F465276
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 222 | 1148 | 100 |
Family's Representative Sequence
| Representative Sequence | 3300005338|Ga0068868_100873546|Ga0068868_1008735462 |
| Length | 102 |
| Sequence | MSVDADDPDDLLRQTVTELAARDDCVWAGIFFVEGHELVLGPEAGTPDLERRVGVPVTWRGERIAELVADGAVEPAELAEVAAGIADLCLVGWDTGGELWQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 7 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 30 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 32 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 37 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 38 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 39 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 40 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 41 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 47 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 51 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 53 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 57 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 83 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 84 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 85 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 86 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 87 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 88 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 89 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 90 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 91 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 92 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 93 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 94 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 95 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 96 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 97 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 98 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 99 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 100 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 101 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 102 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 103 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 104 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 105 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 107 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 108 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 109 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 110 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 111 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 112 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 113 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 114 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 115 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 116 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 117 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 118 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 119 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 120 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 121 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 122 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 123 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 124 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 125 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 126 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 127 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 128 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 129 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 130 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 131 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 132 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 133 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 195 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 196 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 197 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 198 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 199 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 200 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 201 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 202 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 204 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 205 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 206 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 207 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 208 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 209 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 210 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 214 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 215 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 216 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 217 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 222 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.83 |
| Metatranscriptomes | 0.17 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 10.1 |
| Rhizosphere | 89.72 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068868_100873546 | 3300005338 | Unclassified | 816 |
| 2 | Ga0070658_10029027 | 3300005327 | Bacteria | 4442 |
| 3 | Ga0070683_100033099 | 3300005329 | Bacteria | 4711 |
| 4 | Ga0070683_100176363 | 3300005329 | Bacteria | 2029 |
| 5 | Ga0070680_100020222 | 3300005336 | Bacteria | 5282 |
| 6 | Ga0070660_100279618 | 3300005339 | Bacteria | 1365 |
| 7 | Ga0070691_10065565 | 3300005341 | Bacteria | 1754 |
| 8 | Ga0070687_100935544 | 3300005343 | Unclassified | 624 |
| 9 | Ga0070661_100493760 | 3300005344 | Unclassified | 979 |
| 10 | Ga0070671_100377321 | 3300005355 | Unclassified | 1212 |
| 11 | Ga0070659_100566540 | 3300005366 | Bacteria | 973 |
| 12 | Ga0070709_10215543 | 3300005434 | Bacteria | 1366 |
| 13 | Ga0070714_100017044 | 3300005435 | Bacteria | 5880 |
| 14 | Ga0070714_100041854 | 3300005435 | Bacteria | 3868 |
| 15 | Ga0070714_100082104 | 3300005435 | Bacteria | 2807 |
| 16 | Ga0070714_100133382 | 3300005435 | Bacteria | 2221 |
| 17 | Ga0070714_100456265 | 3300005435 | Bacteria | 1215 |
| 18 | Ga0070714_101202173 | 3300005435 | Bacteria | 739 |
| 19 | Ga0070714_101668086 | 3300005435 | Unclassified | 623 |
| 20 | Ga0070713_100089995 | 3300005436 | Bacteria | 2637 |
| 21 | Ga0070713_100131149 | 3300005436 | Bacteria | 2210 |
| 22 | Ga0070713_100148289 | 3300005436 | Bacteria | 2084 |
| 23 | Ga0070713_100400577 | 3300005436 | Bacteria | 1282 |
| 24 | Ga0070710_10005551 | 3300005437 | Bacteria | 6004 |
| 25 | Ga0070710_10374342 | 3300005437 | Bacteria | 948 |
| 26 | Ga0070710_10965966 | 3300005437 | Bacteria | 619 |
| 27 | Ga0070710_11180612 | 3300005437 | Bacteria | 565 |
| 28 | Ga0070711_100037868 | 3300005439 | Bacteria | 3238 |
| 29 | Ga0070711_100122256 | 3300005439 | Bacteria | 1927 |
| 30 | Ga0070711_100189184 | 3300005439 | Bacteria | 1581 |
| 31 | Ga0070705_100558626 | 3300005440 | Bacteria | 879 |
| 32 | Ga0070694_100535929 | 3300005444 | Bacteria | 936 |
| 33 | Ga0070708_101608034 | 3300005445 | Unclassified | 605 |
| 34 | Ga0070663_101558836 | 3300005455 | Bacteria | 588 |
| 35 | Ga0070678_101431265 | 3300005456 | Bacteria | 646 |
| 36 | Ga0070681_10105062 | 3300005458 | Bacteria | 2766 |
| 37 | Ga0070681_10154961 | 3300005458 | Bacteria | 2216 |
