F465331

General Info

Members Datasets Scaffolds Average Seq Length
574 268 1148 195

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0109137|Ga0466959_0109137_28_699
Length 223
Sequence VSGSSRTGATTAAPDARGSSPTSPDAIRERYRRLRDEVGDAVTVVVATKYLTIDELGALAEAGVDVVGENRAQDLADKHARWGDTFRWHFIGHLQSRKAKTVNELCELCHSLSSESAAAKLTIPALVEVNLSGEPSKSGIAPDSLGAFLQLYPDVRGLMTMPPWTAAPEESRPYFRRLRELAEAHGLRELSMGTSQDYRVAVEEGATYIRVGSTLFGDRRPPP

Samples

Sample ID Description Type Environment
1 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
88 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
143 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
144 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
150 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
151 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
154 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
155 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
156 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
160 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
161 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
162 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
166 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
167 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
168 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
169 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
170 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
171 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
172 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
173 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
174 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
175 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
176 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
179 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
180 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
181 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
182 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
185 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
186 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
187 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
188 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
189 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
192 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
193 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
198 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
199 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
200 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
201 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
202 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
203 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
210 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
211 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
212 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
213 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
214 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
218 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
219 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
220 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
232 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
238 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
239 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
243 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
244 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
245 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
246 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
247 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
248 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
249 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
250 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
251 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
252 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
253 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
254 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
255 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
256 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
259 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
267 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
268 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.13
Metatranscriptomes 0.87
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 12.89
Rhizosphere 86.41
Stem 0
Stem Tuber 0
Unclassified 10.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466959_0109137 3300045049 Bacteria 1976
2 JGI25407J50210_10002984 3300003373 Bacteria 4041
3 Ga0070658_10012532 3300005327 Bacteria 6802
4 Ga0070683_100005463 3300005329 Bacteria 10618
5 Ga0070683_100015609 3300005329 Bacteria 6676
6 Ga0070683_100032252 3300005329 Bacteria 4771
7 Ga0070683_100052937 3300005329 Bacteria 3761
8 Ga0070683_100209923 3300005329 Bacteria 1850
9 Ga0070683_100274395 3300005329 Bacteria 1604
10 Ga0070677_10084900 3300005333 Bacteria 1364
11 Ga0070680_100176494 3300005336 Unclassified 1799
12 Ga0070682_100026344 3300005337 Bacteria 3479
13 Ga0068868_100295565 3300005338 Bacteria 1374
14 Ga0068868_100859667 3300005338 Unclassified 822
15 Ga0070660_100033989 3300005339 Bacteria 3848
16 Ga0070660_100058319 3300005339 Bacteria 2993
17 Ga0070660_100209550 3300005339 Bacteria 1582
18 Ga0070660_100245381 3300005339 Bacteria 1459
19 Ga0070691_10030797 3300005341 Bacteria 2514
20 Ga0070687_100255409 3300005343 Bacteria 1091
21 Ga0070661_100110506 3300005344 Bacteria 2052
22 Ga0070661_100151200 3300005344 Bacteria 1755
23 Ga0070661_100157487 3300005344 Bacteria 1719
24 Ga0070661_100556296 3300005344 Bacteria 923
25 Ga0070668_100030366 3300005347 Bacteria 4108
26 Ga0070668_100180863 3300005347 Bacteria 1722
27 Ga0070668_100407551 3300005347 Bacteria 1162
