_0247800	3300048907	Bacteria	1694
310	Ga0496104_0322765	3300048907	Bacteria	1457
311	Ga0496104_0513751	3300048907	Bacteria	1109
312	Ga0496105_0039684	3300048908	Bacteria	3881
313	Ga0496105_0048165	3300048908	Bacteria	3518
314	Ga0496105_0056937	3300048908	Bacteria	3227
315	Ga0496105_0072219	3300048908	Bacteria	2852
316	Ga0496106_0411601	3300048909	Bacteria	1087
317	Ga0496107_0314799	3300048910	Bacteria	1165
318	Ga0496108_0005697	3300048911	Bacteria	10084
319	Ga0496108_0028416	3300048911	Bacteria	4627
320	Ga0496108_0399934	3300048911	Bacteria	1200
321	Ga0496109_0019181	3300048912	Bacteria	6023
322	Ga0496109_0049657	3300048912	Bacteria	3820
323	Ga0496109_0063133	3300048912	Bacteria	3388
324	Ga0496109_0350756	3300048912	Bacteria	1394
325	Ga0496110_0003436	3300048913	Bacteria	12122
326	Ga0496111_0026483	3300048914	Bacteria	4096
327	Ga0496111_0032909	3300048914	Bacteria	3696
328	Ga0496111_0092921	3300048914	Bacteria	2212
329	Ga0496111_0157928	3300048914	Bacteria	1683
330	Ga0496111_0376635	3300048914	Bacteria	1050
331	Ga0496111_0457824	3300048914	Bacteria	941
332	Ga0496111_0482337	3300048914	Bacteria	913
333	Ga0496113_0009522	3300048916	Bacteria	6372
334	Ga0496113_0043524	3300048916	Bacteria	3323
335	Ga0496113_0053609	3300048916	Bacteria	3016
336	Ga0496113_0136835	3300048916	Bacteria	1925
337	Ga0496113_0168766	3300048916	Bacteria	1733
338	Ga0496114_0007323	3300048917	Bacteria	8716
339	Ga0496114_0007758	3300048917	Bacteria	8490
340	Ga0496114_0020117	3300048917	Bacteria	5415
341	Ga0496114_0030311	3300048917	Bacteria	4451
342	Ga0496114_0038735	3300048917	Bacteria	3944
343	Ga0496114_0048943	3300048917	Bacteria	3516
344	Ga0496114_0113803	3300048917	Bacteria	2320
345	Ga0496115_0192910	3300048918	Bacteria	1683
346	Ga0496117_0000817	3300048920	Bacteria	48233
347	Ga0496117_0001079	3300048920	Bacteria	41309
348	Ga0496117_0030576	3300048920	Bacteria	4129
349	Ga0496117_0040355	3300048920	Bacteria	3433
350	Ga0496118_0000398	3300048921	Bacteria	73344
351	Ga0496118_0058143	3300048921	Bacteria	2892
352	Ga0496118_0092219	3300048921	Bacteria	2079
353	Ga0496119_0001127	3300048922	Bacteria	33655
354	Ga0496119_0003864	3300048922	Bacteria	15293
355	Ga0496119_0031481	3300048922	Bacteria	3557
356	Ga0496119_0036246	3300048922	Bacteria	3222
357	Ga0496120_0006921	3300048923	Bacteria	8556
358	Ga0496120_0045819	3300048923	Bacteria	2531
359	Ga0496120_0133932	3300048923	Bacteria	1266
360	Ga0496121_0000098	3300048924	Bacteria	200516
361	Ga0496122_0000986	3300048925	Bacteria	50817
362	Ga0496122_0039270	3300048925	Bacteria	3777
363	Ga0496122_0068287	3300048925	Bacteria	2553
364	Ga0496122_0293910	3300048925	Bacteria	880
365	Ga0496123_0000241	3300048926	Bacteria	110078
366	Ga0496124_0000198	3300048927	Bacteria	119277
367	Ga0496124_0011643	3300048927	Bacteria	8778
368	Ga0496124_0058889	3300048927	Bacteria	3228
369	Ga0496125_0011970	3300048928	Bacteria	8639
370	Ga0496126_0012959	3300048929	Bacteria	8512
371	Ga0496126_0088562	3300048929	Bacteria	2726
372	Ga0496126_0262247	3300048929	Bacteria	1436
373	Ga0501031_0004315	3300049568	Bacteria	9198
374	Ga0501031_0005083	3300049568	Bacteria	8560
375	Ga0501031_0247191	3300049568	Bacteria	1159
376	Ga0501032_0007610	3300049569	Bacteria	7902
377	Ga0501032_0008485	3300049569	Bacteria	7492
378	Ga0501032_0069069	3300049569	Bacteria	2358
379	Ga0501032_0102233	3300049569	Bacteria	1899
380	Ga0501032_0197533	3300049569	Bacteria	1313
381	Ga0501033_0008690	3300049570	Bacteria	7855
382	Ga0501033_0030292	3300049570	Bacteria	4066
383	Ga0501033_0259744	3300049570	Bacteria	1229
384	Ga0501033_0393458	3300049570	Bacteria	967
385	Ga0501034_0001652	3300049571	Bacteria	28812
386	Ga0501034_0006925	3300049571	Bacteria	12115
387	Ga0501034_0013131	3300049571	Bacteria	8535
388	Ga0501034_0029956	3300049571	Bacteria	5532
389	Ga0501034_0054912	3300049571	Bacteria	4009
390	Ga0501034_0117782	3300049571	Bacteria	2643
391	Ga0501034_0207504	3300049571	Bacteria	1915
392	Ga0501034_0353780	3300049571	Bacteria	1397
393	Ga0501036_0016996	3300049572	Bacteria	6079
394	Ga0501036_0019899	3300049572	Bacteria	5635
395	Ga0501036_0049156	3300049572	Bacteria	3571
396	Ga0501036_0192827	3300049572	Bacteria	1714
397	Ga0501036_0491342	3300049572	Bacteria	1021
398	Ga0501037_0004829	3300049573	Bacteria	9803
399	Ga0501037_0083908	3300049573	Bacteria	2308
400	Ga0501037_0090541	3300049573	Bacteria	2212
401	Ga0501037_0098719	3300049573	Bacteria	2109
402	Ga0501038_0002173	3300049574	Bacteria	18217
403	Ga0501038_0017060	3300049574	Bacteria	6567
404	Ga0501038_0094221	3300049574	Bacteria	2503
405	Ga0501038_0128885	3300049574	Bacteria	2079
406	Ga0501039_0025886	3300049575	Bacteria	4511
407	Ga0501039_0131045	3300049575	Bacteria	1968
408	Ga0501040_0394848	3300049576	Bacteria	993
409	Ga0501042_0128373	3300049578	Bacteria	1826
410	Ga0501043_0003907	3300049579	Bacteria	12231
411	Ga0501043_0022262	3300049579	Bacteria	4972
412	Ga0501043_0054320	3300049579	Bacteria	3145
413	Ga0501043_0147976	3300049579	Bacteria	1838
414	Ga0501046_0018783	3300049580	Bacteria	5743
415	Ga0501046_0132815	3300049580	Bacteria	1887
416	Ga0501046_0150138	3300049580	Bacteria	1758
417	Ga0501046_0211950	3300049580	Bacteria	1438
418	Ga0501047_0004225	3300049581	Bacteria	13520
419	Ga0501047_0011290	3300049581	Bacteria	8455
420	Ga0501047_0023745	3300049581	Bacteria	5886
421	Ga0501047_0024512	3300049581	Bacteria	5789
422	Ga0501047_0033087	3300049581	Bacteria	4992
423	Ga0501047_0058158	3300049581	Bacteria	3735
424	Ga0501047_0158075	3300049581	Bacteria	2139
425	Ga0501047_0300570	3300049581	Bacteria	1447
426	Ga0501047_0366225	3300049581	Bacteria	1276
427	Ga0501048_0002403	3300049582	Bacteria	14285
428	Ga0501048_0011583	3300049582	Bacteria	6575
429	Ga0501048_0112078	3300049582	Bacteria	1926
430	Ga0501048_0129436	3300049582	Bacteria	1785
431	Ga0501048_0294870	3300049582	Bacteria	1153
432	Ga0501048_0296198	3300049582	Bacteria	1151
433	Ga0501067_0196640	3300049583	Bacteria	1123
434	Ga0501069_0182833	3300049585	Bacteria	1212
435	Ga0501070_0179514	3300049586	Bacteria	1743
436	Ga0501073_0045892	3300049589	Bacteria	3076
437	Ga0501073_0187956	3300049589	Bacteria	1429
438	Ga0501073_0230299	3300049589	Bacteria	1280
439	Ga0501074_0003014	3300049590	Bacteria	11859
440	Ga0501080_0253916	3300049742	Bacteria	1603
441	Ga0501080_0770398	3300049742	Bacteria	845
442	Ga0501035_0023049	3300049822	Bacteria	5714
443	Ga0501035_0051996	3300049822	Bacteria	3666
444	Ga0501035_0074566	3300049822	Bacteria	3001
445	Ga0501035_0075602	3300049822	Bacteria	2979
446	Ga0501035_0243630	3300049822	Bacteria	1528
447	Ga0501044_0003663	3300049823	Bacteria	17288
448	Ga0501044_0004841	3300049823	Bacteria	15054
449	Ga0501044_0010781	3300049823	Bacteria	9918
450	Ga0501044_0016398	3300049823	Bacteria	7954
451	Ga0501044_0033431	3300049823	Bacteria	5405
452	Ga0501044_0051917	3300049823	Bacteria	4227
453	Ga0501044_0163148	3300049823	Bacteria	2203
454	Ga0501044_0183046	3300049823	Bacteria	2061
455	Ga0501044_0565271	3300049823	Bacteria	1033
456	Ga0501045_0227324	3300049824	Bacteria	1389
457	Ga0501045_0387723	3300049824	Bacteria	1040
458	Ga0501045_0506169	3300049824	Bacteria	897
459	nmdc:mga03n38_992_c1	3300050490	Bacteria	7753
460	nmdc:mga06z11_146314_c1	3300050494	Bacteria	1339
461	nmdc:mga04h51_36510_c1	3300050495	Bacteria	1581
462	nmdc:mga05p37_366794_c1	3300050507	Bacteria	1691
463	nmdc:mga08y16_338671_c1	3300050511	Bacteria	1546
464	Ga0495601_0097564	3300053077	Bacteria	1896
465	Ga0495612_0004782	3300053078	Bacteria	5608
466	Ga0495655_0026919	3300053083	Bacteria	1359
467	Ga0495655_0030622	3300053083	Bacteria	1303
468	Ga0495619_0207973	3300053085	Bacteria	1355
469	Ga0500583_0062543	3300053092	Bacteria	1761
470	Ga0500583_0105686	3300053092	Bacteria	1383
471	Ga0500640_022259	3300053095	Bacteria	2738
472	Ga0500560_000230	3300053107	Bacteria	6860
473	Ga0500572_024892	3300053111	Bacteria	1619
474	Ga0500614_013456	3300053123	Bacteria	1798
475	Ga0500573_0028163	3300053140	Bacteria	3235
476	Ga0500573_0037084	3300053140	Bacteria	2816
477	Ga0500573_0210063	3300053140	Bacteria	1028
478	Ga0500624_003511	3300053157	Bacteria	2056
479	Ga0500630_122251	3300053159	Bacteria	1151
480	Ga0500645_010922	3300053730	Bacteria	2984
481	Ga0501082_0005373	3300060353	Bacteria	11114
482	Ga0501082_0017026	3300060353	Bacteria	6260
483	Ga0466962_0015084	3300061719	Bacteria	3726
484	Ga0466962_0080813	3300061719	Bacteria	1554