| 38 | Ga0070707_100053472 | 3300005468 | Bacteria | 3872 |
| 39 | Ga0070707_101247126 | 3300005468 | Bacteria | 710 |
| 40 | Ga0070698_100175864 | 3300005471 | Bacteria | 2080 |
| 41 | Ga0070698_100369649 | 3300005471 | Bacteria | 1366 |
| 42 | Ga0070679_100153869 | 3300005530 | Bacteria | 2275 |
| 43 | Ga0070679_100224782 | 3300005530 | Bacteria | 1837 |
| 44 | Ga0070684_100068484 | 3300005535 | Bacteria | 3119 |
| 45 | Ga0070684_100220955 | 3300005535 | Bacteria | 1728 |
| 46 | Ga0070684_100737054 | 3300005535 | Unclassified | 919 |
| 47 | Ga0070684_102031398 | 3300005535 | Unclassified | 542 |
| 48 | Ga0070695_100009706 | 3300005545 | Bacteria | 5732 |
| 49 | Ga0070696_101017416 | 3300005546 | Unclassified | 693 |
| 50 | Ga0070696_101710802 | 3300005546 | Bacteria | 542 |
| 51 | Ga0070704_100154544 | 3300005549 | Bacteria | 1808 |
| 52 | Ga0068856_100057152 | 3300005614 | Bacteria | 3851 |
| 53 | Ga0068856_100904213 | 3300005614 | Bacteria | 902 |
| 54 | Ga0070702_101027901 | 3300005615 | Bacteria | 654 |
| 55 | Ga0070702_101077657 | 3300005615 | Bacteria | 641 |
| 56 | Ga0068862_102328216 | 3300005844 | Bacteria | 547 |
| 57 | Ga0070717_10008777 | 3300006028 | Bacteria | 7567 |
| 58 | Ga0070717_10012173 | 3300006028 | Bacteria | 6559 |
| 59 | Ga0070717_10024498 | 3300006028 | Bacteria | 4792 |
| 60 | Ga0070717_10071173 | 3300006028 | Bacteria | 2900 |
| 61 | Ga0070717_10080258 | 3300006028 | Bacteria | 2737 |
| 62 | Ga0070717_10272507 | 3300006028 | Bacteria | 1499 |
| 63 | Ga0070717_10842112 | 3300006028 | Bacteria | 834 |
| 64 | Ga0070715_10001143 | 3300006163 | Bacteria | 7581 |
| 65 | Ga0070715_10711507 | 3300006163 | Bacteria | 601 |
| 66 | Ga0070716_100007577 | 3300006173 | Bacteria | 5354 |
| 67 | Ga0070716_101053950 | 3300006173 | Bacteria | 646 |
| 68 | Ga0070712_100136857 | 3300006175 | Bacteria | 1864 |
| 69 | Ga0070712_100145704 | 3300006175 | Bacteria | 1812 |
| 70 | Ga0070712_101151912 | 3300006175 | Bacteria | 674 |
| 71 | Ga0070712_101174053 | 3300006175 | Bacteria | 667 |
| 72 | Ga0070712_101733128 | 3300006175 | Bacteria | 547 |
| 73 | Ga0070712_101909732 | 3300006175 | Unclassified | 520 |
| 74 | Ga0075433_10193155 | 3300006852 | Bacteria | 1811 |
| 75 | Ga0075434_100032113 | 3300006871 | Bacteria | 5176 |
| 76 | Ga0075436_100104450 | 3300006914 | Bacteria | 1975 |
| 77 | Ga0075436_100345329 | 3300006914 | Unclassified | 1072 |
| 78 | Ga0075435_100468767 | 3300007076 | Bacteria | 1087 |
| 79 | Ga0099795_10177152 | 3300007788 | Unclassified | 889 |
| 80 | Ga0105240_10123304 | 3300009093 | Bacteria | 3118 |
| 81 | Ga0105240_10467621 | 3300009093 | Bacteria | 1408 |
| 82 | Ga0105240_10959699 | 3300009093 | Bacteria | 916 |
| 83 | Ga0105245_10407924 | 3300009098 | Bacteria | 1359 |
| 84 | Ga0105245_10798074 | 3300009098 | Bacteria | 982 |
| 85 | Ga0105241_10155395 | 3300009174 | Bacteria | 1875 |
| 86 | Ga0105241_10399684 | 3300009174 | Unclassified | 1205 |
| 87 | Ga0105248_12765200 | 3300009177 | Bacteria | 560 |
| 88 | Ga0105237_10284587 | 3300009545 | Bacteria | 1656 |
| 89 | Ga0157369_10060976 | 3300013105 | Bacteria | 4067 |
| 90 | Ga0157369_10209514 | 3300013105 | Bacteria | 2043 |
| 91 | Ga0157369_11737868 | 3300013105 | Bacteria | 634 |
| 92 | Ga0163162_10148966 | 3300013306 | Bacteria | 2457 |
| 93 | Ga0157372_10044465 | 3300013307 | Bacteria | 4922 |
| 94 | Ga0157372_10371525 | 3300013307 | Bacteria | 1666 |
| 95 | Ga0157372_11282815 | 3300013307 | Bacteria | 845 |
| 96 | Ga0157372_11295488 | 3300013307 | Unclassified | 841 |
| 97 | Ga0157372_12670598 | 3300013307 | Unclassified | 573 |
| 98 | Ga0163163_11280075 | 3300014325 | Bacteria | 795 |
| 99 | Ga0182008_10372909 | 3300014497 | Unclassified | 761 |
| 100 | Ga0157376_10007904 | 3300014969 | Bacteria | 7630 |
| 101 | Ga0157376_11681760 | 3300014969 | Unclassified | 670 |
| 102 | Ga0157376_12136908 | 3300014969 | Bacteria | 598 |
| 103 | Ga0213871_10002024 | 3300021441 | Bacteria | 3625 |
| 104 | Ga0224712_10292303 | 3300022467 | Bacteria | 760 |
| 105 | Ga0207692_10626526 | 3300025898 | Unclassified | 693 |
| 106 | Ga0207685_10002797 | 3300025905 | Bacteria | 4087 |
| 107 | Ga0207685_10290741 | 3300025905 | Bacteria | 805 |
| 108 | Ga0207699_10008441 | 3300025906 | Bacteria | 5085 |
| 109 | Ga0207699_10084715 | 3300025906 | Bacteria | 1975 |
| 110 | Ga0207654_10246069 | 3300025911 | Bacteria | 1197 |
| 111 | Ga0207707_10929245 | 3300025912 | Bacteria | 718 |
| 112 | Ga0207707_11133051 | 3300025912 | Unclassified | 636 |
| 113 | Ga0207695_10468837 | 3300025913 | Bacteria | 1142 |
| 114 | Ga0207695_10943445 | 3300025913 | Bacteria | 742 |
| 115 | Ga0207695_11549892 | 3300025913 | Bacteria | 543 |
| 116 | Ga0207671_10100020 | 3300025914 | Bacteria | 2195 |
| 117 | Ga0207693_10000920 | 3300025915 | Bacteria | 26422 |
| 118 | Ga0207693_10056091 | 3300025915 | Bacteria | 3089 |
| 119 | Ga0207693_10984969 | 3300025915 | Bacteria | 644 |
| 120 | Ga0207663_10040434 | 3300025916 | Bacteria | 2834 |
| 121 | Ga0207663_10049943 | 3300025916 | Bacteria | 2597 |
| 122 | Ga0207663_11268661 | 3300025916 | Unclassified | 593 |
| 123 | Ga0207660_11165498 | 3300025917 | Bacteria | 627 |
| 124 | Ga0207657_10007057 | 3300025919 | Bacteria | 11541 |
| 125 | Ga0207649_10840893 | 3300025920 | Bacteria | 718 |
| 126 | Ga0207652_10070692 | 3300025921 | Bacteria | 3031 |
| 127 | Ga0207652_10083310 | 3300025921 | Bacteria | 2800 |
| 128 | Ga0207652_10519587 | 3300025921 | Unclassified | 1071 |
| 129 | Ga0207646_10003186 | 3300025922 | Bacteria | 18746 |
| 130 | Ga0207646_10720675 | 3300025922 | Bacteria | 891 |
| 131 | Ga0207694_11023191 | 3300025924 | Unclassified | 699 |
| 132 | Ga0207687_10070400 | 3300025927 | Bacteria | 2497 |
| 133 | Ga0207687_11795156 | 3300025927 | Bacteria | 525 |
| 134 | Ga0207700_10181093 | 3300025928 | Bacteria | 1764 |
| 135 | Ga0207700_10495829 | 3300025928 | Bacteria | 1080 |
| 136 | Ga0207664_10005724 | 3300025929 | Bacteria | 8499 |
| 137 | Ga0207664_10012625 | 3300025929 | Bacteria | 6044 |
| 138 | Ga0207664_10027641 | 3300025929 | Bacteria | 4303 |
| 139 | Ga0207664_10052104 | 3300025929 | Bacteria | 3235 |
| 140 | Ga0207664_10212947 | 3300025929 | Bacteria | 1673 |
| 141 | Ga0207664_10248641 | 3300025929 | Bacteria | 1551 |
| 142 | Ga0207664_10260880 | 3300025929 | Bacteria | 1515 |
| 143 | Ga0207664_11898742 | 3300025929 | Unclassified | 518 |
| 144 | Ga0207644_10413472 | 3300025931 | Bacteria | 1104 |
| 145 | Ga0207644_11021615 | 3300025931 | Bacteria | 694 |
| 146 | Ga0207690_11694655 | 3300025932 | Bacteria | 528 |
| 147 | Ga0207665_10000247 | 3300025939 | Bacteria | 37247 |
| 148 | Ga0207665_10109389 | 3300025939 | Bacteria | 1940 |
| 149 | Ga0207665_10402180 | 3300025939 | Bacteria | 1043 |
| 150 | Ga0207711_10410325 | 3300025941 | Bacteria | 1259 |
| 151 | Ga0207711_11358085 | 3300025941 | Bacteria | 653 |
| 152 | Ga0207661_10923063 | 3300025944 | Bacteria | 804 |
| 153 | Ga0207667_11748582 | 3300025949 | Unclassified | 587 |
| 154 | Ga0207702_10269760 | 3300026078 | Bacteria | 1605 |
| 155 | Ga0207702_11569370 | 3300026078 | Unclassified | 651 |
| 156 | Ga0207683_10886003 | 3300026121 | Unclassified | 829 |
| 157 | Ga0207698_12467477 | 3300026142 | Bacteria | 530 |
| 158 | Ga0268265_11482385 | 3300028380 | Bacteria | 682 |
| 159 | Ga0265337_1055201 | 3300028556 | Unclassified | 1110 |
| 160 | Ga0265336_10010674 | 3300028666 | Bacteria | 3144 |
| 161 | Ga0265338_10126146 | 3300028800 | Bacteria | 2030 |
| 162 | Ga0265325_10163300 | 3300031241 | Bacteria | 1046 |