28 Ga0070675_101258460 3300005354 Unclassified 681
29 Ga0070673_101551915 3300005364 Unclassified 625
30 Ga0070688_100488249 3300005365 Bacteria 927
31 Ga0070659_100179524 3300005366 Bacteria 1737
32 Ga0070709_10044373 3300005434 Bacteria 2753
33 Ga0070714_100029076 3300005435 Bacteria 4591
34 Ga0070714_100066585 3300005435 Bacteria 3105
35 Ga0070714_100248543 3300005435 Bacteria 1644
36 Ga0070714_100256341 3300005435 Bacteria 1619
37 Ga0070714_100309845 3300005435 Unclassified 1474
38 Ga0070714_100400201 3300005435 Bacteria 1297
39 Ga0070714_100477092 3300005435 Unclassified 1187
40 Ga0070713_100239204 3300005436 Bacteria 1653
41 Ga0070710_10216409 3300005437 Bacteria 1217
42 Ga0070711_100059978 3300005439 Bacteria 2643
43 Ga0070711_100881561 3300005439 Bacteria 763
44 Ga0070705_100047671 3300005440 Bacteria 2478
45 Ga0070705_100133960 3300005440 Unclassified 1620
46 Ga0070705_100866190 3300005440 Unclassified 724
47 Ga0070700_100521862 3300005441 Unclassified 918
48 Ga0070708_100013462 3300005445 Bacteria 6700
49 Ga0070708_100528493 3300005445 Bacteria 1113
50 Ga0070678_100513498 3300005456 Bacteria 1059
51 Ga0070662_100531211 3300005457 Bacteria 984
52 Ga0070681_10005979 3300005458 Bacteria 11789
53 Ga0070681_10022436 3300005458 Bacteria 6339
54 Ga0070681_10129514 3300005458 Bacteria 2455
55 Ga0070681_10410132 3300005458 Unclassified 1267
56 Ga0068867_100175386 3300005459 Unclassified 1701
57 Ga0070706_100348344 3300005467 Bacteria 1381
58 Ga0070707_100005939 3300005468 Bacteria 11394
59 Ga0070707_100232656 3300005468 Bacteria 1794
60 Ga0070707_100356647 3300005468 Bacteria 1420
61 Ga0070699_100067851 3300005518 Bacteria 3097
62 Ga0070679_100001403 3300005530 Bacteria 21260
63 Ga0070679_100021038 3300005530 Bacteria 6366
64 Ga0070679_100155438 3300005530 Bacteria 2262
65 Ga0070679_100310245 3300005530 Bacteria 1527
66 Ga0070679_100336611 3300005530 Bacteria 1457
67 Ga0070684_100007800 3300005535 Bacteria 8349
68 Ga0070684_100009215 3300005535 Bacteria 7769
69 Ga0070684_100044829 3300005535 Bacteria 3826
70 Ga0070684_100114113 3300005535 Bacteria 2425
71 Ga0070697_100302999 3300005536 Bacteria 1374
72 Ga0068853_100210481 3300005539 Bacteria 1772
73 Ga0068853_100239378 3300005539 Bacteria 1663
74 Ga0070672_100275503 3300005543 Bacteria 1422
75 Ga0070695_100456568 3300005545 Bacteria 980
76 Ga0070695_100528309 3300005545 Bacteria 916
77 Ga0070693_100063632 3300005547 Bacteria 2151
78 Ga0070665_100473659 3300005548 Bacteria 1263
79 Ga0070665_101044475 3300005548 Unclassified 829
80 Ga0070704_100118916 3300005549 Unclassified 2025
81 Ga0070704_100199413 3300005549 Bacteria 1614
82 Ga0070704_100398550 3300005549 Unclassified 1174
83 Ga0068855_100222558 3300005563 Bacteria 2115
84 Ga0068855_100441830 3300005563 Bacteria 1420
85 Ga0070664_100005843 3300005564 Bacteria 9926
86 Ga0070664_100014783 3300005564 Bacteria 6373
87 Ga0068857_100015432 3300005577 Bacteria 6671
88 Ga0068857_100038252 3300005577 Bacteria 4249
89 Ga0068857_100287382 3300005577 Bacteria 1514
90 Ga0068854_100087354 3300005578 Bacteria 2313
91 Ga0068856_100018994 3300005614 Bacteria 6669
92 Ga0068856_100030731 3300005614 Bacteria 5251
93 Ga0068856_100082703 3300005614 Bacteria 3187
94 Ga0068852_100128948 3300005616 Bacteria 2327
95 Ga0068861_100001363 3300005719 Bacteria 15367
96 Ga0068870_10048513 3300005840 Bacteria 2236
97 Ga0068870_10147880 3300005840 Bacteria 1381
98 Ga0081455_10011802 3300005937 Bacteria 8749
99 Ga0081455_10137214 3300005937 Bacteria 1904
100 Ga0081455_10549283 3300005937 Bacteria 764
101 Ga0081538_10000231 3300005981 Bacteria 62826
102 Ga0081538_10004563 3300005981 Bacteria 12747
103 Ga0081538_10019510 3300005981 Bacteria 5034
104 Ga0081538_10037241 3300005981 Bacteria 3160
105 Ga0081538_10041325 3300005981 Bacteria 2928
106 Ga0081538_10155047 3300005981 Bacteria 1029
107 Ga0081540_1006022 3300005983 Bacteria 8921
108 Ga0081539_10001999 3300005985 Bacteria 30965
109 Ga0075432_10060344 3300006058 Bacteria 1349
110 Ga0075432_10074038 3300006058 Bacteria 1226
111 Ga0070716_100012415 3300006173 Bacteria 4318
112 Ga0070716_100040509 3300006173 Bacteria 2592
113 Ga0070716_100741032 3300006173 Bacteria 755
114 Ga0070712_100003640 3300006175 Bacteria 9505
115 Ga0070712_100023331 3300006175 Bacteria 4086
116 Ga0097621_100132113 3300006237 Bacteria 2126
117 Ga0068871_100190650 3300006358 Bacteria 1766
118 Ga0075428_100009861 3300006844 Bacteria 10614
119 Ga0075428_100252409 3300006844 Bacteria 1901
120 Ga0075431_100037124 3300006847 Bacteria 5021
121 Ga0075433_10018453 3300006852 Bacteria 5799
122 Ga0075433_10349612 3300006852 Bacteria 1306
123 Ga0075433_10695288 3300006852 Bacteria 891
124 Ga0075434_100008428 3300006871 Bacteria 9585
125 Ga0075429_100048270 3300006880 Bacteria 3702
126 Ga0068865_100149432 3300006881 Bacteria 1771
127 Ga0075436_100005731 3300006914 Bacteria 8533
128 Ga0075436_100011563 3300006914 Bacteria 6054
129 Ga0075435_100009889 3300007076 Bacteria 6943
130 Ga0075435_100055700 3300007076 Bacteria 3194
131 Ga0075435_100140438 3300007076 Bacteria 2026
132 Ga0075435_100169477 3300007076 Bacteria 1842
133 Ga0075435_100665821 3300007076 Unclassified 904
134 Ga0105240_10360652 3300009093 Bacteria 1646
135 Ga0111539_10104754 3300009094 Bacteria 3319
136 Ga0111539_10468683 3300009094 Bacteria 1467
137 Ga0105245_10002363 3300009098 Bacteria 17055
138 Ga0105245_10005489 3300009098 Bacteria 11140
139 Ga0105245_10047176 3300009098 Bacteria 3850
140 Ga0105245_10108887 3300009098 Bacteria 2574
141 Ga0105245_10197903 3300009098 Bacteria 1928
142 Ga0105245_10321642 3300009098 Bacteria 1524
143 Ga0114129_10029648 3300009147 Bacteria 7749
144 Ga0114129_10330696 3300009147 Unclassified 2023
145 Ga0114129_10473929 3300009147 Bacteria 1639
146 Ga0114129_10820300 3300009147 Unclassified 1185
147 Ga0114129_11544725 3300009147 Bacteria 814
148 Ga0105243_10199736 3300009148 Bacteria 1753