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025253	Ga0209677_100631	Ga0209677_1006313	245
2	3300046809	Ga0495600_0352014	Ga0495600_0352014_27_791	254
3	3300005545	Ga0070695_100140312	Ga0070695_1001403122	257
4	3300048911	Ga0496108_0399934	Ga0496108_0399934_376_1167	261
5	3300032126	Ga0307415_100425640	Ga0307415_1004256402	264
6	3300009551	Ga0105238_10605235	Ga0105238_106052351	265
7	3300046683	Ga0495658_0391758	Ga0495658_0391758_51_848	265
8	3300013105	Ga0157369_10021585	Ga0157369_100215854	266
9	3300041494	Ga0451837_0746329	Ga0451837_0746329_570_1370	266
10	3300044658	Ga0466972_0177100	Ga0466972_0177100_186_986	266
11	3300044765	Ga0466970_0288659	Ga0466970_0288659_112_912	266
12	3300049742	Ga0501080_0770398	Ga0501080_0770398_29_829	266
13	3300030522	Ga0307512_10025255	Ga0307512_100252552	267
14	3300048909	Ga0496106_0411601	Ga0496106_0411601_25_837	267
15	3300048925	Ga0496122_0293910	Ga0496122_0293910_22_840	267
16	3300049571	Ga0501034_0001652	Ga0501034_0001652_3831_4646	267
17	3300049824	Ga0501045_0506169	Ga0501045_0506169_25_828	267
18	3300053092	Ga0500583_0105686	Ga0500583_0105686_231_1091	267
19	3300060353	Ga0501082_0005373	Ga0501082_0005373_10194_11009	267
20	3300013104	Ga0157370_10452020	Ga0157370_104520202	268
21	3300044683	Ga0466965_0106993	Ga0466965_0106993_22_828	268
22	3300048923	Ga0496120_0133932	Ga0496120_0133932_424_1230	268
23	3300041413	Ga0439465_0099900	Ga0439465_0099900_123_941	269
24	3300048914	Ga0496111_0482337	Ga0496111_0482337_24_839	269
25	3300031507	Ga0307509_10086369	Ga0307509_100863692	270
26	3300049824	Ga0501045_0387723	Ga0501045_0387723_46_912	276
27	iso_pu_bacteria	2870721527	2870727873	276
28	3300048922	Ga0496119_0003864	Ga0496119_0003864_8654_9487	277
29	iso_pu_bacteria	2891326441	2891330264	277
30	iso_pu_bacteria	2751185734	2753069566	278
31	iso_pu_bacteria	2791354901	2791909814	279
32	iso_pu_bacteria	2643221679	2644447547	280
33	iso_pu_bacteria	2887443736	2887445268	280
34	3300047319	Ga0495674_0438412	Ga0495674_0438412_97_975	281
35	3300048914	Ga0496111_0457824	Ga0496111_0457824_25_909	281
36	3300053159	Ga0500630_122251	Ga0500630_122251_83_928	281
37	iso_pu_bacteria	2582581313	2585303160	281
38	iso_pu_bacteria	2582581314	2585313878	281
39	iso_pu_bacteria	2643221647	2644266895	281
40	iso_pu_bacteria	2784132148	2784592851	281
41	iso_pu_bacteria	2784746768	2785373985	281
42	iso_pu_bacteria	2786546132	2786674229	281
43	iso_pu_bacteria	2808606375	2808915658	281
44	iso_pu_bacteria	2808606448	2809235685	281
45	iso_pu_bacteria	2811994879	2812353760	281
46	iso_pu_bacteria	2833709550	2833712368	281
47	iso_pu_bacteria	2852635781	2852638972	281
48	iso_pu_bacteria	2852646457	2852649663	281
49	iso_pu_bacteria	2862281513	2862285030	281
50	iso_pu_bacteria	2867346516	2867350658	281
51	iso_pu_bacteria	2867428634	2867428938	281
52	iso_pu_bacteria	2877676314	2877677166	281
53	iso_pu_bacteria	2945968032	2945969775	281
54	iso_pu_bacteria	2946064051	2946071937	281
55	iso_pu_bacteria	2947224130	2947232827	281
56	iso_pu_bacteria	2954002825	2954009074	281
57	iso_pu_bacteria	2954380949	2954381874	281
58	iso_pu_bacteria	2954673503	2954681184	281
59	iso_pu_bacteria	2954682443	2954682973	281
60	iso_pu_bacteria	2954691527	2954692698	281
61	iso_pu_bacteria	2954701450	2954707771	281
62	iso_pu_bacteria	2954711539	2954712354	281
63	iso_pu_bacteria	2954721474	2954722300	281
64	iso_pu_bacteria	2954731030	2954739549	281
65	iso_pu_bacteria	2954740390	2954741188	281
66	iso_pu_bacteria	2954749733	2954758376	281
67	iso_pu_bacteria	2954759201	2954760199	281
68	iso_pu_bacteria	2984592036	2984592199	281
69	iso_pu_bacteria	8023623736	8023625296	281
70	iso_pu_bacteria	8056829672	8056837144	281
71	3300009098	Ga0105245_10017944	Ga0105245_100179442	282
72	3300009148	Ga0105243_10017865	Ga0105243_100178654	282
73	3300009176	Ga0105242_10329406	Ga0105242_103294061	282
74	3300013308	Ga0157375_10040361	Ga0157375_100403611	282
75	3300014969	Ga0157376_10005448	Ga0157376_100054486	282
76	3300025938	Ga0207704_10117793	Ga0207704_101177932	282
77	3300026067	Ga0207678_10125628	Ga0207678_101256282	282
78	3300026121	Ga0207683_10013342	Ga0207683_100133422	282
79	3300046455	Ga0495603_0129292	Ga0495603_0129292_540_1424	282
80	3300046459	Ga0495629_0162508	Ga0495629_0162508_197_1081	282
81	3300047673	Ga0495593_0160666	Ga0495593_0160666_71_955	282
82	3300048904	Ga0496101_0021740	Ga0496101_0021740_2034_2918	282
83	3300048905	Ga0496102_0018297	Ga0496102_0018297_3359_4243	282
84	3300048911	Ga0496108_0005697	Ga0496108_0005697_1501_2385	282
85	3300048912	Ga0496109_0019181	Ga0496109_0019181_431_1315	282
86	3300048917	Ga0496114_0020117	Ga0496114_0020117_1475_2359	282
87	iso_pu_bacteria	2558860280	2559428258	282
88	iso_pu_bacteria	2622736626	2623588983	282
89	iso_pu_bacteria	2643221678	2644440502	282
90	iso_pu_bacteria	2643221714	2644630923	282
91	iso_pu_bacteria	2731639228	2731908667	282
92	iso_pu_bacteria	2738541272	2738695388	282
93	iso_pu_bacteria	2738543027	2739324741	282
94	iso_pu_bacteria	2739367654	2739606367	282
95	iso_pu_bacteria	2758568522	2760306824	282
96	iso_pu_bacteria	2758568621	2760624682	282
97	iso_pu_bacteria	2808606359	2808845835	282
98	iso_pu_bacteria	2808606394	2809029594	282
99	iso_pu_bacteria	2811994880	2812363837	282
100	iso_pu_bacteria	2839986021	2839989065	282
101	iso_pu_bacteria	2844841374	2844844524	282
102	iso_pu_bacteria	2899370129	2899372376	282
103	iso_pu_bacteria	2919055335	2919056480	282
104	iso_pu_bacteria	2919468124	2919470706	282
105	iso_pu_bacteria	2919523602	2919526473	282
106	iso_pu_bacteria	2928153084	2928155288	282
107	iso_pu_bacteria	2964326757	2964327122	282
108	iso_pu_bacteria	2966924647	2966924681	282
109	iso_pu_bacteria	8056579771	8056583081	282
110	3300053140	Ga0500573_0210063	Ga0500573_0210063_149_1000	283