| 163 | Ga0265325_10332501 | 3300031241 | Unclassified | 673 |
| 164 | Ga0265340_10296098 | 3300031247 | Unclassified | 718 |
| 165 | Ga0265339_10160011 | 3300031249 | Bacteria | 1133 |
| 166 | Ga0265331_10190649 | 3300031250 | Unclassified | 925 |
| 167 | Ga0265327_10174949 | 3300031251 | Unclassified | 984 |
| 168 | Ga0265316_10097900 | 3300031344 | Bacteria | 2232 |
| 169 | Ga0265313_10028282 | 3300031595 | Bacteria | 2917 |
| 170 | Ga0265313_10128221 | 3300031595 | Bacteria | 1101 |
| 171 | Ga0265314_10044092 | 3300031711 | Bacteria | 3164 |
| 172 | Ga0265342_10062192 | 3300031712 | Bacteria | 2198 |
| 173 | Ga0373926_0035748 | 3300035083 | Bacteria | 1763 |
| 174 | Ga0373929_0034313 | 3300035085 | Bacteria | 1100 |
| 175 | Ga0373934_0033658 | 3300035086 | Bacteria | 2012 |
| 176 | Ga0373944_0401694 | 3300035089 | Bacteria | 528 |
| 177 | Ga0373923_0142458 | 3300035111 | Bacteria | 1084 |
| 178 | Ga0373936_0009693 | 3300035113 | Bacteria | 3631 |
| 179 | Ga0373953_0139413 | 3300035117 | Bacteria | 1037 |
| 180 | Ga0373953_0241338 | 3300035117 | Unclassified | 785 |
| 181 | Ga0373954_0219284 | 3300035118 | Bacteria | 936 |
| 182 | Ga0373954_0470906 | 3300035118 | Unclassified | 622 |
| 183 | Ga0373960_0145081 | 3300035121 | Unclassified | 807 |
| 184 | Ga0373943_0002789 | 3300035170 | Bacteria | 7945 |
| 185 | Ga0373943_0390896 | 3300035170 | Bacteria | 802 |
| 186 | Ga0373943_0536929 | 3300035170 | Bacteria | 686 |
| 187 | Ga0373946_0004467 | 3300035171 | Bacteria | 5008 |
| 188 | Ga0373955_0223890 | 3300035172 | Bacteria | 1124 |
| 189 | Ga0373924_0180569 | 3300035410 | Unclassified | 929 |
| 190 | Ga0373931_0541462 | 3300035691 | Bacteria | 755 |
| 191 | Ga0373935_0222211 | 3300035692 | Bacteria | 1312 |
| 192 | Ga0373927_0162189 | 3300035695 | Bacteria | 1464 |
| 193 | Ga0373933_0419818 | 3300035724 | Unclassified | 874 |
| 194 | Ga0373933_0569949 | 3300035724 | Bacteria | 743 |
| 195 | Ga0373947_1240694 | 3300035725 | Bacteria | 508 |
| 196 | Ga0373937_0000355 | 3300036401 | Bacteria | 42585 |
| 197 | Ga0373937_0421635 | 3300036401 | Bacteria | 1267 |
| 198 | Ga0373925_0082747 | 3300037068 | Bacteria | 2443 |
| 199 | Ga0373925_0374524 | 3300037068 | Bacteria | 1159 |
| 200 | Ga0395899_0564187 | 3300037312 | Bacteria | 730 |
| 201 | Ga0395900_0135664 | 3300037418 | Bacteria | 2521 |
| 202 | Ga0395900_0529262 | 3300037418 | Bacteria | 1126 |
| 203 | Ga0395900_1033089 | 3300037418 | Unclassified | 741 |
| 204 | Ga0395901_0026769 | 3300038443 | Bacteria | 5921 |
| 205 | Ga0395901_1297036 | 3300038443 | Bacteria | 690 |
| 206 | Ga0436360_0052335 | 3300039438 | Bacteria | 6752 |
| 207 | Ga0451577_0212024 | 3300042876 | Bacteria | 1750 |
| 208 | Ga0466969_0000591 | 3300044656 | Bacteria | 19709 |
| 209 | Ga0466965_0065742 | 3300044683 | Bacteria | 1817 |
| 210 | Ga0466965_0500394 | 3300044683 | Bacteria | 681 |
| 211 | Ga0466966_0082306 | 3300044684 | Bacteria | 2003 |
| 212 | Ga0466966_0238648 | 3300044684 | Bacteria | 1096 |
| 213 | Ga0466961_0025254 | 3300044693 | Bacteria | 3821 |
| 214 | Ga0466961_0025331 | 3300044693 | Bacteria | 3815 |
| 215 | Ga0466961_0100878 | 3300044693 | Bacteria | 1818 |
| 216 | Ga0466961_0111684 | 3300044693 | Bacteria | 1719 |
| 217 | Ga0466963_0000871 | 3300044694 | Bacteria | 15281 |
| 218 | Ga0466963_0001043 | 3300044694 | Bacteria | 14384 |
| 219 | Ga0466963_0001689 | 3300044694 | Bacteria | 12020 |
| 220 | Ga0466963_0002486 | 3300044694 | Bacteria | 10306 |
| 221 | Ga0466963_0012681 | 3300044694 | Bacteria | 5162 |
| 222 | Ga0466963_0014974 | 3300044694 | Bacteria | 4792 |
| 223 | Ga0466963_0032721 | 3300044694 | Bacteria | 3369 |
| 224 | Ga0466963_0033719 | 3300044694 | Bacteria | 3326 |
| 225 | Ga0466963_0049198 | 3300044694 | Bacteria | 2787 |
| 226 | Ga0466963_0067249 | 3300044694 | Bacteria | 2404 |
| 227 | Ga0466963_0084756 | 3300044694 | Bacteria | 2150 |
| 228 | Ga0466963_0125033 | 3300044694 | Bacteria | 1772 |
| 229 | Ga0466963_0262564 | 3300044694 | Bacteria | 1212 |
| 230 | Ga0466963_0439403 | 3300044694 | Unclassified | 920 |
| 231 | Ga0466963_0630496 | 3300044694 | Unclassified | 757 |
| 232 | Ga0466963_0662784 | 3300044694 | Unclassified | 736 |
| 233 | Ga0466963_0731326 | 3300044694 | Unclassified | 698 |
| 234 | Ga0466963_1198249 | 3300044694 | Bacteria | 533 |
| 235 | Ga0466964_0006431 | 3300044706 | Bacteria | 4377 |
| 236 | Ga0466964_0010339 | 3300044706 | Bacteria | 3520 |
| 237 | Ga0466964_0010666 | 3300044706 | Bacteria | 3467 |
| 238 | Ga0466964_0011937 | 3300044706 | Bacteria | 3284 |
| 239 | Ga0466964_0065430 | 3300044706 | Bacteria | 1523 |
| 240 | Ga0466964_0221827 | 3300044706 | Bacteria | 918 |
| 241 | Ga0466964_0516926 | 3300044706 | Bacteria | 643 |
| 242 | Ga0466964_0581652 | 3300044706 | Unclassified | 612 |
| 243 | Ga0466964_0626531 | 3300044706 | Bacteria | 592 |
| 244 | Ga0466971_0002846 | 3300044719 | Bacteria | 7336 |
| 245 | Ga0466971_0009961 | 3300044719 | Bacteria | 4151 |
| 246 | Ga0466971_0089829 | 3300044719 | Bacteria | 1406 |
| 247 | Ga0466968_0002250 | 3300044735 | Bacteria | 7058 |
| 248 | Ga0466968_0018226 | 3300044735 | Bacteria | 2814 |
| 249 | Ga0466968_0050404 | 3300044735 | Bacteria | 1776 |
| 250 | Ga0466968_0097976 | 3300044735 | Bacteria | 1306 |
| 251 | Ga0466968_0113857 | 3300044735 | Bacteria | 1218 |
| 252 | Ga0466968_0148588 | 3300044735 | Bacteria | 1076 |
| 253 | Ga0466968_0244895 | 3300044735 | Unclassified | 850 |
| 254 | Ga0466968_0300860 | 3300044735 | Bacteria | 771 |
| 255 | Ga0466968_0305447 | 3300044735 | Unclassified | 766 |
| 256 | Ga0466968_0443659 | 3300044735 | Bacteria | 641 |
| 257 | Ga0466968_0749286 | 3300044735 | Bacteria | 501 |
| 258 | Ga0466970_0077611 | 3300044765 | Bacteria | 1791 |
| 259 | Ga0466970_0144889 | 3300044765 | Bacteria | 1310 |
| 260 | Ga0466957_0007870 | 3300044842 | Bacteria | 6044 |
| 261 | Ga0466957_0015917 | 3300044842 | Bacteria | 4396 |
| 262 | Ga0466957_0015978 | 3300044842 | Bacteria | 4386 |
| 263 | Ga0466957_0062440 | 3300044842 | Bacteria | 2288 |
| 264 | Ga0466957_0241772 | 3300044842 | Bacteria | 1198 |
| 265 | Ga0466957_0303934 | 3300044842 | Bacteria | 1072 |
| 266 | Ga0466960_0022463 | 3300044901 | Bacteria | 2821 |
| 267 | Ga0466960_0057200 | 3300044901 | Bacteria | 1901 |
| 268 | Ga0466960_0192142 | 3300044901 | Bacteria | 1111 |
| 269 | Ga0466960_0777107 | 3300044901 | Bacteria | 579 |
| 270 | Ga0466959_0006164 | 3300045049 | Bacteria | 8285 |
| 271 | Ga0466959_0070978 | 3300045049 | Bacteria | 2523 |
| 272 | Ga0466959_0132717 | 3300045049 | Bacteria | 1764 |
| 273 | Ga0466958_0001514 | 3300045836 | Bacteria | 11125 |
| 274 | Ga0466958_0005900 | 3300045836 | Bacteria | 6620 |
| 275 | Ga0466958_0008230 | 3300045836 | Bacteria | 5775 |
| 276 | Ga0466958_0017218 | 3300045836 | Bacteria | 4173 |
| 277 | Ga0466958_0026435 | 3300045836 | Bacteria | 3430 |
| 278 | Ga0466958_0056485 | 3300045836 | Bacteria | 2384 |
| 279 | Ga0466958_0398368 | 3300045836 | Bacteria | 889 |
| 280 | Ga0466958_0422748 | 3300045836 | Bacteria | 861 |
| 281 | Ga0466967_0000173 | 3300045976 | Bacteria | 26504 |
| 282 | Ga0466967_0001483 | 3300045976 | Bacteria | 13692 |
| 283 | Ga0466967_0009541 | 3300045976 | Bacteria | 7209 |
| 284 | Ga0466967_0025980 | 3300045976 | Bacteria | 4840 |
| 285 | Ga0466967_0030265 | 3300045976 | Bacteria | 4541 |
| 286 | Ga0466967_0035242 | 3300045976 | Bacteria | 4257 |
| 287 | Ga0466967_0037934 | 3300045976 | Bacteria | 4129 |
| 288 | Ga0466967_0046397 | 3300045976 | Bacteria | 3782 |
| 289 | Ga0466967_0048433 | 3300045976 | Bacteria | 3710 |