149 Ga0105243_10255107 3300009148 Bacteria 1568
150 Ga0105243_10467042 3300009148 Bacteria 1188
151 Ga0105243_10589656 3300009148 Bacteria 1068
152 Ga0105243_10991707 3300009148 Bacteria 842
153 Ga0105241_10062175 3300009174 Bacteria 2878
154 Ga0105241_10077226 3300009174 Bacteria 2599
155 Ga0105241_11122151 3300009174 Bacteria 741
156 Ga0105242_10008965 3300009176 Bacteria 7680
157 Ga0105242_11044676 3300009176 Bacteria 828
158 Ga0105248_10487065 3300009177 Bacteria 1390
159 Ga0105237_10437756 3300009545 Bacteria 1313
160 Ga0105238_10304102 3300009551 Bacteria 1579
161 Ga0105249_10004966 3300009553 Bacteria 11472
162 Ga0105249_10253356 3300009553 Bacteria 1746
163 Ga0105249_11064516 3300009553 Bacteria 878
164 Ga0105239_10509137 3300010375 Unclassified 1369
165 Ga0105239_10672710 3300010375 Unclassified 1183
166 Ga0105239_10760387 3300010375 Unclassified 1109
167 Ga0105246_10568890 3300011119 Bacteria 974
168 Ga0105246_11091151 3300011119 Unclassified 728
169 Ga0157370_10292983 3300013104 Bacteria 1503
170 Ga0157370_10369258 3300013104 Bacteria 1322
171 Ga0157370_10691051 3300013104 Unclassified 931
172 Ga0157369_10009525 3300013105 Bacteria 11106
173 Ga0157369_10096757 3300013105 Bacteria 3149
174 Ga0157369_10681745 3300013105 Bacteria 1059
175 Ga0157369_10843527 3300013105 Unclassified 941
176 Ga0157374_10108454 3300013296 Bacteria 2669
177 Ga0157374_10108588 3300013296 Unclassified 2667
178 Ga0157374_10482699 3300013296 Bacteria 1243
179 Ga0157378_11095281 3300013297 Unclassified 833
180 Ga0163162_10082042 3300013306 Bacteria 3296
181 Ga0157372_10044068 3300013307 Bacteria 4943
182 Ga0157372_10258868 3300013307 Bacteria 2020
183 Ga0157375_11717507 3300013308 Unclassified 743
184 Ga0157380_10249700 3300014326 Bacteria 1605
185 Ga0157380_11325766 3300014326 Bacteria 768
186 Ga0182008_10006444 3300014497 Bacteria 6562
187 Ga0182008_10023236 3300014497 Bacteria 3169
188 Ga0157377_10016803 3300014745 Bacteria 3771
189 Ga0157377_10059614 3300014745 Unclassified 2176
190 Ga0157376_10163980 3300014969 Bacteria 2017
191 Ga0157376_10863413 3300014969 Bacteria 921
192 Ga0163161_10052171 3300017792 Bacteria 2964
193 Ga0197907_10126759 3300020069 Bacteria 1611
194 Ga0206356_11131013 3300020070 Bacteria 1150
195 Ga0206354_11614219 3300020081 Bacteria 2420
196 Ga0206353_10308808 3300020082 Bacteria 2075
197 Ga0206353_12070242 3300020082 Bacteria 1422
198 Ga0207653_10000589 3300025885 Bacteria 12860
199 Ga0207642_10295687 3300025899 Bacteria 937
200 Ga0207688_10240839 3300025901 Bacteria 1094
201 Ga0207647_10414123 3300025904 Unclassified 758
202 Ga0207685_10035135 3300025905 Bacteria 1827
203 Ga0207699_10396544 3300025906 Bacteria 982
204 Ga0207699_10584785 3300025906 Bacteria 812
205 Ga0207643_10211518 3300025908 Bacteria 1184
206 Ga0207705_10001180 3300025909 Bacteria 21214
207 Ga0207705_10072044 3300025909 Unclassified 2506
208 Ga0207705_10251823 3300025909 Bacteria 1347
209 Ga0207684_10117602 3300025910 Bacteria 2278
210 Ga0207654_10122451 3300025911 Bacteria 1635
211 Ga0207654_10441682 3300025911 Bacteria 911
212 Ga0207707_10017260 3300025912 Bacteria 6290
213 Ga0207707_10028393 3300025912 Bacteria 4890
214 Ga0207707_10096990 3300025912 Bacteria 2576
215 Ga0207707_10105705 3300025912 Bacteria 2460
216 Ga0207707_10120769 3300025912 Bacteria 2291
217 Ga0207693_10000495 3300025915 Bacteria 35594
218 Ga0207693_10003428 3300025915 Bacteria 13527
219 Ga0207693_10010444 3300025915 Bacteria 7533
220 Ga0207663_10003440 3300025916 Bacteria 7751
221 Ga0207663_10528900 3300025916 Unclassified 919
222 Ga0207660_10007442 3300025917 Bacteria 7086
223 Ga0207660_10055962 3300025917 Bacteria 2821
224 Ga0207660_10208101 3300025917 Bacteria 1531
225 Ga0207657_10008781 3300025919 Bacteria 10227
226 Ga0207657_10026421 3300025919 Bacteria 5337
227 Ga0207657_10171993 3300025919 Bacteria 1755
228 Ga0207657_10180236 3300025919 Bacteria 1708
229 Ga0207649_10061616 3300025920 Bacteria 2362
230 Ga0207649_10083128 3300025920 Bacteria 2077
231 Ga0207649_10194246 3300025920 Bacteria 1429
232 Ga0207652_10010690 3300025921 Bacteria 7390
233 Ga0207652_10040821 3300025921 Bacteria 3942
234 Ga0207652_10252524 3300025921 Bacteria 1590
235 Ga0207646_10011714 3300025922 Bacteria 8478
236 Ga0207646_10109459 3300025922 Bacteria 2479
237 Ga0207646_10188077 3300025922 Bacteria 1865
238 Ga0207646_10517069 3300025922 Bacteria 1075
239 Ga0207687_10023022 3300025927 Bacteria 4149
240 Ga0207687_10025947 3300025927 Bacteria 3922
241 Ga0207687_10247442 3300025927 Bacteria 1416
242 Ga0207700_10521889 3300025928 Unclassified 1052
243 Ga0207664_10022406 3300025929 Bacteria 4716
244 Ga0207664_10025149 3300025929 Bacteria 4481
245 Ga0207664_10050242 3300025929 Bacteria 3287
246 Ga0207664_10111200 3300025929 Bacteria 2279
247 Ga0207664_10548244 3300025929 Unclassified 1037
248 Ga0207644_10147315 3300025931 Bacteria 1819
249 Ga0207690_10185208 3300025932 Bacteria 1570
250 Ga0207706_10013883 3300025933 Bacteria 7305
251 Ga0207706_10459842 3300025933 Bacteria 1100
252 Ga0207709_10144986 3300025935 Bacteria 1637
253 Ga0207709_10160272 3300025935 Bacteria 1568
254 Ga0207709_10227239 3300025935 Unclassified 1350
255 Ga0207704_10180822 3300025938 Bacteria 1524
256 Ga0207665_10021600 3300025939 Bacteria 4234
257 Ga0207665_10055879 3300025939 Bacteria 2664
258 Ga0207665_10107937 3300025939 Bacteria 1952
259 Ga0207691_10086709 3300025940 Bacteria 2809
260 Ga0207661_10002036 3300025944 Bacteria 13944
261 Ga0207661_10007125 3300025944 Bacteria 7946
262 Ga0207661_10020465 3300025944 Bacteria 4946
263 Ga0207661_10077742 3300025944 Bacteria 2730
264 Ga0207661_10116901 3300025944 Bacteria 2264
265 Ga0207679_10073477 3300025945 Bacteria 2587
266 Ga0207679_10100887 3300025945 Bacteria 2257
267 Ga0207679_10241209 3300025945 Bacteria 1531
268 Ga0207679_10620886 3300025945 Unclassified 976
269 Ga0207651_11272644 3300025960 Unclassified 661