111	iso_pu_bacteria	2643221567	2643851908	283
112	iso_pu_bacteria	2643221624	2644136662	283
113	iso_pu_bacteria	2643221632	2644181452	283
114	iso_pu_bacteria	2643221690	2644506038	283
115	iso_pu_bacteria	2643221711	2644611378	283
116	iso_pu_bacteria	2675903058	2676477471	283
117	iso_pu_bacteria	2728369276	2729905868	283
118	iso_pu_bacteria	2751185788	2753303439	283
119	iso_pu_bacteria	2799112218	2799185352	283
120	iso_pu_bacteria	2808606365	2808874059	283
121	iso_pu_bacteria	2808606372	2808903289	283
122	iso_pu_bacteria	2808606700	2810365771	283
123	iso_pu_bacteria	2811994882	2812375534	283
124	iso_pu_bacteria	2818991318	2819424253	283
125	iso_pu_bacteria	2818991458	2819668237	283
126	iso_pu_bacteria	2818991462	2819692075	283
127	iso_pu_bacteria	2818991469	2819729831	283
128	iso_pu_bacteria	2827628540	2827634728	283
129	iso_pu_bacteria	2835188231	2835190096	283
130	iso_pu_bacteria	2884994152	2884997210	283
131	iso_pu_bacteria	2904430863	2904431517	283
132	iso_pu_bacteria	2905926851	2905928793	283
133	iso_pu_bacteria	2919042368	2919043438	283
134	iso_pu_bacteria	2919446982	2919448666	283
135	iso_pu_bacteria	2928104781	2928107001	283
136	iso_pu_bacteria	2946003308	2946006067	283
137	iso_pu_bacteria	2984551494	2984551745	283
138	3300003203	JGI25406J46586_10028762	JGI25406J46586_100287622	284
139	3300005985	Ga0081539_10003079	Ga0081539_1000307914	284
140	3300026075	Ga0207708_10502299	Ga0207708_105022991	284
141	3300026078	Ga0207702_10028046	Ga0207702_100280464	284
142	3300026142	Ga0207698_10422032	Ga0207698_104220322	284
143	3300031731	Ga0307405_10229322	Ga0307405_102293222	284
144	3300035119	Ga0373956_0023290	Ga0373956_0023290_891_1760	284
145	3300035242	Ga0373962_0000454	Ga0373962_0000454_7310_8164	284
146	3300036459	Ga0372808_017912	Ga0372808_017912_138_995	284
147	3300044658	Ga0466972_0089977	Ga0466972_0089977_268_1125	284
148	3300044842	Ga0466957_0085994	Ga0466957_0085994_737_1594	284
149	3300044842	Ga0466957_0309763	Ga0466957_0309763_113_967	284
150	3300044901	Ga0466960_0075347	Ga0466960_0075347_157_1011	284
151	3300048907	Ga0496104_0247800	Ga0496104_0247800_805_1659	284
152	3300048911	Ga0496108_0028416	Ga0496108_0028416_3103_3957	284
153	3300048912	Ga0496109_0049657	Ga0496109_0049657_755_1609	284
154	3300048913	Ga0496110_0003436	Ga0496110_0003436_7442_8296	284
155	3300048914	Ga0496111_0026483	Ga0496111_0026483_2681_3535	284
156	3300048917	Ga0496114_0007758	Ga0496114_0007758_6817_7671	284
157	3300061719	Ga0466962_0080813	Ga0466962_0080813_154_1011	284
158	3300002067	JGI24735J21928_10041767	JGI24735J21928_100417672	285
159	3300005563	Ga0068855_100198036	Ga0068855_1001980362	285
160	3300005937	Ga0081455_10046204	Ga0081455_100462042	285
161	3300005985	Ga0081539_10000456	Ga0081539_1000045649	285
162	3300006038	Ga0075365_10069339	Ga0075365_100693392	285
163	3300006042	Ga0075368_10021760	Ga0075368_100217602	285
164	3300006048	Ga0075363_100002996	Ga0075363_1000029962	285
165	3300006178	Ga0075367_10002772	Ga0075367_100027727	285
166	3300013105	Ga0157369_10053529	Ga0157369_100535293	285
167	3300013105	Ga0157369_10326303	Ga0157369_103263031	285
168	3300013306	Ga0163162_10110914	Ga0163162_101109143	285
169	3300013307	Ga0157372_10013448	Ga0157372_100134485	285
170	3300014497	Ga0182008_10000508	Ga0182008_100005082	285
171	3300015688	Ga0183367_1004	Ga0183367_1004575	285
172	3300020082	Ga0206353_11675873	Ga0206353_116758733	285
173	3300025297	Ga0209758_1002460	Ga0209758_100246020	285
174	3300025904	Ga0207647_10027197	Ga0207647_100271976	285
175	3300028786	Ga0307517_10023329	Ga0307517_100233292	285
176	3300028794	Ga0307515_10000050	Ga0307515_10000050201	285
177	3300028794	Ga0307515_10267852	Ga0307515_102678522	285
178	3300030500	Ga0268256_1036463	Ga0268256_10364631	285
179	3300030521	Ga0307511_10001277	Ga0307511_1000127722	285
180	3300030522	Ga0307512_10000766	Ga0307512_1000076628	285
181	3300030522	Ga0307512_10179017	Ga0307512_101790171	285
182	3300031247	Ga0265340_10013411	Ga0265340_100134119	285
183	3300031456	Ga0307513_10003014	Ga0307513_1000301412	285
184	3300031456	Ga0307513_10008986	Ga0307513_100089869	285
185	3300031456	Ga0307513_10026185	Ga0307513_100261853	285
186	3300031507	Ga0307509_10066709	Ga0307509_100667091	285
187	3300031507	Ga0307509_10078928	Ga0307509_100789284	285
188	3300031616	Ga0307508_10007757	Ga0307508_100077572	285
189	3300031616	Ga0307508_10007850	Ga0307508_100078502	285
190	3300031616	Ga0307508_10017255	Ga0307508_100172552	285
191	3300031649	Ga0307514_10002314	Ga0307514_1000231416	285
192	3300031730	Ga0307516_10002791	Ga0307516_1000279112	285
193	3300031730	Ga0307516_10003999	Ga0307516_100039994	285
194	3300031731	Ga0307405_10000708	Ga0307405_1000070812	285
195	3300031824	Ga0307413_10070729	Ga0307413_100707293	285
196	3300031838	Ga0307518_10083130	Ga0307518_100831303	285
197	3300031838	Ga0307518_10126131	Ga0307518_101261312	285
198	3300031852	Ga0307410_10004486	Ga0307410_100044864	285
199	3300031852	Ga0307410_10032631	Ga0307410_100326313	285
200	3300031995	Ga0307409_100000227	Ga0307409_1000002278	285
201	3300031995	Ga0307409_100070571	Ga0307409_1000705712	285
202	3300032002	Ga0307416_100011839	Ga0307416_1000118398	285
203	3300032126	Ga0307415_100000037	Ga0307415_1000000375	285
204	3300033179	Ga0307507_10021507	Ga0307507_100215071	285
205	3300033179	Ga0307507_10025919	Ga0307507_100259196	285
206	3300033180	Ga0307510_10001630	Ga0307510_1000163019	285
207	3300037466	Ga0395898_0004472	Ga0395898_0004472_14173_15030	285
208	3300041404	Ga0439436_0002600	Ga0439436_0002600_1951_2808	285
209	3300041452	Ga0451793_0161858	Ga0451793_0161858_239_1099	285
210	3300041999	Ga0439433_0006710	Ga0439433_0006710_73_930	285
211	3300042002	Ga0439442_018724	Ga0439442_018724_166_1023	285
212	3300042005	Ga0439448_0025876	Ga0439448_0025876_658_1515	285