| 290 | Ga0466967_0056230 | 3300045976 | Bacteria | 3468 |
| 291 | Ga0466967_0071866 | 3300045976 | Bacteria | 3099 |
| 292 | Ga0466967_0080509 | 3300045976 | Bacteria | 2939 |
| 293 | Ga0466967_0133655 | 3300045976 | Bacteria | 2305 |
| 294 | Ga0466967_0155053 | 3300045976 | Bacteria | 2144 |
| 295 | Ga0466967_0194025 | 3300045976 | Bacteria | 1920 |
| 296 | Ga0466967_0219134 | 3300045976 | Bacteria | 1807 |
| 297 | Ga0466967_0473342 | 3300045976 | Bacteria | 1226 |
| 298 | Ga0466967_1078260 | 3300045976 | Unclassified | 800 |
| 299 | Ga0466967_1448233 | 3300045976 | Bacteria | 684 |
| 300 | Ga0495592_0000635 | 3300046454 | Bacteria | 24391 |
| 301 | Ga0495592_0000769 | 3300046454 | Bacteria | 22286 |
| 302 | Ga0495592_0255814 | 3300046454 | Bacteria | 1155 |
| 303 | Ga0495592_0366300 | 3300046454 | Bacteria | 920 |
| 304 | Ga0495603_0012764 | 3300046455 | Bacteria | 5080 |
| 305 | Ga0495603_0387814 | 3300046455 | Bacteria | 801 |
| 306 | Ga0495629_0048615 | 3300046459 | Bacteria | 2973 |
| 307 | Ga0495629_0331547 | 3300046459 | Unclassified | 1039 |
| 308 | Ga0495629_0351677 | 3300046459 | Bacteria | 1005 |
| 309 | Ga0495641_0021247 | 3300046461 | Bacteria | 3268 |
| 310 | Ga0495641_0056809 | 3300046461 | Bacteria | 1773 |
| 311 | Ga0495641_0057633 | 3300046461 | Bacteria | 1759 |
| 312 | Ga0495641_0264111 | 3300046461 | Unclassified | 774 |
| 313 | Ga0495641_0300788 | 3300046461 | Unclassified | 723 |
| 314 | Ga0495651_0000029 | 3300046462 | Bacteria | 105042 |
| 315 | Ga0495651_0403323 | 3300046462 | Bacteria | 892 |
| 316 | Ga0495651_0462084 | 3300046462 | Bacteria | 818 |
| 317 | Ga0495653_0003221 | 3300046463 | Bacteria | 13077 |
| 318 | Ga0495653_0036940 | 3300046463 | Bacteria | 3843 |
| 319 | Ga0495653_0071061 | 3300046463 | Bacteria | 2603 |
| 320 | Ga0495653_0093395 | 3300046463 | Bacteria | 2194 |
| 321 | Ga0495653_0223265 | 3300046463 | Bacteria | 1265 |
| 322 | Ga0495653_0546534 | 3300046463 | Bacteria | 717 |
| 323 | Ga0495580_0050971 | 3300046472 | Bacteria | 2926 |
| 324 | Ga0495580_0531272 | 3300046472 | Bacteria | 783 |
| 325 | Ga0495582_0170642 | 3300046473 | Bacteria | 1238 |
| 326 | Ga0495582_0182664 | 3300046473 | Bacteria | 1195 |
| 327 | Ga0495582_0250913 | 3300046473 | Bacteria | 1015 |
| 328 | Ga0495582_0264042 | 3300046473 | Bacteria | 987 |
| 329 | Ga0495582_0312659 | 3300046473 | Unclassified | 904 |
| 330 | Ga0495605_0063632 | 3300046474 | Bacteria | 1759 |
| 331 | Ga0495639_0002681 | 3300046475 | Bacteria | 7730 |
| 332 | Ga0495639_0329808 | 3300046475 | Unclassified | 764 |
| 333 | Ga0495662_0011724 | 3300046476 | Bacteria | 4285 |
| 334 | Ga0495662_0014853 | 3300046476 | Bacteria | 3783 |
| 335 | Ga0495664_0007196 | 3300046477 | Bacteria | 6170 |
| 336 | Ga0495664_0045576 | 3300046477 | Bacteria | 2600 |
| 337 | Ga0495664_0135257 | 3300046477 | Bacteria | 1493 |
| 338 | Ga0495664_0244377 | 3300046477 | Unclassified | 1085 |
| 339 | Ga0495664_0353612 | 3300046477 | Unclassified | 884 |
| 340 | Ga0495664_0614618 | 3300046477 | Bacteria | 645 |
| 341 | Ga0495584_0066410 | 3300046491 | Bacteria | 1814 |
| 342 | Ga0495594_0232163 | 3300046499 | Bacteria | 1052 |
| 343 | Ga0495594_0342603 | 3300046499 | Bacteria | 851 |
| 344 | Ga0495594_0475781 | 3300046499 | Unclassified | 710 |
| 345 | Ga0495594_0488433 | 3300046499 | Unclassified | 700 |
| 346 | Ga0495607_0112495 | 3300046501 | Bacteria | 1441 |
| 347 | Ga0495608_0008612 | 3300046511 | Bacteria | 7142 |
| 348 | Ga0495608_0117279 | 3300046511 | Bacteria | 1708 |
| 349 | Ga0495608_0558337 | 3300046511 | Bacteria | 689 |
| 350 | Ga0495618_0001935 | 3300046514 | Bacteria | 13569 |
| 351 | Ga0495618_0159673 | 3300046514 | Bacteria | 1437 |
| 352 | Ga0495618_0171347 | 3300046514 | Bacteria | 1381 |
| 353 | Ga0495618_0187311 | 3300046514 | Bacteria | 1313 |
| 354 | Ga0495618_0279493 | 3300046514 | Bacteria | 1041 |
| 355 | Ga0495628_0000016 | 3300046516 | Bacteria | 170260 |
| 356 | Ga0495628_0081995 | 3300046516 | Bacteria | 2505 |
| 357 | Ga0495628_0817008 | 3300046516 | Unclassified | 651 |
| 358 | Ga0495630_0010255 | 3300046517 | Bacteria | 6760 |
| 359 | Ga0495630_0041538 | 3300046517 | Bacteria | 3434 |
| 360 | Ga0495630_0102755 | 3300046517 | Bacteria | 2162 |
| 361 | Ga0495630_0423075 | 3300046517 | Unclassified | 1020 |
| 362 | Ga0495630_0756489 | 3300046517 | Unclassified | 742 |
| 363 | Ga0495631_0152875 | 3300046518 | Bacteria | 990 |
| 364 | Ga0495644_0034283 | 3300046523 | Bacteria | 1916 |
| 365 | Ga0495663_0054293 | 3300046525 | Bacteria | 1247 |
| 366 | Ga0495666_0001728 | 3300046526 | Bacteria | 10773 |
| 367 | Ga0495666_0114151 | 3300046526 | Bacteria | 1268 |
| 368 | Ga0495642_0049361 | 3300046528 | Bacteria | 1728 |
| 369 | Ga0495652_0001228 | 3300046529 | Bacteria | 28728 |
| 370 | Ga0495652_0011063 | 3300046529 | Bacteria | 8176 |
| 371 | Ga0495652_0075687 | 3300046529 | Bacteria | 2795 |
| 372 | Ga0495652_0305759 | 3300046529 | Bacteria | 1154 |
| 373 | Ga0495652_0367901 | 3300046529 | Bacteria | 1025 |
| 374 | Ga0495665_0020866 | 3300046531 | Bacteria | 3519 |
| 375 | Ga0495640_0047657 | 3300046533 | Bacteria | 2965 |
| 376 | Ga0495640_0055771 | 3300046533 | Bacteria | 2702 |
| 377 | Ga0495640_0224494 | 3300046533 | Bacteria | 1183 |
| 378 | Ga0495640_0321382 | 3300046533 | Bacteria | 958 |
| 379 | Ga0495586_0026226 | 3300046535 | Bacteria | 3118 |
| 380 | Ga0495586_0103981 | 3300046535 | Bacteria | 1577 |
| 381 | Ga0495586_0146656 | 3300046535 | Bacteria | 1326 |
| 382 | Ga0495586_0167849 | 3300046535 | Bacteria | 1239 |
| 383 | Ga0495587_0000434 | 3300046536 | Bacteria | 29352 |
| 384 | Ga0495587_0021328 | 3300046536 | Bacteria | 3994 |
| 385 | Ga0495587_0231021 | 3300046536 | Bacteria | 1042 |
| 386 | Ga0495598_0052853 | 3300046537 | Bacteria | 1229 |
| 387 | Ga0495609_0047750 | 3300046538 | Bacteria | 1915 |
| 388 | Ga0495645_0000367 | 3300046543 | Bacteria | 31425 |
| 389 | Ga0495645_0009395 | 3300046543 | Bacteria | 6836 |
| 390 | Ga0495645_0191154 | 3300046543 | Bacteria | 1395 |
| 391 | Ga0495645_0972668 | 3300046543 | Unclassified | 500 |
| 392 | Ga0495667_0028356 | 3300046559 | Bacteria | 3770 |
| 393 | Ga0495667_0062525 | 3300046559 | Bacteria | 2439 |
| 394 | Ga0495667_0398152 | 3300046559 | Bacteria | 867 |
| 395 | Ga0495667_0512084 | 3300046559 | Bacteria | 751 |
| 396 | Ga0495656_0008107 | 3300046615 | Bacteria | 3739 |
| 397 | Ga0495634_0200365 | 3300046642 | Bacteria | 1240 |
| 398 | Ga0495634_0205587 | 3300046642 | Bacteria | 1221 |
| 399 | Ga0495634_0208878 | 3300046642 | Unclassified | 1209 |
| 400 | Ga0495634_0218501 | 3300046642 | Bacteria | 1177 |
| 401 | Ga0495634_0762202 | 3300046642 | Bacteria | 553 |
| 402 | Ga0495611_0173314 | 3300046648 | Bacteria | 1008 |
| 403 | Ga0495635_0088310 | 3300046663 | Bacteria | 2121 |
| 404 | Ga0495635_0218802 | 3300046663 | Bacteria | 1288 |
| 405 | Ga0495635_0255206 | 3300046663 | Unclassified | 1181 |
| 406 | Ga0495635_0782561 | 3300046663 | Bacteria | 615 |
| 407 | Ga0495661_0087600 | 3300046665 | Bacteria | 1780 |
| 408 | Ga0495588_0249961 | 3300046674 | Unclassified | 935 |
| 409 | Ga0495657_0002796 | 3300046675 | Bacteria | 14500 |
| 410 | Ga0495657_0003896 | 3300046675 | Bacteria | 12010 |
| 411 | Ga0495657_0108292 | 3300046675 | Bacteria | 1763 |
| 412 | Ga0495657_0547502 | 3300046675 | Unclassified | 672 |
| 413 | Ga0495657_0583949 | 3300046675 | Bacteria | 647 |
| 414 | Ga0495599_0000187 | 3300046678 | Bacteria | 40807 |
| 415 | Ga0495599_0001457 | 3300046678 | Bacteria | 13574 |