270 Ga0207668_10021691 3300025972 Bacteria 4100
271 Ga0207668_10160622 3300025972 Bacteria 1751
272 Ga0207640_10372859 3300025981 Bacteria 1154
273 Ga0207677_10063005 3300026023 Bacteria 2575
274 Ga0207677_10175792 3300026023 Bacteria 1679
275 Ga0207639_10326483 3300026041 Unclassified 1364
276 Ga0207678_10576100 3300026067 Unclassified 986
277 Ga0207702_10010080 3300026078 Bacteria 7919
278 Ga0207702_10089356 3300026078 Unclassified 2694
279 Ga0207702_10102085 3300026078 Bacteria 2534
280 Ga0207702_10353738 3300026078 Bacteria 1406
281 Ga0207648_10048570 3300026089 Unclassified 3715
282 Ga0207648_10294408 3300026089 Unclassified 1454
283 Ga0207648_10382090 3300026089 Bacteria 1273
284 Ga0207674_10021324 3300026116 Bacteria 6980
285 Ga0207674_10304063 3300026116 Bacteria 1544
286 Ga0207674_10606319 3300026116 Bacteria 1058
287 Ga0207675_100000541 3300026118 Bacteria 36871
288 Ga0207675_100017237 3300026118 Bacteria 6745
289 Ga0207683_10078094 3300026121 Bacteria 2933
290 Ga0207683_10296356 3300026121 Bacteria 1479
291 Ga0207428_10025525 3300027907 Bacteria 4946
292 Ga0207428_10129825 3300027907 Bacteria 1929
293 Ga0268266_10686121 3300028379 Bacteria 987
294 Ga0268266_10834854 3300028379 Unclassified 890
295 Ga0268265_10310993 3300028380 Bacteria 1423
296 Ga0265322_10078801 3300028654 Bacteria 935
297 Ga0265338_10012044 3300028800 Bacteria 9895
298 Ga0265325_10051941 3300031241 Archaea 2106
299 Ga0265339_10002969 3300031249 Bacteria 11982
300 Ga0265331_10051464 3300031250 Bacteria 1971
301 Ga0265327_10135534 3300031251 Bacteria 1155
302 Ga0265316_10050745 3300031344 Bacteria 3261
303 Ga0265342_10102593 3300031712 Bacteria 1627
304 Ga0307416_100444666 3300032002 Bacteria 1347
305 Ga0373930_0005814 3300034816 Bacteria 2064
306 Ga0373950_0009604 3300034818 Bacteria 1549
307 Ga0373959_0002201 3300034820 Bacteria 3108
308 Ga0373929_0006551 3300035085 Bacteria 2106
309 Ga0373949_0054504 3300035090 Bacteria 1015
310 Ga0373952_0006790 3300035092 Bacteria 2128
311 Ga0373932_0024602 3300035112 Bacteria 1622
312 Ga0373936_0098785 3300035113 Bacteria 1230
313 Ga0373939_0006438 3300035114 Bacteria 2829
314 Ga0373941_0011013 3300035115 Bacteria 2327
315 Ga0373941_0186302 3300035115 Bacteria 782
316 Ga0373960_0016556 3300035121 Bacteria 1899
317 Ga0373962_0015150 3300035242 Bacteria 1973
318 Ga0373931_0514874 3300035691 Bacteria 773
319 Ga0373935_0043236 3300035692 Bacteria 2835
320 Ga0395899_0001267 3300037312 Bacteria 21969
321 Ga0395899_0003370 3300037312 Bacteria 12677
322 Ga0395899_0016111 3300037312 Bacteria 5698
323 Ga0395899_0019986 3300037312 Bacteria 5081
324 Ga0395899_0043135 3300037312 Bacteria 3365
325 Ga0395900_0003489 3300037418 Bacteria 16973
326 Ga0395900_0023618 3300037418 Bacteria 6290
327 Ga0395900_0024974 3300037418 Bacteria 6115
328 Ga0395900_0057742 3300037418 Bacteria 3995
329 Ga0395900_0246123 3300037418 Bacteria 1791
330 Ga0395900_0294309 3300037418 Bacteria 1611
331 Ga0395900_0359511 3300037418 Bacteria 1428
332 Ga0395900_0566581 3300037418 Bacteria 1079
333 Ga0395900_0799610 3300037418 Unclassified 871
334 Ga0395898_0001276 3300037466 Bacteria 37111
335 Ga0395898_0008267 3300037466 Bacteria 11005
336 Ga0395898_0011522 3300037466 Bacteria 9182
337 Ga0395898_0049382 3300037466 Bacteria 4122
338 Ga0395898_0137191 3300037466 Bacteria 2342
339 Ga0395898_0385436 3300037466 Bacteria 1336
340 Ga0395898_1438450 3300037466 Unclassified 616
341 Ga0395905_0001281 3300037471 Bacteria 31019
342 Ga0395905_0019886 3300037471 Bacteria 6362
343 Ga0395905_0023643 3300037471 Bacteria 5802
344 Ga0395905_0036754 3300037471 Bacteria 4600
345 Ga0395905_0056847 3300037471 Bacteria 3659
346 Ga0395905_0088176 3300037471 Bacteria 2908
347 Ga0395905_0159439 3300037471 Unclassified 2121
348 Ga0395905_0245197 3300037471 Bacteria 1674
349 Ga0395905_0273895 3300037471 Bacteria 1574
350 Ga0395905_0759440 3300037471 Bacteria 872
351 Ga0395901_0001957 3300038443 Bacteria 21190
352 Ga0395901_0018418 3300038443 Bacteria 7127
353 Ga0395901_0039754 3300038443 Bacteria 4868
354 Ga0395901_0052105 3300038443 Bacteria 4254
355 Ga0395901_0081441 3300038443 Bacteria 3381
356 Ga0395901_0088190 3300038443 Bacteria 3244
357 Ga0395901_0139015 3300038443 Bacteria 2553
358 Ga0395901_0175737 3300038443 Bacteria 2246
359 Ga0395901_0197150 3300038443 Bacteria 2111
360 Ga0395901_0218720 3300038443 Bacteria 1991
361 Ga0395901_0241648 3300038443 Bacteria 1883
362 Ga0395901_1292935 3300038443 Bacteria 691
363 Ga0395901_1318235 3300038443 Unclassified 683
364 Ga0439461_0047985 3300041410 Bacteria 940
365 Ga0451798_0154163 3300041458 Unclassified 903
366 Ga0451807_0137371 3300041486 Unclassified 1285
367 Ga0451847_0902794 3300041503 Bacteria 683
368 Ga0451851_0725049 3300041507 Unclassified 1100
369 Ga0451853_2291318 3300041512 Bacteria 2788
370 Ga0451853_2615168 3300041512 Bacteria 5760
371 Ga0439448_0021235 3300042005 Bacteria 2012
372 Ga0439451_010264 3300042009 Bacteria 1888
373 Ga0439455_0058571 3300042012 Unclassified 1018
374 Ga0439458_0052636 3300042157 Unclassified 1006
375 Ga0439460_0034453 3300042461 Bacteria 1460
376 Ga0466966_0008334 3300044684 Bacteria 6865
377 Ga0466961_0124488 3300044693 Bacteria 1618
378 Ga0466961_0388041 3300044693 Bacteria 848
379 Ga0466963_0007384 3300044694 Bacteria 6549
380 Ga0466963_0010625 3300044694 Bacteria 5581
381 Ga0466963_0020177 3300044694 Bacteria 4189
382 Ga0466963_0027038 3300044694 Bacteria 3671
383 Ga0466963_0163911 3300044694 Bacteria 1548
384 Ga0466964_0009904 3300044706 Bacteria 3592
385 Ga0453684_0993750 3300044712 Bacteria 893
386 Ga0466971_0023800 3300044719 Bacteria 2730
387 Ga0466971_0221619 3300044719 Bacteria 896
388 Ga0466968_0121330 3300044735 Bacteria 1183
389 Ga0466968_0124144 3300044735 Bacteria 1170
390 Ga0466957_0056605 3300044842 Bacteria 2398
391 Ga0466957_0123020 3300044842 Bacteria 1655
392 Ga0466957_0348736 3300044842 Bacteria 1004