213	3300042007	Ga0439449_0006879	Ga0439449_0006879_3212_4069	285
214	3300042007	Ga0439449_0029766	Ga0439449_0029766_499_1356	285
215	3300042007	Ga0439449_0063600	Ga0439449_0063600_90_947	285
216	3300042012	Ga0439455_0033911	Ga0439455_0033911_356_1213	285
217	3300042014	Ga0439457_035592	Ga0439457_035592_47_904	285
218	3300042138	Ga0450903_000063	Ga0450903_000063_8195_9052	285
219	3300044656	Ga0466969_0007032	Ga0466969_0007032_1639_2496	285
220	3300044684	Ga0466966_0028704	Ga0466966_0028704_1877_2734	285
221	3300044693	Ga0466961_0007204	Ga0466961_0007204_5890_6747	285
222	3300044719	Ga0466971_0000378	Ga0466971_0000378_12598_13455	285
223	3300044765	Ga0466970_0004128	Ga0466970_0004128_4082_4939	285
224	3300044842	Ga0466957_0027506	Ga0466957_0027506_1445_2302	285
225	3300045049	Ga0466959_0014765	Ga0466959_0014765_3861_4718	285
226	3300045976	Ga0466967_0050374	Ga0466967_0050374_2440_3297	285
227	3300046454	Ga0495592_0039453	Ga0495592_0039453_1651_2508	285
228	3300046454	Ga0495592_0117069	Ga0495592_0117069_10_867	285
229	3300046459	Ga0495629_0007501	Ga0495629_0007501_4853_5710	285
230	3300046462	Ga0495651_0030923	Ga0495651_0030923_3169_4026	285
231	3300046462	Ga0495651_0056860	Ga0495651_0056860_2107_2964	285
232	3300046476	Ga0495662_0004559	Ga0495662_0004559_4340_5197	285
233	3300046477	Ga0495664_0003281	Ga0495664_0003281_1239_2096	285
234	3300046499	Ga0495594_0059145	Ga0495594_0059145_933_1790	285
235	3300046514	Ga0495618_0134756	Ga0495618_0134756_305_1162	285
236	3300046516	Ga0495628_0023656	Ga0495628_0023656_2488_3345	285
237	3300046516	Ga0495628_0060196	Ga0495628_0060196_2107_2964	285
238	3300046526	Ga0495666_0029104	Ga0495666_0029104_1534_2391	285
239	3300046529	Ga0495652_0129647	Ga0495652_0129647_277_1134	285
240	3300046529	Ga0495652_0319401	Ga0495652_0319401_250_1107	285
241	3300046533	Ga0495640_0192531	Ga0495640_0192531_384_1241	285
242	3300046543	Ga0495645_0007300	Ga0495645_0007300_6776_7633	285
243	3300046543	Ga0495645_0010625	Ga0495645_0010625_5138_5995	285
244	3300046557	Ga0495622_0044213	Ga0495622_0044213_890_1747	285
245	3300046642	Ga0495634_0014054	Ga0495634_0014054_433_1290	285
246	3300046642	Ga0495634_0040295	Ga0495634_0040295_2055_2912	285
247	3300046660	Ga0495625_0023464	Ga0495625_0023464_1883_2740	285
248	3300046663	Ga0495635_0002671	Ga0495635_0002671_3411_4268	285
249	3300046675	Ga0495657_0001323	Ga0495657_0001323_4583_5440	285
250	3300046675	Ga0495657_0167095	Ga0495657_0167095_468_1325	285
251	3300046680	Ga0495646_0008081	Ga0495646_0008081_1270_2127	285
252	3300046689	Ga0495613_0017614	Ga0495613_0017614_1708_2565	285
253	3300046689	Ga0495613_0045361	Ga0495613_0045361_2267_3124	285
254	3300046689	Ga0495613_0141313	Ga0495613_0141313_26_883	285
255	3300046692	Ga0495671_0016300	Ga0495671_0016300_2845_3702	285
256	3300046809	Ga0495600_0036102	Ga0495600_0036102_151_1008	285
257	3300047315	Ga0495581_0001816	Ga0495581_0001816_54_911	285
258	3300047317	Ga0495604_0016530	Ga0495604_0016530_1324_2181	285
259	3300047321	Ga0495676_0013352	Ga0495676_0013352_782_1639	285
260	3300047443	Ga0495687_014833	Ga0495687_014833_2338_3195	285
261	3300047444	Ga0495675_0029975	Ga0495675_0029975_481_1338	285
262	3300047470	Ga0495681_0006924	Ga0495681_0006924_6393_7250	285
263	3300047472	Ga0495686_0082634	Ga0495686_0082634_194_1051	285
264	3300047673	Ga0495593_0032345	Ga0495593_0032345_637_1494	285
265	3300048089	Ga0495614_0046765	Ga0495614_0046765_18_875	285
266	3300048903	Ga0496100_0099681	Ga0496100_0099681_325_1182	285
267	3300048904	Ga0496101_0130610	Ga0496101_0130610_41_898	285
268	3300048905	Ga0496102_0229806	Ga0496102_0229806_817_1674	285
269	3300048907	Ga0496104_0044538	Ga0496104_0044538_1597_2454	285
270	3300048907	Ga0496104_0101146	Ga0496104_0101146_1221_2078	285
271	3300048908	Ga0496105_0072219	Ga0496105_0072219_1940_2797	285
272	3300048912	Ga0496109_0063133	Ga0496109_0063133_2431_3288	285
273	3300048914	Ga0496111_0376635	Ga0496111_0376635_55_912	285
274	3300048916	Ga0496113_0043524	Ga0496113_0043524_588_1445	285
275	3300048917	Ga0496114_0030311	Ga0496114_0030311_3557_4414	285
276	3300048917	Ga0496114_0048943	Ga0496114_0048943_1220_2077	285
277	3300048917	Ga0496114_0113803	Ga0496114_0113803_168_1025	285
278	3300048918	Ga0496115_0192910	Ga0496115_0192910_601_1458	285
279	3300048922	Ga0496119_0001127	Ga0496119_0001127_12713_13570	285
280	3300048922	Ga0496119_0031481	Ga0496119_0031481_1442_2299	285
281	3300048923	Ga0496120_0006921	Ga0496120_0006921_2650_3507	285
282	3300048924	Ga0496121_0000098	Ga0496121_0000098_12705_13562	285
283	3300049568	Ga0501031_0004315	Ga0501031_0004315_5947_6804	285
284	3300049569	Ga0501032_0008485	Ga0501032_0008485_3474_4331	285
285	3300049569	Ga0501032_0069069	Ga0501032_0069069_293_1150	285
286	3300049570	Ga0501033_0008690	Ga0501033_0008690_2452_3309	285
287	3300049571	Ga0501034_0117782	Ga0501034_0117782_74_931	285
288	3300049572	Ga0501036_0049156	Ga0501036_0049156_1486_2343	285
289	3300049573	Ga0501037_0004829	Ga0501037_0004829_4630_5487	285
290	3300049573	Ga0501037_0098719	Ga0501037_0098719_895_1752	285
291	3300049574	Ga0501038_0094221	Ga0501038_0094221_498_1355	285
292	3300049575	Ga0501039_0025886	Ga0501039_0025886_3208_4065	285
293	3300049579	Ga0501043_0054320	Ga0501043_0054320_2054_2911	285
294	3300049580	Ga0501046_0018783	Ga0501046_0018783_494_1351	285
295	3300049581	Ga0501047_0004225	Ga0501047_0004225_9534_10391	285
296	3300049581	Ga0501047_0023745	Ga0501047_0023745_1744_2601	285
297	3300049581	Ga0501047_0024512	Ga0501047_0024512_1313_2170	285
298	3300049581	Ga0501047_0366225	Ga0501047_0366225_235_1092	285
299	3300049582	Ga0501048_0002403	Ga0501048_0002403_4202_5059	285
300	3300049585	Ga0501069_0182833	Ga0501069_0182833_179_1036	285
301	3300049589	Ga0501073_0187956	Ga0501073_0187956_48_905	285