| 416 | Ga0495599_0227875 | 3300046678 | Bacteria | 1138 |
| 417 | Ga0495623_0000121 | 3300046679 | Bacteria | 47882 |
| 418 | Ga0495623_0053918 | 3300046679 | Bacteria | 2538 |
| 419 | Ga0495646_0000742 | 3300046680 | Bacteria | 18135 |
| 420 | Ga0495646_0294471 | 3300046680 | Bacteria | 860 |
| 421 | Ga0495647_0035085 | 3300046681 | Bacteria | 1881 |
| 422 | Ga0495647_0124002 | 3300046681 | Unclassified | 1089 |
| 423 | Ga0495647_0133263 | 3300046681 | Bacteria | 1054 |
| 424 | Ga0495647_0625496 | 3300046681 | Bacteria | 506 |
| 425 | Ga0495658_0055353 | 3300046683 | Bacteria | 2259 |
| 426 | Ga0495658_0449291 | 3300046683 | Bacteria | 823 |
| 427 | Ga0495658_0617489 | 3300046683 | Unclassified | 694 |
| 428 | Ga0495613_0048649 | 3300046689 | Bacteria | 3131 |
| 429 | Ga0495613_0051744 | 3300046689 | Bacteria | 3026 |
| 430 | Ga0495613_0096978 | 3300046689 | Bacteria | 2132 |
| 431 | Ga0495613_0348970 | 3300046689 | Bacteria | 1016 |
| 432 | Ga0495624_0013715 | 3300046690 | Bacteria | 5518 |
| 433 | Ga0495624_0034100 | 3300046690 | Bacteria | 3294 |
| 434 | Ga0495624_0055294 | 3300046690 | Bacteria | 2500 |
| 435 | Ga0495589_0047317 | 3300046794 | Bacteria | 2132 |
| 436 | Ga0495600_0022357 | 3300046809 | Bacteria | 4058 |
| 437 | Ga0495600_0478020 | 3300046809 | Bacteria | 768 |
| 438 | Ga0495581_0013623 | 3300047315 | Bacteria | 4716 |
| 439 | Ga0495581_0066952 | 3300047315 | Bacteria | 2077 |
| 440 | Ga0495581_0578464 | 3300047315 | Unclassified | 651 |
| 441 | Ga0495581_0775892 | 3300047315 | Unclassified | 551 |
| 442 | Ga0495604_0000628 | 3300047317 | Bacteria | 30365 |
| 443 | Ga0495604_0053337 | 3300047317 | Bacteria | 3126 |
| 444 | Ga0495604_0121086 | 3300047317 | Bacteria | 1894 |
| 445 | Ga0495604_0341924 | 3300047317 | Unclassified | 996 |
| 446 | Ga0495636_0028003 | 3300047318 | Bacteria | 2296 |
| 447 | Ga0495674_0096821 | 3300047319 | Bacteria | 2514 |
| 448 | Ga0495674_0161360 | 3300047319 | Bacteria | 1875 |
| 449 | Ga0495674_0328870 | 3300047319 | Bacteria | 1244 |
| 450 | Ga0495674_0612585 | 3300047319 | Bacteria | 861 |
| 451 | Ga0495676_0131799 | 3300047321 | Bacteria | 1803 |
| 452 | Ga0495676_0273683 | 3300047321 | Bacteria | 1145 |
| 453 | Ga0495676_0453934 | 3300047321 | Bacteria | 845 |
| 454 | Ga0495676_0458510 | 3300047321 | Unclassified | 840 |
| 455 | Ga0495676_0585364 | 3300047321 | Bacteria | 727 |
| 456 | Ga0495680_0002048 | 3300047322 | Bacteria | 21061 |
| 457 | Ga0495680_0040968 | 3300047322 | Bacteria | 3685 |
| 458 | Ga0495680_0056576 | 3300047322 | Bacteria | 3036 |
| 459 | Ga0495680_0086017 | 3300047322 | Bacteria | 2366 |
| 460 | Ga0495680_0091971 | 3300047322 | Bacteria | 2273 |
| 461 | Ga0495680_0557781 | 3300047322 | Bacteria | 771 |
| 462 | Ga0495675_0000031 | 3300047444 | Bacteria | 99240 |
| 463 | Ga0495677_0083042 | 3300047445 | Bacteria | 1202 |
| 464 | Ga0495684_0009072 | 3300047471 | Bacteria | 7681 |
| 465 | Ga0495684_0041052 | 3300047471 | Bacteria | 3546 |
| 466 | Ga0495684_0074185 | 3300047471 | Bacteria | 2584 |
| 467 | Ga0495684_0134268 | 3300047471 | Bacteria | 1857 |
| 468 | Ga0495684_0179522 | 3300047471 | Bacteria | 1570 |
| 469 | Ga0495684_0201006 | 3300047471 | Bacteria | 1469 |
| 470 | Ga0495593_0018216 | 3300047673 | Bacteria | 3948 |
| 471 | Ga0495593_0078079 | 3300047673 | Bacteria | 1715 |
| 472 | Ga0495602_0000133 | 3300048088 | Bacteria | 69392 |
| 473 | Ga0495602_0018304 | 3300048088 | Bacteria | 7000 |
| 474 | Ga0495602_0213416 | 3300048088 | Bacteria | 1463 |
| 475 | Ga0495614_0011907 | 3300048089 | Bacteria | 3822 |
| 476 | Ga0496100_0011817 | 3300048903 | Bacteria | 4981 |
| 477 | Ga0496100_0099642 | 3300048903 | Bacteria | 2000 |
| 478 | Ga0496100_0183828 | 3300048903 | Bacteria | 1513 |
| 479 | Ga0496100_0200765 | 3300048903 | Bacteria | 1453 |
| 480 | Ga0496100_0502937 | 3300048903 | Archaea | 934 |
| 481 | Ga0496100_1269450 | 3300048903 | Bacteria | 581 |
| 482 | Ga0496101_0189621 | 3300048904 | Bacteria | 1586 |
| 483 | Ga0496101_0254915 | 3300048904 | Bacteria | 1367 |
| 484 | Ga0496101_0406060 | 3300048904 | Unclassified | 1073 |
| 485 | Ga0496101_0463292 | 3300048904 | Bacteria | 1000 |
| 486 | Ga0496101_0568599 | 3300048904 | Unclassified | 896 |
| 487 | Ga0496101_0694904 | 3300048904 | Bacteria | 803 |
| 488 | Ga0496102_0353437 | 3300048905 | Bacteria | 1384 |
| 489 | Ga0496102_0650753 | 3300048905 | Unclassified | 977 |
| 490 | Ga0496103_0037168 | 3300048906 | Bacteria | 2983 |
| 491 | Ga0496104_0005551 | 3300048907 | Bacteria | 11047 |
| 492 | Ga0496104_0055658 | 3300048907 | Bacteria | 3740 |
| 493 | Ga0496104_0322206 | 3300048907 | Bacteria | 1458 |
| 494 | Ga0496104_0536779 | 3300048907 | Unclassified | 1080 |
| 495 | Ga0496105_0039159 | 3300048908 | Bacteria | 3906 |
| 496 | Ga0496105_0070205 | 3300048908 | Bacteria | 2895 |
| 497 | Ga0496105_0652155 | 3300048908 | Bacteria | 812 |
| 498 | Ga0496106_0063164 | 3300048909 | Bacteria | 2813 |
| 499 | Ga0496106_0939491 | 3300048909 | Bacteria | 682 |
| 500 | Ga0496107_0026994 | 3300048910 | Bacteria | 4075 |
| 501 | Ga0496107_0202988 | 3300048910 | Bacteria | 1473 |
| 502 | Ga0496107_0469156 | 3300048910 | Bacteria | 934 |
| 503 | Ga0496107_0557468 | 3300048910 | Bacteria | 848 |
| 504 | Ga0496107_0753134 | 3300048910 | Bacteria | 715 |
| 505 | Ga0496108_0089334 | 3300048911 | Bacteria | 2618 |
| 506 | Ga0496108_0136557 | 3300048911 | Bacteria | 2110 |
| 507 | Ga0496108_0144943 | 3300048911 | Bacteria | 2047 |
| 508 | Ga0496108_0255584 | 3300048911 | Bacteria | 1524 |
| 509 | Ga0496109_0025610 | 3300048912 | Bacteria | 5257 |
| 510 | Ga0496109_0073674 | 3300048912 | Bacteria | 3138 |
| 511 | Ga0496109_0090085 | 3300048912 | Bacteria | 2836 |
| 512 | Ga0496109_0441457 | 3300048912 | Bacteria | 1229 |
| 513 | Ga0496110_0089715 | 3300048913 | Bacteria | 2748 |
| 514 | Ga0496110_0252728 | 3300048913 | Bacteria | 1604 |
| 515 | Ga0496110_0816642 | 3300048913 | Unclassified | 837 |
| 516 | Ga0496111_0016883 | 3300048914 | Bacteria | 5038 |
| 517 | Ga0496111_0079586 | 3300048914 | Bacteria | 2391 |
| 518 | Ga0496111_0325031 | 3300048914 | Bacteria | 1139 |
| 519 | Ga0496111_0573456 | 3300048914 | Bacteria | 827 |
| 520 | Ga0496112_0037033 | 3300048915 | Bacteria | 4761 |
| 521 | Ga0496112_0097016 | 3300048915 | Bacteria | 2918 |
| 522 | Ga0496112_0493536 | 3300048915 | Bacteria | 1160 |
| 523 | Ga0496112_0873842 | 3300048915 | Bacteria | 822 |
| 524 | Ga0496113_0080781 | 3300048916 | Bacteria | 2491 |
| 525 | Ga0496113_0539786 | 3300048916 | Unclassified | 936 |
| 526 | Ga0496114_0092279 | 3300048917 | Bacteria | 2572 |
| 527 | Ga0496114_0204420 | 3300048917 | Bacteria | 1731 |
| 528 | Ga0496114_0232350 | 3300048917 | Unclassified | 1620 |
| 529 | Ga0496114_0261975 | 3300048917 | Bacteria | 1522 |
| 530 | Ga0496115_0004285 | 3300048918 | Bacteria | 10329 |
| 531 | Ga0496115_0175756 | 3300048918 | Bacteria | 1770 |
| 532 | Ga0496115_0418166 | 3300048918 | Bacteria | 1086 |
| 533 | Ga0496115_0543255 | 3300048918 | Bacteria | 929 |
| 534 | Ga0501067_0002804 | 3300049583 | Bacteria | 9587 |
| 535 | Ga0501067_0222378 | 3300049583 | Bacteria | 1051 |
| 536 | Ga0501069_0155700 | 3300049585 | Bacteria | 1314 |
| 537 | Ga0501070_1298386 | 3300049586 | Bacteria | 556 |
| 538 | nmdc:mga0n895_16746_c1 | 3300050512 | Bacteria | 6736 |
| 539 | nmdc:mga0rr50_80843_c1 | 3300050513 | Bacteria | 2506 |
| 540 | nmdc:mga08x19_47476_c1 | 3300050514 | Bacteria | 2748 |
| 541 | nmdc:mga0a205_239560_c1 | 3300050515 | Bacteria | 1695 |