393 Ga0466959_0018225 3300045049 Bacteria 5154
394 Ga0466959_0219058 3300045049 Bacteria 1321
395 Ga0451576_0043428 3300045051 Bacteria 4743
396 Ga0466958_0015851 3300045836 Bacteria 4330
397 Ga0466958_0023275 3300045836 Bacteria 3634
398 Ga0466958_0335559 3300045836 Bacteria 972
399 Ga0466958_0412694 3300045836 Bacteria 872
400 Ga0466967_0006616 3300045976 Bacteria 8236
401 Ga0466967_0022962 3300045976 Bacteria 5103
402 Ga0466967_0036019 3300045976 Bacteria 4220
403 Ga0466967_0051409 3300045976 Bacteria 3611
404 Ga0466967_0065565 3300045976 Bacteria 3233
405 Ga0466967_0090676 3300045976 Bacteria 2777
406 Ga0466967_0263572 3300045976 Bacteria 1649
407 Ga0466967_0413353 3300045976 Bacteria 1314
408 Ga0466967_0726853 3300045976 Bacteria 984
409 Ga0466967_0782030 3300045976 Bacteria 947
410 Ga0495629_0065495 3300046459 Bacteria 2536
411 Ga0495641_0012360 3300046461 Bacteria 4782
412 Ga0495641_0123199 3300046461 Bacteria 1157
413 Ga0495582_0042600 3300046473 Bacteria 2500
414 Ga0495582_0129387 3300046473 Unclassified 1426
415 Ga0495582_0201675 3300046473 Bacteria 1136
416 Ga0495605_0257774 3300046474 Unclassified 745
417 Ga0495584_0101012 3300046491 Bacteria 1458
418 Ga0495584_0186451 3300046491 Bacteria 1054
419 Ga0495584_0246216 3300046491 Bacteria 909
420 Ga0495596_0093000 3300046500 Bacteria 1171
421 Ga0495607_0205554 3300046501 Bacteria 972
422 Ga0495630_0374329 3300046517 Bacteria 1091
423 Ga0495644_0086052 3300046523 Bacteria 1185
424 Ga0495644_0139395 3300046523 Bacteria 926
425 Ga0495665_0040510 3300046531 Bacteria 2480
426 Ga0495621_0155455 3300046539 Bacteria 902
427 Ga0495656_0305956 3300046615 Bacteria 816
428 Ga0495634_0296067 3300046642 Bacteria 979
429 Ga0495659_0141666 3300046664 Bacteria 960
430 Ga0495658_0018275 3300046683 Bacteria 3642
431 Ga0495658_0021178 3300046683 Bacteria 3425
432 Ga0495613_0067713 3300046689 Bacteria 2606
433 Ga0495613_0440666 3300046689 Bacteria 884
434 Ga0495670_0210305 3300046691 Bacteria 1032
435 Ga0495589_0031667 3300046794 Bacteria 2662
436 Ga0495581_0000674 3300047315 Bacteria 17953
437 Ga0495676_0098219 3300047321 Bacteria 2173
438 Ga0495676_0103503 3300047321 Bacteria 2102
439 Ga0495676_0470941 3300047321 Bacteria 827
440 Ga0495677_0058401 3300047445 Bacteria 1427
441 Ga0495593_0066709 3300047673 Bacteria 1875
442 Ga0495602_1006540 3300048088 Bacteria 550
443 Ga0495614_0056976 3300048089 Bacteria 1678
444 Ga0496100_0004851 3300048903 Bacteria 7183
445 Ga0496100_0021541 3300048903 Bacteria 3884
446 Ga0496100_0100516 3300048903 Unclassified 1992
447 Ga0496100_0485419 3300048903 Bacteria 950
448 Ga0496101_0008696 3300048904 Bacteria 6640
449 Ga0496101_0045876 3300048904 Bacteria 3132
450 Ga0496101_0047758 3300048904 Bacteria 3074
451 Ga0496101_0070827 3300048904 Bacteria 2554
452 Ga0496101_0763055 3300048904 Bacteria 763
453 Ga0496102_0040814 3300048905 Bacteria 4200
454 Ga0496102_0148011 3300048905 Bacteria 2205
455 Ga0496102_0864195 3300048905 Bacteria 826
456 Ga0496102_1023499 3300048905 Bacteria 746
457 Ga0496103_0008609 3300048906 Bacteria 6059
458 Ga0496103_0037158 3300048906 Bacteria 2984
459 Ga0496103_0409589 3300048906 Bacteria 871
460 Ga0496104_0002542 3300048907 Bacteria 15712
461 Ga0496104_0038869 3300048907 Bacteria 4454
462 Ga0496104_0066799 3300048907 Bacteria 3415
463 Ga0496104_0136449 3300048907 Bacteria 2357
464 Ga0496105_0000594 3300048908 Bacteria 24087
465 Ga0496105_0069309 3300048908 Bacteria 2914
466 Ga0496105_0331683 3300048908 Unclassified 1217
467 Ga0496106_0075258 3300048909 Unclassified 2586
468 Ga0496106_0087694 3300048909 Bacteria 2398
469 Ga0496106_0442307 3300048909 Bacteria 1044
470 Ga0496107_0044129 3300048910 Bacteria 3204
471 Ga0496107_0066518 3300048910 Unclassified 2613
472 Ga0496107_0092030 3300048910 Bacteria 2216
473 Ga0496107_0391731 3300048910 Bacteria 1033
474 Ga0496108_0002772 3300048911 Bacteria 14039
475 Ga0496108_0052368 3300048911 Bacteria 3420
476 Ga0496108_0152331 3300048911 Bacteria 1995
477 Ga0496108_0179769 3300048911 Bacteria 1832
478 Ga0496108_0195527 3300048911 Bacteria 1754
479 Ga0496108_0263719 3300048911 Bacteria 1499
480 Ga0496108_0434999 3300048911 Bacteria 1146
481 Ga0496109_0000463 3300048912 Bacteria 34599
482 Ga0496109_0007742 3300048912 Bacteria 9095
483 Ga0496109_0013557 3300048912 Bacteria 7077
484 Ga0496109_0025337 3300048912 Bacteria 5284
485 Ga0496109_0034347 3300048912 Bacteria 4566
486 Ga0496109_0168964 3300048912 Unclassified 2051
487 Ga0496110_0000563 3300048913 Bacteria 25359
488 Ga0496110_0007165 3300048913 Bacteria 8879
489 Ga0496110_0019029 3300048913 Bacteria 5771
490 Ga0496110_0043948 3300048913 Bacteria 3901
491 Ga0496110_0081594 3300048913 Bacteria 2883
492 Ga0496110_0148286 3300048913 Bacteria 2123
493 Ga0496110_0326412 3300048913 Bacteria 1398
494 Ga0496110_0701971 3300048913 Bacteria 913
495 Ga0496111_0007281 3300048914 Bacteria 7242
496 Ga0496111_0010595 3300048914 Bacteria 6193
497 Ga0496111_0076513 3300048914 Unclassified 2439
498 Ga0496111_0351857 3300048914 Bacteria 1090
499 Ga0496111_0637503 3300048914 Bacteria 778
500 Ga0496112_0016172 3300048915 Bacteria 6980
501 Ga0496112_0016569 3300048915 Bacteria 6910
502 Ga0496112_0031572 3300048915 Bacteria 5140
503 Ga0496112_0081460 3300048915 Bacteria 3201
504 Ga0496112_0101201 3300048915 Bacteria 2851
505 Ga0496112_0581780 3300048915 Bacteria 1052
506 Ga0496113_0056786 3300048916 Bacteria 2940
507 Ga0496113_0107282 3300048916 Bacteria 2170
508 Ga0496114_0000690 3300048917 Bacteria 25130
509 Ga0496114_0008744 3300048917 Bacteria 8023
510 Ga0496114_0012463 3300048917 Bacteria 6806
511 Ga0496114_0031583 3300048917 Bacteria 4357
512 Ga0496114_0171994 3300048917 Bacteria 1888
513 Ga0496114_0351263 3300048917 Bacteria 1304
514 Ga0496115_0006958 3300048918 Bacteria 8308
515 Ga0496115_0196094 3300048918 Bacteria 1668
516 Ga0501031_0031632 3300049568 Bacteria 3451