302	3300049742	Ga0501080_0253916	Ga0501080_0253916_599_1456	285
303	3300049822	Ga0501035_0051996	Ga0501035_0051996_864_1721	285
304	3300049822	Ga0501035_0075602	Ga0501035_0075602_32_889	285
305	3300049823	Ga0501044_0003663	Ga0501044_0003663_12782_13639	285
306	3300049823	Ga0501044_0033431	Ga0501044_0033431_1007_1864	285
307	3300049823	Ga0501044_0163148	Ga0501044_0163148_29_886	285
308	3300049823	Ga0501044_0565271	Ga0501044_0565271_50_907	285
309	3300050490	nmdc:mga03n38_992_c1	nmdc:mga03n38_992_c1_6725_7582	285
310	3300050495	nmdc:mga04h51_36510_c1	nmdc:mga04h51_36510_c1_83_940	285
311	3300053092	Ga0500583_0062543	Ga0500583_0062543_634_1491	285
312	3300053095	Ga0500640_022259	Ga0500640_022259_1852_2709	285
313	3300053107	Ga0500560_000230	Ga0500560_000230_2835_3692	285
314	3300053111	Ga0500572_024892	Ga0500572_024892_13_870	285
315	3300053123	Ga0500614_013456	Ga0500614_013456_588_1445	285
316	3300053140	Ga0500573_0037084	Ga0500573_0037084_969_1826	285
317	3300053157	Ga0500624_003511	Ga0500624_003511_53_910	285
318	3300003578	Ga0006562J51391_1080470	Ga0006562J51391_10804702	286
319	3300003578	Ga0006562J51391_1080471	Ga0006562J51391_10804719	286
320	3300005327	Ga0070658_10001069	Ga0070658_100010692	286
321	3300005329	Ga0070683_100178621	Ga0070683_1001786211	286
322	3300005339	Ga0070660_100036397	Ga0070660_1000363973	286
323	3300005435	Ga0070714_100014410	Ga0070714_1000144103	286
324	3300005439	Ga0070711_100018593	Ga0070711_1000185931	286
325	3300005614	Ga0068856_100330591	Ga0068856_1003305912	286
326	3300005937	Ga0081455_10234115	Ga0081455_102341151	286
327	3300006175	Ga0070712_100181839	Ga0070712_1001818393	286
328	3300009147	Ga0114129_10449254	Ga0114129_104492542	286
329	3300009551	Ga0105238_10571583	Ga0105238_105715831	286
330	3300010375	Ga0105239_10217419	Ga0105239_102174193	286
331	3300013104	Ga0157370_10504841	Ga0157370_105048411	286
332	3300013105	Ga0157369_10314206	Ga0157369_103142062	286
333	3300013308	Ga0157375_10118289	Ga0157375_101182892	286
334	3300013308	Ga0157375_10178440	Ga0157375_101784401	286
335	3300017792	Ga0163161_10048684	Ga0163161_100486842	286
336	3300017792	Ga0163161_10261295	Ga0163161_102612951	286
337	3300020081	Ga0206354_10375450	Ga0206354_103754501	286
338	3300022467	Ga0224712_10003789	Ga0224712_100037894	286
339	3300025225	Ga0209566_100013	Ga0209566_100013194	286
340	3300025226	Ga0209674_100001	Ga0209674_1000012969	286
341	3300025230	Ga0209563_100001	Ga0209563_1000012969	286
342	3300025230	Ga0209563_100196	Ga0209563_10019621	286
343	3300025253	Ga0209677_100001	Ga0209677_1000012969	286
344	3300025898	Ga0207692_10297295	Ga0207692_102972951	286
345	3300025904	Ga0207647_10003533	Ga0207647_100035333	286
346	3300025909	Ga0207705_10000001	Ga0207705_100000011202	286
347	3300025909	Ga0207705_10078184	Ga0207705_100781841	286
348	3300025911	Ga0207654_10163808	Ga0207654_101638082	286
349	3300025913	Ga0207695_10000951	Ga0207695_1000095135	286
350	3300025914	Ga0207671_10000182	Ga0207671_1000018260	286
351	3300025915	Ga0207693_10443919	Ga0207693_104439191	286
352	3300025916	Ga0207663_10278783	Ga0207663_102787831	286
353	3300025919	Ga0207657_10213315	Ga0207657_102133152	286
354	3300025924	Ga0207694_10001573	Ga0207694_1000157314	286
355	3300025929	Ga0207664_10031055	Ga0207664_100310553	286
356	3300025949	Ga0207667_10105578	Ga0207667_101055782	286
357	3300025981	Ga0207640_10010692	Ga0207640_100106923	286
358	3300026041	Ga0207639_10193800	Ga0207639_101938002	286
359	3300026067	Ga0207678_10041951	Ga0207678_100419514	286
360	3300026067	Ga0207678_10281907	Ga0207678_102819071	286
361	3300026142	Ga0207698_10012344	Ga0207698_100123445	286
362	3300030522	Ga0307512_10023379	Ga0307512_100233791	286
363	3300030734	Ga0316179_1012522	Ga0316179_10125223	286
364	3300031456	Ga0307513_10128838	Ga0307513_101288383	286
365	3300031456	Ga0307513_10157434	Ga0307513_101574343	286
366	3300031456	Ga0307513_10160786	Ga0307513_101607863	286
367	3300031649	Ga0307514_10051462	Ga0307514_100514623	286
368	3300031649	Ga0307514_10100970	Ga0307514_101009702	286
369	3300031838	Ga0307518_10090270	Ga0307518_100902702	286
370	3300032126	Ga0307415_100087634	Ga0307415_1000876342	286
371	3300035091	Ga0373951_0000158	Ga0373951_0000158_15353_16213	286
372	3300037312	Ga0395899_0021314	Ga0395899_0021314_2201_3061	286
373	3300037418	Ga0395900_0040168	Ga0395900_0040168_2683_3543	286
374	3300037466	Ga0395898_0000158	Ga0395898_0000158_30747_31607	286
375	3300037466	Ga0395898_0295287	Ga0395898_0295287_73_933	286
376	3300038443	Ga0395901_0066951	Ga0395901_0066951_1108_1968	286
377	3300041512	Ga0451853_1234429	Ga0451853_1234429_470_1330	286
378	3300044658	Ga0466972_0011615	Ga0466972_0011615_1325_2185	286
379	3300044658	Ga0466972_0018856	Ga0466972_0018856_1641_2501	286
380	3300044683	Ga0466965_0070448	Ga0466965_0070448_401_1279	286
381	3300044684	Ga0466966_0015406	Ga0466966_0015406_60_920	286
382	3300044684	Ga0466966_0034716	Ga0466966_0034716_1282_2142	286
383	3300044693	Ga0466961_0034666	Ga0466961_0034666_1546_2424	286
384	3300044693	Ga0466961_0071458	Ga0466961_0071458_1289_2167	286
385	3300044693	Ga0466961_0134607	Ga0466961_0134607_641_1501	286
386	3300044693	Ga0466961_0235349	Ga0466961_0235349_100_960	286
387	3300044719	Ga0466971_0046875	Ga0466971_0046875_755_1615	286
388	3300044735	Ga0466968_0026898	Ga0466968_0026898_1077_1937	286
389	3300044735	Ga0466968_0029741	Ga0466968_0029741_905_1807	286
390	3300044735	Ga0466968_0160351	Ga0466968_0160351_162_1022	286
391	3300044765	Ga0466970_0005703	Ga0466970_0005703_4986_5846	286
392	3300044765	Ga0466970_0083567	Ga0466970_0083567_55_933	286
393	3300044842	Ga0466957_0055835	Ga0466957_0055835_666_1526	286
394	3300044842	Ga0466957_0138806	Ga0466957_0138806_503_1363	286