| 542 | Ga0495601_0001112 | 3300053077 | Bacteria | 14736 |
| 543 | Ga0495601_0017959 | 3300053077 | Bacteria | 4300 |
| 544 | Ga0495601_0059478 | 3300053077 | Bacteria | 2423 |
| 545 | Ga0495601_0195966 | 3300053077 | Bacteria | 1320 |
| 546 | Ga0495601_0467013 | 3300053077 | Bacteria | 815 |
| 547 | Ga0495601_0600093 | 3300053077 | Unclassified | 706 |
| 548 | Ga0495601_0748153 | 3300053077 | Bacteria | 622 |
| 549 | Ga0495612_0005613 | 3300053078 | Bacteria | 5185 |
| 550 | Ga0495612_0016048 | 3300053078 | Bacteria | 3001 |
| 551 | Ga0495612_0019018 | 3300053078 | Bacteria | 2749 |
| 552 | Ga0495612_0099490 | 3300053078 | Unclassified | 1237 |
| 553 | Ga0495612_0121809 | 3300053078 | Bacteria | 1122 |
| 554 | Ga0495595_0010724 | 3300053084 | Bacteria | 3818 |
| 555 | Ga0495595_0152537 | 3300053084 | Bacteria | 1137 |
| 556 | Ga0495595_0202045 | 3300053084 | Bacteria | 989 |
| 557 | Ga0495595_0271437 | 3300053084 | Bacteria | 851 |
| 558 | Ga0495595_0426313 | 3300053084 | Bacteria | 673 |
| 559 | Ga0495595_0493782 | 3300053084 | Bacteria | 623 |
| 560 | Ga0495619_0001848 | 3300053085 | Bacteria | 14098 |
| 561 | Ga0495619_0034416 | 3300053085 | Bacteria | 3293 |
| 562 | Ga0495619_0043663 | 3300053085 | Bacteria | 2940 |
| 563 | Ga0495619_0086108 | 3300053085 | Bacteria | 2123 |
| 564 | Ga0495619_0518236 | 3300053085 | Unclassified | 819 |
| 565 | Ga0495619_0624231 | 3300053085 | Bacteria | 736 |
| 566 | Ga0500566_0264115 | 3300053094 | Bacteria | 829 |
| 567 | Ga0466962_0002207 | 3300061719 | Bacteria | 9202 |
| 568 | Ga0466962_0006327 | 3300061719 | Bacteria | 5682 |
| 569 | Ga0466962_0022218 | 3300061719 | Bacteria | 3047 |
| 570 | Ga0466962_0095403 | 3300061719 | Bacteria | 1426 |
| 571 | Ga0466962_0109315 | 3300061719 | Bacteria | 1331 |
| 572 | Ga0466962_0110852 | 3300061719 | Bacteria | 1321 |
| 573 | Ga0466962_0144375 | 3300061719 | Bacteria | 1153 |
| 574 | Ga0466962_0293136 | 3300061719 | Unclassified | 804 |
| 575 | Ga0068868_100873546 | |||
| 576 | Ga0070658_10029027 | |||
| 577 | Ga0070683_100033099 | |||
| 578 | Ga0070683_100176363 | |||
| 579 | Ga0070680_100020222 | |||
| 580 | Ga0070660_100279618 | |||
| 581 | Ga0070691_10065565 | |||
| 582 | Ga0070687_100935544 | |||
| 583 | Ga0070661_100493760 | |||
| 584 | Ga0070671_100377321 | |||
| 585 | Ga0070659_100566540 | |||
| 586 | Ga0070709_10215543 | |||
| 587 | Ga0070714_100017044 | |||
| 588 | Ga0070714_100041854 | |||
| 589 | Ga0070714_100082104 | |||
| 590 | Ga0070714_100133382 | |||
| 591 | Ga0070714_100456265 | |||
| 592 | Ga0070714_101202173 | |||
| 593 | Ga0070714_101668086 | |||
| 594 | Ga0070713_100089995 | |||
| 595 | Ga0070713_100131149 | |||
| 596 | Ga0070713_100148289 | |||
| 597 | Ga0070713_100400577 | |||
| 598 | Ga0070710_10005551 | |||
| 599 | Ga0070710_10374342 | |||
| 600 | Ga0070710_10965966 | |||
| 601 | Ga0070710_11180612 | |||
| 602 | Ga0070711_100037868 | |||
| 603 | Ga0070711_100122256 | |||
| 604 | Ga0070711_100189184 | |||
| 605 | Ga0070705_100558626 | |||
| 606 | Ga0070694_100535929 | |||
| 607 | Ga0070708_101608034 | |||
| 608 | Ga0070663_101558836 | |||
| 609 | Ga0070678_101431265 | |||
| 610 | Ga0070681_10105062 | |||
| 611 | Ga0070681_10154961 | |||
| 612 | Ga0070707_100053472 | |||
| 613 | Ga0070707_101247126 | |||
| 614 | Ga0070698_100175864 | |||
| 615 | Ga0070698_100369649 | |||
| 616 | Ga0070679_100153869 | |||
| 617 | Ga0070679_100224782 | |||
| 618 | Ga0070684_100068484 | |||
| 619 | Ga0070684_100220955 | |||
| 620 | Ga0070684_100737054 | |||
| 621 | Ga0070684_102031398 | |||
| 622 | Ga0070695_100009706 | |||
| 623 | Ga0070696_101017416 | |||
| 624 | Ga0070696_101710802 | |||
| 625 | Ga0070704_100154544 | |||
| 626 | Ga0068856_100057152 | |||
| 627 | Ga0068856_100904213 | |||
| 628 | Ga0070702_101027901 | |||
| 629 | Ga0070702_101077657 | |||
| 630 | Ga0068862_102328216 | |||
| 631 | Ga0070717_10008777 | |||
| 632 | Ga0070717_10012173 | |||
| 633 | Ga0070717_10024498 | |||
| 634 | Ga0070717_10071173 | |||
| 635 | Ga0070717_10080258 | |||
| 636 | Ga0070717_10272507 | |||
| 637 | Ga0070717_10842112 | |||
| 638 | Ga0070715_10001143 | |||
| 639 | Ga0070715_10711507 | |||
| 640 | Ga0070716_100007577 | |||
| 641 | Ga0070716_101053950 | |||
| 642 | Ga0070712_100136857 | |||
| 643 | Ga0070712_100145704 | |||
| 644 | Ga0070712_101151912 | |||
| 645 | Ga0070712_101174053 | |||
| 646 | Ga0070712_101733128 | |||
| 647 | Ga0070712_101909732 | |||
| 648 | Ga0075433_10193155 | |||
| 649 | Ga0075434_100032113 | |||
| 650 | Ga0075436_100104450 | |||
| 651 | Ga0075436_100345329 | |||
| 652 | Ga0075435_100468767 | |||
| 653 | Ga0099795_10177152 | |||
| 654 | Ga0105240_10123304 | |||
| 655 | Ga0105240_10467621 | |||
| 656 | Ga0105240_10959699 | |||
| 657 | Ga0105245_10407924 | |||
| 658 | Ga0105245_10798074 | |||
| 659 | Ga0105241_10155395 | |||
| 660 | Ga0105241_10399684 | |||
| 661 | Ga0105248_12765200 | |||
| 662 | Ga0105237_10284587 | |||
| 663 | Ga0157369_10060976 | |||
| 664 | Ga0157369_10209514 | |||
| 665 | Ga0157369_11737868 | |||
| 666 | Ga0163162_10148966 | |||
| 667 | Ga0157372_10044465 | |||
| 668 | Ga0157372_10371525 | |||
| 669 | Ga0157372_11282815 | |||
| 670 | Ga0157372_11295488 | |||
| 671 | Ga0157372_12670598 | |||
| 672 | Ga0163163_11280075 | |||
| 673 | Ga0182008_10372909 | |||
| 674 | Ga0157376_10007904 | |||
| 675 | Ga0157376_11681760 | |||
| 676 | Ga0157376_12136908 | |||
| 677 | Ga0213871_10002024 | |||
| 678 | Ga0224712_10292303 | |||
| 679 | Ga0207692_10626526 | |||
| 680 | Ga0207685_10002797 | |||
| 681 | Ga0207685_10290741 | |||
| 682 | Ga0207699_10008441 | |||
| 683 | Ga0207699_10084715 | |||
| 684 | Ga0207654_10246069 | |||
| 685 | Ga0207707_10929245 | |||
| 686 | Ga0207707_11133051 | |||
| 687 | Ga0207695_10468837 | |||
| 688 | Ga0207695_10943445 | |||
| 689 | Ga0207695_11549892 | |||
| 690 | Ga0207671_10100020 | |||
| 691 | Ga0207693_10000920 | |||
| 692 | Ga0207693_10056091 | |||
| 693 | Ga0207693_10984969 | |||
| 694 | Ga0207663_10040434 | |||
| 695 | Ga0207663_10049943 | |||
| 696 | Ga0207663_11268661 | |||
| 697 | Ga0207660_11165498 | |||
| 698 | Ga0207657_10007057 | |||
| 699 | Ga0207649_10840893 | |||
| 700 | Ga0207652_10070692 | |||
| 701 | Ga0207652_10083310 | |||
| 702 | Ga0207652_10519587 | |||
| 703 | Ga0207646_10003186 | |||
| 704 | Ga0207646_10720675 | |||
| 705 | Ga0207694_11023191 | |||
| 706 | Ga0207687_10070400 | |||
| 707 | Ga0207687_11795156 | |||
| 708 | Ga0207700_10181093 | |||
| 709 | Ga0207700_10495829 | |||
| 710 | Ga0207664_10005724 | |||
| 711 | Ga0207664_10012625 | |||
| 712 | Ga0207664_10027641 | |||
| 713 | Ga0207664_10052104 | |||
| 714 | Ga0207664_10212947 | |||
| 715 | Ga0207664_10248641 | |||
| 716 | Ga0207664_10260880 | |||
| 717 | Ga0207664_11898742 | |||
| 718 | Ga0207644_10413472 | |||
| 719 | Ga0207644_11021615 | |||
| 720 | Ga0207690_11694655 | |||
| 721 | Ga0207665_10000247 | |||
| 722 | Ga0207665_10109389 | |||
| 723 | Ga0207665_10402180 | |||
| 724 | Ga0207711_10410325 | |||
| 725 | Ga0207711_11358085 | |||
| 726 | Ga0207661_10923063 | |||
| 727 | Ga0207667_11748582 | |||
| 728 | Ga0207702_10269760 | |||
| 729 | Ga0207702_11569370 | |||
| 730 | Ga0207683_10886003 | |||
| 731 | Ga0207698_12467477 | |||
| 732 | Ga0268265_11482385 | |||
| 733 | Ga0265337_1055201 | |||
| 734 | Ga0265336_10010674 | |||
| 735 | Ga0265338_10126146 | |||
| 736 | Ga0265325_10163300 | |||
| 737 | Ga0265325_10332501 | |||
| 738 | Ga0265340_10296098 | |||
| 739 | Ga0265339_10160011 | |||
| 740 | Ga0265331_10190649 | |||
| 741 | Ga0265327_10174949 | |||