517 Ga0501032_0025390 3300049569 Bacteria 4084
518 Ga0501033_0040122 3300049570 Bacteria 3495
519 Ga0501034_0021244 3300049571 Bacteria 6620
520 Ga0501034_0480118 3300049571 Bacteria 1158
521 Ga0501037_0011391 3300049573 Bacteria 6547
522 Ga0501038_0008959 3300049574 Bacteria 9180
523 Ga0501039_0020513 3300049575 Bacteria 5064
524 Ga0501041_0005891 3300049577 Bacteria 7163
525 Ga0501042_0005494 3300049578 Bacteria 8169
526 Ga0501043_0036036 3300049579 Bacteria 3891
527 Ga0501046_0028473 3300049580 Bacteria 4548
528 Ga0501046_0241305 3300049580 Bacteria 1333
529 Ga0501048_0008878 3300049582 Bacteria 7568
530 Ga0501067_0077690 3300049583 Bacteria 1840
531 Ga0501068_0026305 3300049584 Bacteria 3426
532 Ga0501069_0005482 3300049585 Bacteria 6602
533 Ga0501069_0029099 3300049585 Bacteria 3031
534 Ga0501070_0020743 3300049586 Bacteria 5512
535 Ga0501070_0029511 3300049586 Bacteria 4597
536 Ga0501070_0089652 3300049586 Bacteria 2545
537 Ga0501071_0031199 3300049587 Bacteria 3775
538 Ga0501072_0032580 3300049588 Bacteria 4081
539 Ga0501074_0005266 3300049590 Bacteria 9310
540 Ga0501074_0016830 3300049590 Bacteria 5306
541 Ga0501075_0008350 3300049591 Bacteria 7221
542 Ga0501076_0003560 3300049592 Bacteria 10941
543 Ga0501077_0007581 3300049593 Bacteria 6697
544 Ga0501079_0010406 3300049741 Bacteria 7071
545 Ga0501080_0000646 3300049742 Bacteria 27624
546 Ga0501080_0047302 3300049742 Bacteria 4004
547 Ga0501081_0008311 3300049743 Bacteria 6736
548 Ga0501083_0007908 3300049744 Bacteria 7530
549 Ga0501035_0070674 3300049822 Bacteria 3091
550 Ga0501044_0095943 3300049823 Bacteria 2988
551 Ga0501044_0314208 3300049823 Bacteria 1493
552 nmdc:mga05p37_22552_c1 3300050507 Bacteria 7634
553 nmdc:mga05p37_8824_c1 3300050507 Bacteria 7753
554 nmdc:mga05p37_988564_c1 3300050507 Bacteria 895
555 nmdc:mga09592_151332_c1 3300050508 Unclassified 2002
556 nmdc:mga09592_195001_c1 3300050508 Bacteria 1753
557 nmdc:mga06r32_793752_c1 3300050510 Bacteria 908
558 nmdc:mga08y16_35353_c1 3300050511 Bacteria 5246
559 nmdc:mga0n895_125069_c1 3300050512 Unclassified 2595
560 nmdc:mga0n895_178341_c1 3300050512 Bacteria 2156
561 nmdc:mga0n895_49894_c1 3300050512 Bacteria 4103
562 nmdc:mga0n895_66531_c1 3300050512 Bacteria 3569
563 nmdc:mga0n895_92201_c1 3300050512 Bacteria 3032
564 nmdc:mga0rr50_127617_c1 3300050513 Bacteria 2033
565 nmdc:mga0rr50_422707_c1 3300050513 Bacteria 1127
566 nmdc:mga08x19_12275_c1 3300050514 Bacteria 5157
567 nmdc:mga0a205_171047_c1 3300050515 Bacteria 2069
568 nmdc:mga0a205_34027_c1 3300050515 Bacteria 4889
569 Ga0501082_0034185 3300060353 Bacteria 4385
570 Ga0466962_0211833 3300061719 Bacteria 948
571 Ga0466962_0227534 3300061719 Bacteria 914
572 Ga0530510_0003037 3300061734 Bacteria 11528
573 Ga0530510_0247240 3300061734 Bacteria 1329
574 Ga0530510_0374071 3300061734 Unclassified 1072
575 Ga0466959_0109137
576 JGI25407J50210_10002984
577 Ga0070658_10012532
578 Ga0070683_100005463
579 Ga0070683_100015609
580 Ga0070683_100032252
581 Ga0070683_100052937
582 Ga0070683_100209923
583 Ga0070683_100274395
584 Ga0070677_10084900
585 Ga0070680_100176494
586 Ga0070682_100026344
587 Ga0068868_100295565
588 Ga0068868_100859667
589 Ga0070660_100033989
590 Ga0070660_100058319
591 Ga0070660_100209550
592 Ga0070660_100245381
593 Ga0070691_10030797
594 Ga0070687_100255409
595 Ga0070661_100110506
596 Ga0070661_100151200
597 Ga0070661_100157487
598 Ga0070661_100556296
599 Ga0070668_100030366
600 Ga0070668_100180863
601 Ga0070668_100407551
602 Ga0070675_101258460
603 Ga0070673_101551915
604 Ga0070688_100488249
605 Ga0070659_100179524
606 Ga0070709_10044373
607 Ga0070714_100029076
608 Ga0070714_100066585
609 Ga0070714_100248543
610 Ga0070714_100256341
611 Ga0070714_100309845
612 Ga0070714_100400201
613 Ga0070714_100477092
614 Ga0070713_100239204
615 Ga0070710_10216409
616 Ga0070711_100059978
617 Ga0070711_100881561
618 Ga0070705_100047671
619 Ga0070705_100133960
620 Ga0070705_100866190
621 Ga0070700_100521862
622 Ga0070708_100013462
623 Ga0070708_100528493
624 Ga0070678_100513498
625 Ga0070662_100531211
626 Ga0070681_10005979
627 Ga0070681_10022436
628 Ga0070681_10129514
629 Ga0070681_10410132
630 Ga0068867_100175386
631 Ga0070706_100348344
632 Ga0070707_100005939
633 Ga0070707_100232656
634 Ga0070707_100356647
635 Ga0070699_100067851
636 Ga0070679_100001403
637 Ga0070679_100021038
638 Ga0070679_100155438
639 Ga0070679_100310245
640 Ga0070679_100336611
641 Ga0070684_100007800
642 Ga0070684_100009215
643 Ga0070684_100044829
644 Ga0070684_100114113
645 Ga0070697_100302999
646 Ga0068853_100210481
647 Ga0068853_100239378
648 Ga0070672_100275503
649 Ga0070695_100456568
650 Ga0070695_100528309
651 Ga0070693_100063632
652 Ga0070665_100473659
653 Ga0070665_101044475
654 Ga0070704_100118916
655 Ga0070704_100199413
656 Ga0070704_100398550
657 Ga0068855_100222558
658 Ga0068855_100441830
659 Ga0070664_100005843
660 Ga0070664_100014783
661 Ga0068857_100015432
662 Ga0068857_100038252
663 Ga0068857_100287382
664 Ga0068854_100087354
665 Ga0068856_100018994
666 Ga0068856_100030731
667 Ga0068856_100082703
668 Ga0068852_100128948
669 Ga0068861_100001363
670 Ga0068870_10048513
671 Ga0068870_10147880
672 Ga0081455_10011802
673 Ga0081455_10137214
674 Ga0081455_10549283
675 Ga0081538_10000231
676 Ga0081538_10004563
677 Ga0081538_10019510
678 Ga0081538_10037241
679 Ga0081538_10041325
680 Ga0081538_10155047
681 Ga0081540_1006022
682 Ga0081539_10001999
683 Ga0075432_10060344
684 Ga0075432_10074038
685 Ga0070716_100012415
686 Ga0070716_100040509
687 Ga0070716_100741032
688 Ga0070712_100003640
689 Ga0070712_100023331
690 Ga0097621_100132113
691 Ga0068871_100190650
692 Ga0075428_100009861
693 Ga0075428_100252409
694 Ga0075431_100037124
695 Ga0075433_10018453
696 Ga0075433_10349612
697 Ga0075433_10695288
698 Ga0075434_100008428
699 Ga0075429_100048270
700 Ga0068865_100149432
701 Ga0075436_100005731
702 Ga0075436_100011563