395	3300044842	Ga0466957_0140359	Ga0466957_0140359_360_1241	286
396	3300044842	Ga0466957_0161434	Ga0466957_0161434_83_985	286
397	3300044901	Ga0466960_0051499	Ga0466960_0051499_757_1659	286
398	3300044901	Ga0466960_0063546	Ga0466960_0063546_204_1064	286
399	3300044901	Ga0466960_0084527	Ga0466960_0084527_201_1061	286
400	3300045049	Ga0466959_0035882	Ga0466959_0035882_2658_3518	286
401	3300045049	Ga0466959_0082155	Ga0466959_0082155_447_1307	286
402	3300045836	Ga0466958_0062091	Ga0466958_0062091_328_1188	286
403	3300045976	Ga0466967_0230550	Ga0466967_0230550_326_1207	286
404	3300046453	Ga0495627_023001	Ga0495627_023001_199_1065	286
405	3300046511	Ga0495608_0101492	Ga0495608_0101492_264_1124	286
406	3300046559	Ga0495667_0167267	Ga0495667_0167267_421_1281	286
407	3300046694	Ga0495649_0064097	Ga0495649_0064097_286_1146	286
408	3300048914	Ga0496111_0032909	Ga0496111_0032909_2544_3413	286
409	3300048920	Ga0496117_0000817	Ga0496117_0000817_9187_10047	286
410	3300048920	Ga0496117_0030576	Ga0496117_0030576_3112_3972	286
411	3300048920	Ga0496117_0040355	Ga0496117_0040355_2213_3073	286
412	3300048921	Ga0496118_0058143	Ga0496118_0058143_986_1846	286
413	3300048921	Ga0496118_0092219	Ga0496118_0092219_186_1046	286
414	3300048925	Ga0496122_0000986	Ga0496122_0000986_32533_33393	286
415	3300048926	Ga0496123_0000241	Ga0496123_0000241_38458_39318	286
416	3300048927	Ga0496124_0011643	Ga0496124_0011643_6875_7735	286
417	3300048928	Ga0496125_0011970	Ga0496125_0011970_953_1813	286
418	3300048929	Ga0496126_0012959	Ga0496126_0012959_7586_8446	286
419	3300048929	Ga0496126_0088562	Ga0496126_0088562_1584_2444	286
420	3300048929	Ga0496126_0262247	Ga0496126_0262247_180_1049	286
421	3300049568	Ga0501031_0247191	Ga0501031_0247191_250_1110	286
422	3300049569	Ga0501032_0102233	Ga0501032_0102233_349_1209	286
423	3300049569	Ga0501032_0197533	Ga0501032_0197533_288_1148	286
424	3300049570	Ga0501033_0030292	Ga0501033_0030292_307_1167	286
425	3300049570	Ga0501033_0259744	Ga0501033_0259744_137_997	286
426	3300049570	Ga0501033_0393458	Ga0501033_0393458_88_948	286
427	3300049571	Ga0501034_0013131	Ga0501034_0013131_65_925	286
428	3300049571	Ga0501034_0029956	Ga0501034_0029956_2605_3465	286
429	3300049571	Ga0501034_0207504	Ga0501034_0207504_108_968	286
430	3300049571	Ga0501034_0353780	Ga0501034_0353780_183_1049	286
431	3300049572	Ga0501036_0016996	Ga0501036_0016996_4420_5280	286
432	3300049572	Ga0501036_0019899	Ga0501036_0019899_4276_5136	286
433	3300049572	Ga0501036_0192827	Ga0501036_0192827_69_929	286
434	3300049573	Ga0501037_0083908	Ga0501037_0083908_1412_2272	286
435	3300049573	Ga0501037_0090541	Ga0501037_0090541_245_1105	286
436	3300049574	Ga0501038_0017060	Ga0501038_0017060_3022_3882	286
437	3300049574	Ga0501038_0128885	Ga0501038_0128885_233_1093	286
438	3300049575	Ga0501039_0131045	Ga0501039_0131045_1040_1900	286
439	3300049576	Ga0501040_0394848	Ga0501040_0394848_108_968	286
440	3300049578	Ga0501042_0128373	Ga0501042_0128373_704_1564	286
441	3300049579	Ga0501043_0003907	Ga0501043_0003907_6344_7204	286
442	3300049579	Ga0501043_0147976	Ga0501043_0147976_202_1062	286
443	3300049580	Ga0501046_0132815	Ga0501046_0132815_115_975	286
444	3300049580	Ga0501046_0211950	Ga0501046_0211950_359_1219	286
445	3300049581	Ga0501047_0011290	Ga0501047_0011290_4087_4947	286
446	3300049581	Ga0501047_0158075	Ga0501047_0158075_1265_2125	286
447	3300049581	Ga0501047_0300570	Ga0501047_0300570_466_1326	286
448	3300049582	Ga0501048_0011583	Ga0501048_0011583_5064_5924	286
449	3300049582	Ga0501048_0112078	Ga0501048_0112078_721_1581	286
450	3300049582	Ga0501048_0296198	Ga0501048_0296198_180_1040	286
451	3300049586	Ga0501070_0179514	Ga0501070_0179514_686_1546	286
452	3300049589	Ga0501073_0045892	Ga0501073_0045892_1283_2143	286
453	3300049589	Ga0501073_0230299	Ga0501073_0230299_192_1052	286
454	3300049590	Ga0501074_0003014	Ga0501074_0003014_3234_4094	286
455	3300049822	Ga0501035_0074566	Ga0501035_0074566_1213_2073	286
456	3300049822	Ga0501035_0243630	Ga0501035_0243630_21_881	286
457	3300049823	Ga0501044_0004841	Ga0501044_0004841_13680_14540	286
458	3300049823	Ga0501044_0016398	Ga0501044_0016398_5876_6736	286
459	3300049823	Ga0501044_0051917	Ga0501044_0051917_578_1438	286
460	3300049824	Ga0501045_0227324	Ga0501045_0227324_473_1333	286
461	3300050494	nmdc:mga06z11_146314_c1	nmdc:mga06z11_146314_c1_317_1177	286
462	3300050507	nmdc:mga05p37_366794_c1	nmdc:mga05p37_366794_c1_671_1531	286
463	3300053077	Ga0495601_0097564	Ga0495601_0097564_997_1857	286
464	3300053078	Ga0495612_0004782	Ga0495612_0004782_4728_5588	286
465	3300053083	Ga0495655_0026919	Ga0495655_0026919_166_1041	286
466	3300053083	Ga0495655_0030622	Ga0495655_0030622_395_1270	286
467	3300053085	Ga0495619_0207973	Ga0495619_0207973_35_895	286
468	3300053140	Ga0500573_0028163	Ga0500573_0028163_260_1120	286
469	3300053730	Ga0500645_010922	Ga0500645_010922_962_1822	286
470	3300061719	Ga0466962_0015084	Ga0466962_0015084_1447_2307	286
471	iso_pu_bacteria	2816332119	2816422580	286
472	3300001989	JGI24739J22299_10067448	JGI24739J22299_100674482	287
473	3300002067	JGI24735J21928_10057631	JGI24735J21928_100576312	287
474	3300003285	Ga0007423J48922_100876	Ga0007423J48922_1008762	287
475	3300003578	Ga0006562J51391_1070716	Ga0006562J51391_10707162	287
476	3300005327	Ga0070658_10494362	Ga0070658_104943621	287
477	3300005347	Ga0070668_100033382	Ga0070668_1000333821	287
478	3300005841	Ga0068863_100255095	Ga0068863_1002550952	287
479	3300005937	Ga0081455_10101709	Ga0081455_101017092	287
480	3300005985	Ga0081539_10005632	Ga0081539_100056325	287
481	3300009148	Ga0105243_10069913	Ga0105243_100699134	287
482	3300009177	Ga0105248_10589212	Ga0105248_105892121	287
483	3300013307	Ga0157372_10023430	Ga0157372_100234306	287
484	3300013307	Ga0157372_10199728	Ga0157372_101997282	287