| 742 | Ga0265316_10097900 | |||
| 743 | Ga0265313_10028282 | |||
| 744 | Ga0265313_10128221 | |||
| 745 | Ga0265314_10044092 | |||
| 746 | Ga0265342_10062192 | |||
| 747 | Ga0373926_0035748 | |||
| 748 | Ga0373929_0034313 | |||
| 749 | Ga0373934_0033658 | |||
| 750 | Ga0373944_0401694 | |||
| 751 | Ga0373923_0142458 | |||
| 752 | Ga0373936_0009693 | |||
| 753 | Ga0373953_0139413 | |||
| 754 | Ga0373953_0241338 | |||
| 755 | Ga0373954_0219284 | |||
| 756 | Ga0373954_0470906 | |||
| 757 | Ga0373960_0145081 | |||
| 758 | Ga0373943_0002789 | |||
| 759 | Ga0373943_0390896 | |||
| 760 | Ga0373943_0536929 | |||
| 761 | Ga0373946_0004467 | |||
| 762 | Ga0373955_0223890 | |||
| 763 | Ga0373924_0180569 | |||
| 764 | Ga0373931_0541462 | |||
| 765 | Ga0373935_0222211 | |||
| 766 | Ga0373927_0162189 | |||
| 767 | Ga0373933_0419818 | |||
| 768 | Ga0373933_0569949 | |||
| 769 | Ga0373947_1240694 | |||
| 770 | Ga0373937_0000355 | |||
| 771 | Ga0373937_0421635 | |||
| 772 | Ga0373925_0082747 | |||
| 773 | Ga0373925_0374524 | |||
| 774 | Ga0395899_0564187 | |||
| 775 | Ga0395900_0135664 | |||
| 776 | Ga0395900_0529262 | |||
| 777 | Ga0395900_1033089 | |||
| 778 | Ga0395901_0026769 | |||
| 779 | Ga0395901_1297036 | |||
| 780 | Ga0436360_0052335 | |||
| 781 | Ga0451577_0212024 | |||
| 782 | Ga0466969_0000591 | |||
| 783 | Ga0466965_0065742 | |||
| 784 | Ga0466965_0500394 | |||
| 785 | Ga0466966_0082306 | |||
| 786 | Ga0466966_0238648 | |||
| 787 | Ga0466961_0025254 | |||
| 788 | Ga0466961_0025331 | |||
| 789 | Ga0466961_0100878 | |||
| 790 | Ga0466961_0111684 | |||
| 791 | Ga0466963_0000871 | |||
| 792 | Ga0466963_0001043 | |||
| 793 | Ga0466963_0001689 | |||
| 794 | Ga0466963_0002486 | |||
| 795 | Ga0466963_0012681 | |||
| 796 | Ga0466963_0014974 | |||
| 797 | Ga0466963_0032721 | |||
| 798 | Ga0466963_0033719 | |||
| 799 | Ga0466963_0049198 | |||
| 800 | Ga0466963_0067249 | |||
| 801 | Ga0466963_0084756 | |||
| 802 | Ga0466963_0125033 | |||
| 803 | Ga0466963_0262564 | |||
| 804 | Ga0466963_0439403 | |||
| 805 | Ga0466963_0630496 | |||
| 806 | Ga0466963_0662784 | |||
| 807 | Ga0466963_0731326 | |||
| 808 | Ga0466963_1198249 | |||
| 809 | Ga0466964_0006431 | |||
| 810 | Ga0466964_0010339 | |||
| 811 | Ga0466964_0010666 | |||
| 812 | Ga0466964_0011937 | |||
| 813 | Ga0466964_0065430 | |||
| 814 | Ga0466964_0221827 | |||
| 815 | Ga0466964_0516926 | |||
| 816 | Ga0466964_0581652 | |||
| 817 | Ga0466964_0626531 | |||
| 818 | Ga0466971_0002846 | |||
| 819 | Ga0466971_0009961 | |||
| 820 | Ga0466971_0089829 | |||
| 821 | Ga0466968_0002250 | |||
| 822 | Ga0466968_0018226 | |||
| 823 | Ga0466968_0050404 | |||
| 824 | Ga0466968_0097976 | |||
| 825 | Ga0466968_0113857 | |||
| 826 | Ga0466968_0148588 | |||
| 827 | Ga0466968_0244895 | |||
| 828 | Ga0466968_0300860 | |||
| 829 | Ga0466968_0305447 | |||
| 830 | Ga0466968_0443659 | |||
| 831 | Ga0466968_0749286 | |||
| 832 | Ga0466970_0077611 | |||
| 833 | Ga0466970_0144889 | |||
| 834 | Ga0466957_0007870 | |||
| 835 | Ga0466957_0015917 | |||
| 836 | Ga0466957_0015978 | |||
| 837 | Ga0466957_0062440 | |||
| 838 | Ga0466957_0241772 | |||
| 839 | Ga0466957_0303934 | |||
| 840 | Ga0466960_0022463 | |||
| 841 | Ga0466960_0057200 | |||
| 842 | Ga0466960_0192142 | |||
| 843 | Ga0466960_0777107 | |||
| 844 | Ga0466959_0006164 | |||
| 845 | Ga0466959_0070978 | |||
| 846 | Ga0466959_0132717 | |||
| 847 | Ga0466958_0001514 | |||
| 848 | Ga0466958_0005900 | |||
| 849 | Ga0466958_0008230 | |||
| 850 | Ga0466958_0017218 | |||
| 851 | Ga0466958_0026435 | |||
| 852 | Ga0466958_0056485 | |||
| 853 | Ga0466958_0398368 | |||
| 854 | Ga0466958_0422748 | |||
| 855 | Ga0466967_0000173 | |||
| 856 | Ga0466967_0001483 | |||
| 857 | Ga0466967_0009541 | |||
| 858 | Ga0466967_0025980 | |||
| 859 | Ga0466967_0030265 | |||
| 860 | Ga0466967_0035242 | |||
| 861 | Ga0466967_0037934 | |||
| 862 | Ga0466967_0046397 | |||
| 863 | Ga0466967_0048433 | |||
| 864 | Ga0466967_0056230 | |||
| 865 | Ga0466967_0071866 | |||
| 866 | Ga0466967_0080509 | |||
| 867 | Ga0466967_0133655 | |||
| 868 | Ga0466967_0155053 | |||
| 869 | Ga0466967_0194025 | |||
| 870 | Ga0466967_0219134 | |||
| 871 | Ga0466967_0473342 | |||
| 872 | Ga0466967_1078260 | |||
| 873 | Ga0466967_1448233 | |||
| 874 | Ga0495592_0000635 | |||
| 875 | Ga0495592_0000769 | |||
| 876 | Ga0495592_0255814 | |||
| 877 | Ga0495592_0366300 | |||
| 878 | Ga0495603_0012764 | |||
| 879 | Ga0495603_0387814 | |||
| 880 | Ga0495629_0048615 | |||
| 881 | Ga0495629_0331547 | |||
| 882 | Ga0495629_0351677 | |||
| 883 | Ga0495641_0021247 | |||
| 884 | Ga0495641_0056809 | |||
| 885 | Ga0495641_0057633 | |||
| 886 | Ga0495641_0264111 | |||
| 887 | Ga0495641_0300788 | |||
| 888 | Ga0495651_0000029 | |||
| 889 | Ga0495651_0403323 | |||
| 890 | Ga0495651_0462084 | |||
| 891 | Ga0495653_0003221 | |||
| 892 | Ga0495653_0036940 | |||
| 893 | Ga0495653_0071061 | |||
| 894 | Ga0495653_0093395 | |||
| 895 | Ga0495653_0223265 | |||
| 896 | Ga0495653_0546534 | |||
| 897 | Ga0495580_0050971 | |||
| 898 | Ga0495580_0531272 | |||
| 899 | Ga0495582_0170642 | |||
| 900 | Ga0495582_0182664 | |||
| 901 | Ga0495582_0250913 | |||
| 902 | Ga0495582_0264042 | |||
| 903 | Ga0495582_0312659 | |||
| 904 | Ga0495605_0063632 | |||
| 905 | Ga0495639_0002681 | |||
| 906 | Ga0495639_0329808 | |||
| 907 | Ga0495662_0011724 | |||
| 908 | Ga0495662_0014853 | |||
| 909 | Ga0495664_0007196 | |||
| 910 | Ga0495664_0045576 | |||
| 911 | Ga0495664_0135257 | |||
| 912 | Ga0495664_0244377 | |||
| 913 | Ga0495664_0353612 | |||
| 914 | Ga0495664_0614618 | |||
| 915 | Ga0495584_0066410 | |||
| 916 | Ga0495594_0232163 | |||
| 917 | Ga0495594_0342603 | |||
| 918 | Ga0495594_0475781 | |||
| 919 | Ga0495594_0488433 | |||
| 920 | Ga0495607_0112495 | |||
| 921 | Ga0495608_0008612 | |||
| 922 | Ga0495608_0117279 | |||
| 923 | Ga0495608_0558337 | |||
| 924 | Ga0495618_0001935 | |||
| 925 | Ga0495618_0159673 | |||
| 926 | Ga0495618_0171347 | |||
| 927 | Ga0495618_0187311 | |||
| 928 | Ga0495618_0279493 | |||
| 929 | Ga0495628_0000016 | |||
| 930 | Ga0495628_0081995 | |||
| 931 | Ga0495628_0817008 | |||
| 932 | Ga0495630_0010255 | |||
| 933 | Ga0495630_0041538 | |||
| 934 | Ga0495630_0102755 | |||
| 935 | Ga0495630_0423075 | |||
| 936 | Ga0495630_0756489 | |||
| 937 | Ga0495631_0152875 | |||
| 938 | Ga0495644_0034283 | |||
| 939 | Ga0495663_0054293 | |||
| 940 | Ga0495666_0001728 | |||
| 941 | Ga0495666_0114151 | |||
| 942 | Ga0495642_0049361 | |||
| 943 | Ga0495652_0001228 | |||
| 944 | Ga0495652_0011063 | |||
| 945 | Ga0495652_0075687 | |||
| 946 | Ga0495652_0305759 | |||
| 947 | Ga0495652_0367901 | |||
| 948 | Ga0495665_0020866 | |||
| 949 | Ga0495640_0047657 | |||
| 950 | Ga0495640_0055771 | |||
| 951 | Ga0495640_0224494 | |||
| 952 | Ga0495640_0321382 | |||
| 953 | Ga0495586_0026226 | |||
| 954 | Ga0495586_0103981 | |||
| 955 | Ga0495586_0146656 | |||
| 956 | Ga0495586_0167849 | |||
| 957 | Ga0495587_0000434 | |||
| 958 | Ga0495587_0021328 | |||
| 959 | Ga0495587_0231021 | |||
| 960 | Ga0495598_0052853 | |||
| 961 | Ga0495609_0047750 | |||
| 962 | Ga0495645_0000367 | |||
| 963 | Ga0495645_0009395 | |||
| 964 | Ga0495645_0191154 | |||
| 965 | Ga0495645_0972668 | |||
| 966 | Ga0495667_0028356 | |||
| 967 | Ga0495667_0062525 | |||
| 968 | Ga0495667_0398152 | |||
| 969 | Ga0495667_0512084 | |||
| 970 | Ga0495656_0008107 | |||
| 971 | Ga0495634_0200365 | |||
| 972 | Ga0495634_0205587 | |||
| 973 | Ga0495634_0208878 | |||
| 974 | Ga0495634_0218501 | |||
| 975 | Ga0495634_0762202 | |||
| 976 | Ga0495611_0173314 | |||