703 Ga0075435_100009889
704 Ga0075435_100055700
705 Ga0075435_100140438
706 Ga0075435_100169477
707 Ga0075435_100665821
708 Ga0105240_10360652
709 Ga0111539_10104754
710 Ga0111539_10468683
711 Ga0105245_10002363
712 Ga0105245_10005489
713 Ga0105245_10047176
714 Ga0105245_10108887
715 Ga0105245_10197903
716 Ga0105245_10321642
717 Ga0114129_10029648
718 Ga0114129_10330696
719 Ga0114129_10473929
720 Ga0114129_10820300
721 Ga0114129_11544725
722 Ga0105243_10199736
723 Ga0105243_10255107
724 Ga0105243_10467042
725 Ga0105243_10589656
726 Ga0105243_10991707
727 Ga0105241_10062175
728 Ga0105241_10077226
729 Ga0105241_11122151
730 Ga0105242_10008965
731 Ga0105242_11044676
732 Ga0105248_10487065
733 Ga0105237_10437756
734 Ga0105238_10304102
735 Ga0105249_10004966
736 Ga0105249_10253356
737 Ga0105249_11064516
738 Ga0105239_10509137
739 Ga0105239_10672710
740 Ga0105239_10760387
741 Ga0105246_10568890
742 Ga0105246_11091151
743 Ga0157370_10292983
744 Ga0157370_10369258
745 Ga0157370_10691051
746 Ga0157369_10009525
747 Ga0157369_10096757
748 Ga0157369_10681745
749 Ga0157369_10843527
750 Ga0157374_10108454
751 Ga0157374_10108588
752 Ga0157374_10482699
753 Ga0157378_11095281
754 Ga0163162_10082042
755 Ga0157372_10044068
756 Ga0157372_10258868
757 Ga0157375_11717507
758 Ga0157380_10249700
759 Ga0157380_11325766
760 Ga0182008_10006444
761 Ga0182008_10023236
762 Ga0157377_10016803
763 Ga0157377_10059614
764 Ga0157376_10163980
765 Ga0157376_10863413
766 Ga0163161_10052171
767 Ga0197907_10126759
768 Ga0206356_11131013
769 Ga0206354_11614219
770 Ga0206353_10308808
771 Ga0206353_12070242
772 Ga0207653_10000589
773 Ga0207642_10295687
774 Ga0207688_10240839
775 Ga0207647_10414123
776 Ga0207685_10035135
777 Ga0207699_10396544
778 Ga0207699_10584785
779 Ga0207643_10211518
780 Ga0207705_10001180
781 Ga0207705_10072044
782 Ga0207705_10251823
783 Ga0207684_10117602
784 Ga0207654_10122451
785 Ga0207654_10441682
786 Ga0207707_10017260
787 Ga0207707_10028393
788 Ga0207707_10096990
789 Ga0207707_10105705
790 Ga0207707_10120769
791 Ga0207693_10000495
792 Ga0207693_10003428
793 Ga0207693_10010444
794 Ga0207663_10003440
795 Ga0207663_10528900
796 Ga0207660_10007442
797 Ga0207660_10055962
798 Ga0207660_10208101
799 Ga0207657_10008781
800 Ga0207657_10026421
801 Ga0207657_10171993
802 Ga0207657_10180236
803 Ga0207649_10061616
804 Ga0207649_10083128
805 Ga0207649_10194246
806 Ga0207652_10010690
807 Ga0207652_10040821
808 Ga0207652_10252524
809 Ga0207646_10011714
810 Ga0207646_10109459
811 Ga0207646_10188077
812 Ga0207646_10517069
813 Ga0207687_10023022
814 Ga0207687_10025947
815 Ga0207687_10247442
816 Ga0207700_10521889
817 Ga0207664_10022406
818 Ga0207664_10025149
819 Ga0207664_10050242
820 Ga0207664_10111200
821 Ga0207664_10548244
822 Ga0207644_10147315
823 Ga0207690_10185208
824 Ga0207706_10013883
825 Ga0207706_10459842
826 Ga0207709_10144986
827 Ga0207709_10160272
828 Ga0207709_10227239
829 Ga0207704_10180822
830 Ga0207665_10021600
831 Ga0207665_10055879
832 Ga0207665_10107937
833 Ga0207691_10086709
834 Ga0207661_10002036
835 Ga0207661_10007125
836 Ga0207661_10020465
837 Ga0207661_10077742
838 Ga0207661_10116901
839 Ga0207679_10073477
840 Ga0207679_10100887
841 Ga0207679_10241209
842 Ga0207679_10620886
843 Ga0207651_11272644
844 Ga0207668_10021691
845 Ga0207668_10160622
846 Ga0207640_10372859
847 Ga0207677_10063005
848 Ga0207677_10175792
849 Ga0207639_10326483
850 Ga0207678_10576100
851 Ga0207702_10010080
852 Ga0207702_10089356
853 Ga0207702_10102085
854 Ga0207702_10353738
855 Ga0207648_10048570
856 Ga0207648_10294408
857 Ga0207648_10382090
858 Ga0207674_10021324
859 Ga0207674_10304063
860 Ga0207674_10606319
861 Ga0207675_100000541
862 Ga0207675_100017237
863 Ga0207683_10078094
864 Ga0207683_10296356
865 Ga0207428_10025525
866 Ga0207428_10129825
867 Ga0268266_10686121
868 Ga0268266_10834854
869 Ga0268265_10310993
870 Ga0265322_10078801
871 Ga0265338_10012044
872 Ga0265325_10051941
873 Ga0265339_10002969
874 Ga0265331_10051464
875 Ga0265327_10135534
876 Ga0265316_10050745
877 Ga0265342_10102593
878 Ga0307416_100444666
879 Ga0373930_0005814
880 Ga0373950_0009604
881 Ga0373959_0002201
882 Ga0373929_0006551
883 Ga0373949_0054504
884 Ga0373952_0006790
885 Ga0373932_0024602
886 Ga0373936_0098785
887 Ga0373939_0006438
888 Ga0373941_0011013
889 Ga0373941_0186302
890 Ga0373960_0016556
891 Ga0373962_0015150
892 Ga0373931_0514874
893 Ga0373935_0043236
894 Ga0395899_0001267
895 Ga0395899_0003370
896 Ga0395899_0016111
897 Ga0395899_0019986
898 Ga0395899_0043135
899 Ga0395900_0003489
900 Ga0395900_0023618
901 Ga0395900_0024974
902 Ga0395900_0057742
903 Ga0395900_0246123
904 Ga0395900_0294309
905 Ga0395900_0359511
906 Ga0395900_0566581
907 Ga0395900_0799610
908 Ga0395898_0001276
909 Ga0395898_0008267
910 Ga0395898_0011522
911 Ga0395898_0049382
912 Ga0395898_0137191
913 Ga0395898_0385436
914 Ga0395898_1438450
915 Ga0395905_0001281
916 Ga0395905_0019886
917 Ga0395905_0023643
918 Ga0395905_0036754
919 Ga0395905_0056847
920 Ga0395905_0088176
921 Ga0395905_0159439
922 Ga0395905_0245197
923 Ga0395905_0273895
924 Ga0395905_0759440
925 Ga0395901_0001957
926 Ga0395901_0018418
927 Ga0395901_0039754
928 Ga0395901_0052105
929 Ga0395901_0081441
930 Ga0395901_0088190
931 Ga0395901_0139015
932 Ga0395901_0175737
933 Ga0395901_0197150
934 Ga0395901_0218720
935 Ga0395901_0241648
936 Ga0395901_1292935
937 Ga0395901_1318235
938 Ga0439461_0047985
939 Ga0451798_0154163
940 Ga0451807_0137371
941 Ga0451847_0902794
942 Ga0451851_0725049
943 Ga0451853_2291318
944 Ga0451853_2615168
945 Ga0439448_0021235
946 Ga0439451_010264
947 Ga0439455_0058571
948 Ga0439458_0052636
949 Ga0439460_0034453
950 Ga0466966_0008334
951 Ga0466961_0124488
952 Ga0466961_0388041
953 Ga0466963_0007384
954 Ga0466963_0010625
955 Ga0466963_0020177
956 Ga0466963_0027038
957 Ga0466963_0163911
958 Ga0466964_0009904
959 Ga0453684_0993750
960 Ga0466971_0023800
961 Ga0466971_0221619