485	3300014326	Ga0157380_10022259	Ga0157380_100222595	287
486	3300017792	Ga0163161_10125936	Ga0163161_101259363	287
487	3300017792	Ga0163161_10444033	Ga0163161_104440331	287
488	3300025935	Ga0207709_10418984	Ga0207709_104189842	287
489	3300025972	Ga0207668_10024122	Ga0207668_100241221	287
490	3300026067	Ga0207678_10229840	Ga0207678_102298402	287
491	3300026067	Ga0207678_10490170	Ga0207678_104901701	287
492	3300026116	Ga0207674_10345738	Ga0207674_103457382	287
493	3300026121	Ga0207683_10196502	Ga0207683_101965022	287
494	3300031456	Ga0307513_10000248	Ga0307513_1000024844	287
495	3300031665	Ga0316575_10000006	Ga0316575_1000000617	287
496	3300031665	Ga0316575_10002734	Ga0316575_100027341	287
497	3300031691	Ga0316579_10002384	Ga0316579_100023843	287
498	3300031728	Ga0316578_10050201	Ga0316578_100502012	287
499	3300031901	Ga0307406_10027142	Ga0307406_100271425	287
500	3300031901	Ga0307406_10071947	Ga0307406_100719474	287
501	3300031903	Ga0307407_10125095	Ga0307407_101250954	287
502	3300032002	Ga0307416_100321344	Ga0307416_1003213442	287
503	3300032137	Ga0316585_10012482	Ga0316585_100124822	287
504	3300033529	Ga0316587_1010315	Ga0316587_10103151	287
505	3300035398	Ga0316574_0013717	Ga0316574_0013717_3236_4099	287
506	3300036647	Ga0316582_0000615	Ga0316582_0000615_567_1430	287
507	3300036647	Ga0316582_0213500	Ga0316582_0213500_140_1003	287
508	3300036712	Ga0316584_0060211	Ga0316584_0060211_1753_2616	287
509	3300037312	Ga0395899_0017732	Ga0395899_0017732_3030_3908	287
510	3300037418	Ga0395900_0056932	Ga0395900_0056932_2868_3746	287
511	3300037418	Ga0395900_0333200	Ga0395900_0333200_536_1405	287
512	3300037466	Ga0395898_0001167	Ga0395898_0001167_10484_11362	287
513	3300037466	Ga0395898_0085383	Ga0395898_0085383_216_1094	287
514	3300038443	Ga0395901_0008340	Ga0395901_0008340_5326_6204	287
515	3300038443	Ga0395901_0126573	Ga0395901_0126573_1431_2309	287
516	3300041451	Ga0451791_1372276	Ga0451791_1372276_290_1174	287
517	3300041452	Ga0451793_1069513	Ga0451793_1069513_1007_1897	287
518	3300041496	Ga0451839_1296375	Ga0451839_1296375_488_1372	287
519	3300041512	Ga0451853_3393842	Ga0451853_3393842_486_1370	287
520	3300044683	Ga0466965_0017992	Ga0466965_0017992_2376_3245	287
521	3300044684	Ga0466966_0125244	Ga0466966_0125244_237_1115	287
522	3300044694	Ga0466963_0000550	Ga0466963_0000550_2778_3704	287
523	3300044765	Ga0466970_0150225	Ga0466970_0150225_313_1191	287
524	3300046538	Ga0495609_0133032	Ga0495609_0133032_39_914	287
525	3300046660	Ga0495625_0213680	Ga0495625_0213680_378_1256	287
526	3300048903	Ga0496100_0000514	Ga0496100_0000514_406_1350	287
527	3300048903	Ga0496100_0017473	Ga0496100_0017473_25_894	287
528	3300048904	Ga0496101_0003079	Ga0496101_0003079_5367_6311	287
529	3300048905	Ga0496102_0014925	Ga0496102_0014925_2095_3039	287
530	3300048905	Ga0496102_0210903	Ga0496102_0210903_738_1607	287
531	3300048905	Ga0496102_0411022	Ga0496102_0411022_31_909	287
532	3300048906	Ga0496103_0001872	Ga0496103_0001872_8421_9365	287
533	3300048907	Ga0496104_0014064	Ga0496104_0014064_3380_4249	287
534	3300048907	Ga0496104_0035363	Ga0496104_0035363_1045_1998	287
535	3300048907	Ga0496104_0322765	Ga0496104_0322765_41_910	287
536	3300048907	Ga0496104_0513751	Ga0496104_0513751_70_939	287
537	3300048908	Ga0496105_0039684	Ga0496105_0039684_1478_2431	287
538	3300048908	Ga0496105_0048165	Ga0496105_0048165_2546_3415	287
539	3300048908	Ga0496105_0056937	Ga0496105_0056937_1421_2365	287
540	3300048910	Ga0496107_0314799	Ga0496107_0314799_57_932	287
541	3300048912	Ga0496109_0350756	Ga0496109_0350756_122_985	287
542	3300048914	Ga0496111_0092921	Ga0496111_0092921_1185_2054	287
543	3300048914	Ga0496111_0157928	Ga0496111_0157928_548_1411	287
544	3300048916	Ga0496113_0009522	Ga0496113_0009522_5429_6298	287
545	3300048916	Ga0496113_0053609	Ga0496113_0053609_866_1741	287
546	3300048916	Ga0496113_0136835	Ga0496113_0136835_629_1498	287
547	3300048916	Ga0496113_0168766	Ga0496113_0168766_303_1172	287
548	3300048917	Ga0496114_0007323	Ga0496114_0007323_3277_4221	287
549	3300048917	Ga0496114_0038735	Ga0496114_0038735_378_1241	287
550	3300048920	Ga0496117_0001079	Ga0496117_0001079_13248_14126	287
551	3300048921	Ga0496118_0000398	Ga0496118_0000398_34773_35651	287
552	3300048922	Ga0496119_0036246	Ga0496119_0036246_1858_2736	287
553	3300048923	Ga0496120_0045819	Ga0496120_0045819_704_1582	287
554	3300048925	Ga0496122_0039270	Ga0496122_0039270_1756_2634	287
555	3300048925	Ga0496122_0068287	Ga0496122_0068287_717_1595	287
556	3300048927	Ga0496124_0000198	Ga0496124_0000198_80623_81501	287
557	3300048927	Ga0496124_0058889	Ga0496124_0058889_1563_2441	287
558	3300049568	Ga0501031_0005083	Ga0501031_0005083_12_896	287
559	3300049569	Ga0501032_0007610	Ga0501032_0007610_341_1225	287
560	3300049571	Ga0501034_0006925	Ga0501034_0006925_10_894	287
561	3300049571	Ga0501034_0054912	Ga0501034_0054912_324_1193	287
562	3300049572	Ga0501036_0491342	Ga0501036_0491342_90_974	287
563	3300049574	Ga0501038_0002173	Ga0501038_0002173_6717_7601	287
564	3300049579	Ga0501043_0022262	Ga0501043_0022262_2791_3675	287
565	3300049580	Ga0501046_0150138	Ga0501046_0150138_267_1151	287
566	3300049581	Ga0501047_0033087	Ga0501047_0033087_246_1118	287
567	3300049581	Ga0501047_0058158	Ga0501047_0058158_2046_2930	287
568	3300049582	Ga0501048_0129436	Ga0501048_0129436_211_1074	287
569	3300049582	Ga0501048_0294870	Ga0501048_0294870_30_914	287
570	3300049583	Ga0501067_0196640	Ga0501067_0196640_118_1002	287
571	3300049822	Ga0501035_0023049	Ga0501035_0023049_1991_2875	287
572	3300049823	Ga0501044_0010781	Ga0501044_0010781_3781_4665	287
573	3300049823	Ga0501044_0183046	Ga0501044_0183046_981_1853	287
574	3300050511	nmdc:mga08y16_338671_c1	nmdc:mga08y16_338671_c1_300_1175	287
575	3300060353	Ga0501082_0017026	Ga0501082_0017026_5224_6108	287