| 977 | Ga0495635_0088310 | |||
| 978 | Ga0495635_0218802 | |||
| 979 | Ga0495635_0255206 | |||
| 980 | Ga0495635_0782561 | |||
| 981 | Ga0495661_0087600 | |||
| 982 | Ga0495588_0249961 | |||
| 983 | Ga0495657_0002796 | |||
| 984 | Ga0495657_0003896 | |||
| 985 | Ga0495657_0108292 | |||
| 986 | Ga0495657_0547502 | |||
| 987 | Ga0495657_0583949 | |||
| 988 | Ga0495599_0000187 | |||
| 989 | Ga0495599_0001457 | |||
| 990 | Ga0495599_0227875 | |||
| 991 | Ga0495623_0000121 | |||
| 992 | Ga0495623_0053918 | |||
| 993 | Ga0495646_0000742 | |||
| 994 | Ga0495646_0294471 | |||
| 995 | Ga0495647_0035085 | |||
| 996 | Ga0495647_0124002 | |||
| 997 | Ga0495647_0133263 | |||
| 998 | Ga0495647_0625496 | |||
| 999 | Ga0495658_0055353 | |||
| 1000 | Ga0495658_0449291 | |||
| 1001 | Ga0495658_0617489 | |||
| 1002 | Ga0495613_0048649 | |||
| 1003 | Ga0495613_0051744 | |||
| 1004 | Ga0495613_0096978 | |||
| 1005 | Ga0495613_0348970 | |||
| 1006 | Ga0495624_0013715 | |||
| 1007 | Ga0495624_0034100 | |||
| 1008 | Ga0495624_0055294 | |||
| 1009 | Ga0495589_0047317 | |||
| 1010 | Ga0495600_0022357 | |||
| 1011 | Ga0495600_0478020 | |||
| 1012 | Ga0495581_0013623 | |||
| 1013 | Ga0495581_0066952 | |||
| 1014 | Ga0495581_0578464 | |||
| 1015 | Ga0495581_0775892 | |||
| 1016 | Ga0495604_0000628 | |||
| 1017 | Ga0495604_0053337 | |||
| 1018 | Ga0495604_0121086 | |||
| 1019 | Ga0495604_0341924 | |||
| 1020 | Ga0495636_0028003 | |||
| 1021 | Ga0495674_0096821 | |||
| 1022 | Ga0495674_0161360 | |||
| 1023 | Ga0495674_0328870 | |||
| 1024 | Ga0495674_0612585 | |||
| 1025 | Ga0495676_0131799 | |||
| 1026 | Ga0495676_0273683 | |||
| 1027 | Ga0495676_0453934 | |||
| 1028 | Ga0495676_0458510 | |||
| 1029 | Ga0495676_0585364 | |||
| 1030 | Ga0495680_0002048 | |||
| 1031 | Ga0495680_0040968 | |||
| 1032 | Ga0495680_0056576 | |||
| 1033 | Ga0495680_0086017 | |||
| 1034 | Ga0495680_0091971 | |||
| 1035 | Ga0495680_0557781 | |||
| 1036 | Ga0495675_0000031 | |||
| 1037 | Ga0495677_0083042 | |||
| 1038 | Ga0495684_0009072 | |||
| 1039 | Ga0495684_0041052 | |||
| 1040 | Ga0495684_0074185 | |||
| 1041 | Ga0495684_0134268 | |||
| 1042 | Ga0495684_0179522 | |||
| 1043 | Ga0495684_0201006 | |||
| 1044 | Ga0495593_0018216 | |||
| 1045 | Ga0495593_0078079 | |||
| 1046 | Ga0495602_0000133 | |||
| 1047 | Ga0495602_0018304 | |||
| 1048 | Ga0495602_0213416 | |||
| 1049 | Ga0495614_0011907 | |||
| 1050 | Ga0496100_0011817 | |||
| 1051 | Ga0496100_0099642 | |||
| 1052 | Ga0496100_0183828 | |||
| 1053 | Ga0496100_0200765 | |||
| 1054 | Ga0496100_0502937 | |||
| 1055 | Ga0496100_1269450 | |||
| 1056 | Ga0496101_0189621 | |||
| 1057 | Ga0496101_0254915 | |||
| 1058 | Ga0496101_0406060 | |||
| 1059 | Ga0496101_0463292 | |||
| 1060 | Ga0496101_0568599 | |||
| 1061 | Ga0496101_0694904 | |||
| 1062 | Ga0496102_0353437 | |||
| 1063 | Ga0496102_0650753 | |||
| 1064 | Ga0496103_0037168 | |||
| 1065 | Ga0496104_0005551 | |||
| 1066 | Ga0496104_0055658 | |||
| 1067 | Ga0496104_0322206 | |||
| 1068 | Ga0496104_0536779 | |||
| 1069 | Ga0496105_0039159 | |||
| 1070 | Ga0496105_0070205 | |||
| 1071 | Ga0496105_0652155 | |||
| 1072 | Ga0496106_0063164 | |||
| 1073 | Ga0496106_0939491 | |||
| 1074 | Ga0496107_0026994 | |||
| 1075 | Ga0496107_0202988 | |||
| 1076 | Ga0496107_0469156 | |||
| 1077 | Ga0496107_0557468 | |||
| 1078 | Ga0496107_0753134 | |||
| 1079 | Ga0496108_0089334 | |||
| 1080 | Ga0496108_0136557 | |||
| 1081 | Ga0496108_0144943 | |||
| 1082 | Ga0496108_0255584 | |||
| 1083 | Ga0496109_0025610 | |||
| 1084 | Ga0496109_0073674 | |||
| 1085 | Ga0496109_0090085 | |||
| 1086 | Ga0496109_0441457 | |||
| 1087 | Ga0496110_0089715 | |||
| 1088 | Ga0496110_0252728 | |||
| 1089 | Ga0496110_0816642 | |||
| 1090 | Ga0496111_0016883 | |||
| 1091 | Ga0496111_0079586 | |||
| 1092 | Ga0496111_0325031 | |||
| 1093 | Ga0496111_0573456 | |||
| 1094 | Ga0496112_0037033 | |||
| 1095 | Ga0496112_0097016 | |||
| 1096 | Ga0496112_0493536 | |||
| 1097 | Ga0496112_0873842 | |||
| 1098 | Ga0496113_0080781 | |||
| 1099 | Ga0496113_0539786 | |||
| 1100 | Ga0496114_0092279 | |||
| 1101 | Ga0496114_0204420 | |||
| 1102 | Ga0496114_0232350 | |||
| 1103 | Ga0496114_0261975 | |||
| 1104 | Ga0496115_0004285 | |||
| 1105 | Ga0496115_0175756 | |||
| 1106 | Ga0496115_0418166 | |||
| 1107 | Ga0496115_0543255 | |||
| 1108 | Ga0501067_0002804 | |||
| 1109 | Ga0501067_0222378 | |||
| 1110 | Ga0501069_0155700 | |||
| 1111 | Ga0501070_1298386 | |||
| 1112 | nmdc:mga0n895_16746_c1 | |||
| 1113 | nmdc:mga0rr50_80843_c1 | |||
| 1114 | nmdc:mga08x19_47476_c1 | |||
| 1115 | nmdc:mga0a205_239560_c1 | |||
| 1116 | Ga0495601_0001112 | |||
| 1117 | Ga0495601_0017959 | |||
| 1118 | Ga0495601_0059478 | |||
| 1119 | Ga0495601_0195966 | |||
| 1120 | Ga0495601_0467013 | |||
| 1121 | Ga0495601_0600093 | |||
| 1122 | Ga0495601_0748153 | |||
| 1123 | Ga0495612_0005613 | |||
| 1124 | Ga0495612_0016048 | |||
| 1125 | Ga0495612_0019018 | |||
| 1126 | Ga0495612_0099490 | |||
| 1127 | Ga0495612_0121809 | |||
| 1128 | Ga0495595_0010724 | |||
| 1129 | Ga0495595_0152537 | |||
| 1130 | Ga0495595_0202045 | |||
| 1131 | Ga0495595_0271437 | |||
| 1132 | Ga0495595_0426313 | |||
| 1133 | Ga0495595_0493782 | |||
| 1134 | Ga0495619_0001848 | |||
| 1135 | Ga0495619_0034416 | |||
| 1136 | Ga0495619_0043663 | |||
| 1137 | Ga0495619_0086108 | |||
| 1138 | Ga0495619_0518236 | |||
| 1139 | Ga0495619_0624231 | |||
| 1140 | Ga0500566_0264115 | |||
| 1141 | Ga0466962_0002207 | |||
| 1142 | Ga0466962_0006327 | |||
| 1143 | Ga0466962_0022218 | |||
| 1144 | Ga0466962_0095403 | |||
| 1145 | Ga0466962_0109315 | |||
| 1146 | Ga0466962_0110852 | |||
| 1147 | Ga0466962_0144375 | |||
| 1148 | Ga0466962_0293136 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4mmn-assembly2.cif.gz_E | structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum | 0.8171 | 5 | 85 |
| 1vhm-assembly1.cif.gz_A | crystal structure of an hypothetical protein | 0.7847 | 9 | 86 |
| 5i5l-assembly1.cif.gz_A-2 | the photosensory module (pas-gaf-phy) of the bacterial phytochrome agp1 (atbphp1) in the pr form, chromophore modelled with an endocyclic double bond in pyrrole ring a | 0.7837 | 5 | 93 |
| 6ob8-assembly1.cif.gz_A | crystal structure of a dual sensor histidine kinase in green light illuminated state | 0.7793 | 4 | 95 |
| 5hsq-assembly1.cif.gz_A-2 | the surface engineered photosensory module (pas-gaf-phy) of the bacterial phytochrome agp1 (atbphp1) in the pr form, chromophore modelled with an endocyclic double bond in pyrrole ring a. | 0.7669 | 2 | 93 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 6mghD00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.8304 | 5 | 89 | 3.30.450.40 |
| 4rq9A02 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7884 | 2 | 89 | 3.30.450.40 |
| 1vhmA00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7847 | 9 | 86 | 3.30.450.40 |
| af_P76245_4_163_3.30.450.40 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7829 | 1 | 88 | 3.30.450.40 |
| 3oovB00 | Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain | 0.7756 | 2 | 88 | 3.30.450.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W0YTW8-F1-model_v4 | GAF domain-containing protein | 0.9615 | 1 | 63 |
|
| AF-A0A7Y5X0F3-F1-model_v4 | GAF domain-containing protein | 0.9342 | 2 | 86 |
|
| AF-A0A538IFB0-F1-model_v4 | GAF domain-containing protein | 0.8625 | 1 | 99 |
|
| AF-A0A538GKA8-F1-model_v4 | Uncharacterized protein | 0.8607 | 5 | 95 |
|
| AF-A0A6I3BRY3-F1-model_v4 | GAF domain-containing protein | 0.8585 | 3 | 98 |
|