962 Ga0466968_0121330
963 Ga0466968_0124144
964 Ga0466957_0056605
965 Ga0466957_0123020
966 Ga0466957_0348736
967 Ga0466959_0018225
968 Ga0466959_0219058
969 Ga0451576_0043428
970 Ga0466958_0015851
971 Ga0466958_0023275
972 Ga0466958_0335559
973 Ga0466958_0412694
974 Ga0466967_0006616
975 Ga0466967_0022962
976 Ga0466967_0036019
977 Ga0466967_0051409
978 Ga0466967_0065565
979 Ga0466967_0090676
980 Ga0466967_0263572
981 Ga0466967_0413353
982 Ga0466967_0726853
983 Ga0466967_0782030
984 Ga0495629_0065495
985 Ga0495641_0012360
986 Ga0495641_0123199
987 Ga0495582_0042600
988 Ga0495582_0129387
989 Ga0495582_0201675
990 Ga0495605_0257774
991 Ga0495584_0101012
992 Ga0495584_0186451
993 Ga0495584_0246216
994 Ga0495596_0093000
995 Ga0495607_0205554
996 Ga0495630_0374329
997 Ga0495644_0086052
998 Ga0495644_0139395
999 Ga0495665_0040510
1000 Ga0495621_0155455
1001 Ga0495656_0305956
1002 Ga0495634_0296067
1003 Ga0495659_0141666
1004 Ga0495658_0018275
1005 Ga0495658_0021178
1006 Ga0495613_0067713
1007 Ga0495613_0440666
1008 Ga0495670_0210305
1009 Ga0495589_0031667
1010 Ga0495581_0000674
1011 Ga0495676_0098219
1012 Ga0495676_0103503
1013 Ga0495676_0470941
1014 Ga0495677_0058401
1015 Ga0495593_0066709
1016 Ga0495602_1006540
1017 Ga0495614_0056976
1018 Ga0496100_0004851
1019 Ga0496100_0021541
1020 Ga0496100_0100516
1021 Ga0496100_0485419
1022 Ga0496101_0008696
1023 Ga0496101_0045876
1024 Ga0496101_0047758
1025 Ga0496101_0070827
1026 Ga0496101_0763055
1027 Ga0496102_0040814
1028 Ga0496102_0148011
1029 Ga0496102_0864195
1030 Ga0496102_1023499
1031 Ga0496103_0008609
1032 Ga0496103_0037158
1033 Ga0496103_0409589
1034 Ga0496104_0002542
1035 Ga0496104_0038869
1036 Ga0496104_0066799
1037 Ga0496104_0136449
1038 Ga0496105_0000594
1039 Ga0496105_0069309
1040 Ga0496105_0331683
1041 Ga0496106_0075258
1042 Ga0496106_0087694
1043 Ga0496106_0442307
1044 Ga0496107_0044129
1045 Ga0496107_0066518
1046 Ga0496107_0092030
1047 Ga0496107_0391731
1048 Ga0496108_0002772
1049 Ga0496108_0052368
1050 Ga0496108_0152331
1051 Ga0496108_0179769
1052 Ga0496108_0195527
1053 Ga0496108_0263719
1054 Ga0496108_0434999
1055 Ga0496109_0000463
1056 Ga0496109_0007742
1057 Ga0496109_0013557
1058 Ga0496109_0025337
1059 Ga0496109_0034347
1060 Ga0496109_0168964
1061 Ga0496110_0000563
1062 Ga0496110_0007165
1063 Ga0496110_0019029
1064 Ga0496110_0043948
1065 Ga0496110_0081594
1066 Ga0496110_0148286
1067 Ga0496110_0326412
1068 Ga0496110_0701971
1069 Ga0496111_0007281
1070 Ga0496111_0010595
1071 Ga0496111_0076513
1072 Ga0496111_0351857
1073 Ga0496111_0637503
1074 Ga0496112_0016172
1075 Ga0496112_0016569
1076 Ga0496112_0031572
1077 Ga0496112_0081460
1078 Ga0496112_0101201
1079 Ga0496112_0581780
1080 Ga0496113_0056786
1081 Ga0496113_0107282
1082 Ga0496114_0000690
1083 Ga0496114_0008744
1084 Ga0496114_0012463
1085 Ga0496114_0031583
1086 Ga0496114_0171994
1087 Ga0496114_0351263
1088 Ga0496115_0006958
1089 Ga0496115_0196094
1090 Ga0501031_0031632
1091 Ga0501032_0025390
1092 Ga0501033_0040122
1093 Ga0501034_0021244
1094 Ga0501034_0480118
1095 Ga0501037_0011391
1096 Ga0501038_0008959
1097 Ga0501039_0020513
1098 Ga0501041_0005891
1099 Ga0501042_0005494
1100 Ga0501043_0036036
1101 Ga0501046_0028473
1102 Ga0501046_0241305
1103 Ga0501048_0008878
1104 Ga0501067_0077690
1105 Ga0501068_0026305
1106 Ga0501069_0005482
1107 Ga0501069_0029099
1108 Ga0501070_0020743
1109 Ga0501070_0029511
1110 Ga0501070_0089652
1111 Ga0501071_0031199
1112 Ga0501072_0032580
1113 Ga0501074_0005266
1114 Ga0501074_0016830
1115 Ga0501075_0008350
1116 Ga0501076_0003560
1117 Ga0501077_0007581
1118 Ga0501079_0010406
1119 Ga0501080_0000646
1120 Ga0501080_0047302
1121 Ga0501081_0008311
1122 Ga0501083_0007908
1123 Ga0501035_0070674
1124 Ga0501044_0095943
1125 Ga0501044_0314208
1126 nmdc:mga05p37_22552_c1
1127 nmdc:mga05p37_8824_c1
1128 nmdc:mga05p37_988564_c1
1129 nmdc:mga09592_151332_c1
1130 nmdc:mga09592_195001_c1
1131 nmdc:mga06r32_793752_c1
1132 nmdc:mga08y16_35353_c1
1133 nmdc:mga0n895_125069_c1
1134 nmdc:mga0n895_178341_c1
1135 nmdc:mga0n895_49894_c1
1136 nmdc:mga0n895_66531_c1
1137 nmdc:mga0n895_92201_c1
1138 nmdc:mga0rr50_127617_c1
1139 nmdc:mga0rr50_422707_c1
1140 nmdc:mga08x19_12275_c1
1141 nmdc:mga0a205_171047_c1
1142 nmdc:mga0a205_34027_c1
1143 Ga0501082_0034185
1144 Ga0466962_0211833
1145 Ga0466962_0227534
1146 Ga0530510_0003037
1147 Ga0530510_0247240
1148 Ga0530510_0374071

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

22

220

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r79-assembly3.cif.gz_A-2 crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9242 2 192
7f8e-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9147 2 191
7ygf-assembly3.cif.gz_C crystal structure of yggs from fusobacterium nucleatum 0.9143 2 191
6kzw-assembly2.cif.gz_B crystal structure of yggs family pyridoxal phosphate-dependent enzyme pipy from fusobacterium nucleatum 0.9136 2 191
1w8g-assembly1.cif.gz_A crystal structure of e. coli k-12 yggs 0.9114 2 192
ID Description Score Start End Superfamily
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9203 1 193 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9114 2 192 3.20.20.10
af_Q2FZ87_1_222_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9026 1 193 3.20.20.10
af_Q9P6Q1_1_232_3.20.20.10 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.8978 2 195 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.897 2 191 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A2V2SI98-F1-model_v4 deleted 0.9961 2 191
AF-A0A538H635-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9954 2 191 GO:0030170
AF-A0A538DPC4-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9909 31 124 GO:0030170
AF-A0A538F445-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9905 2 119 GO:0030170
AF-A0A538L8S1-F1-model_v4 YggS family pyridoxal phosphate enzyme 0.9898 1 193 GO:0009055
GO:0020037
GO:0030170
GO:0046872

Map