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00248

Aldo_ket_red

Aldo/keto reductase family

13

285

0.97 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
8hnq-assembly1.cif.gz_A	the structure of a alcohol dehydrogenase akr13b2 with nadp	0.9214	3	283
3v0t-assembly1.cif.gz_A	crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during nadph binding	0.9149	1	286
4mhb-assembly4.cif.gz_D	structure of a putative reductase from yersinia pestis	0.9026	1	286
4fzi-assembly2.cif.gz_B	crystal structure of prostaglandin f synthase from trypanosoma cruzi	0.8993	1	286
4q3m-assembly1.cif.gz_B	crystal structure of mgs-m4, an aldo-keto reductase enzyme from a medee basin deep-sea metagenome library	0.8961	2	287

ID	Description	Score	Start	End	Superfamily
af_O94315_19_306_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9306	5	285	3.20.20.100
af_A0A0R0ETH2_7_234_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.9136	1	211	3.20.20.100
af_Q4DJ07_1_282_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.8971	2	286	3.20.20.100
3v0uA00	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.895	2	287	3.20.20.100
af_P30863_1_265_3.20.20.100	Alpha Beta;Alpha-Beta Barrel;TIM Barrel;NADP-dependent oxidoreductase domain	0.8941	13	286	3.20.20.100

ID	Description	Score	Start	End	GO Terms
AF-A0A7V9SHP7-F1-model_v4	Aldo/keto reductase	0.9896	96	285	GO:0004033 GO:0005737
AF-A0A075V0A1-F1-model_v4	Aldo/keto reductase	0.985	1	282	GO:0004033 GO:0005737
AF-A0A1T2X6X9-F1-model_v4	Aldo/keto reductase	0.9758	1	283	GO:0004033 GO:0005737
AF-A0A3N1VC86-F1-model_v4	Aldo/keto reductase family protein	0.9754	2	104	GO:0004033 GO:0005737
AF-A0A075V0A1-F1-model_v4	Aldo/keto reductase	0.9743	1	282	GO:0004033 GO:0005737

Feature Viewer

pLDDT	pTM	Quality
95.8	0.93	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F465419

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF00248

Aldo_ket_red

Aldo/keto reductase family

13

285

0.97

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map