F465276

General Info

Members Datasets Scaffolds Average Seq Length
574 222 1148 100

Family's Representative Sequence

Representative Sequence 3300005338|Ga0068868_100873546|Ga0068868_1008735462
Length 102
Sequence MSVDADDPDDLLRQTVTELAARDDCVWAGIFFVEGHELVLGPEAGTPDLERRVGVPVTWRGERIAELVADGAVEPAELAEVAAGIADLCLVGWDTGGELWQS

Samples

Sample ID Description Type Environment
1 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
7 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
30 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
31 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
38 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
41 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
42 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
43 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
44 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
45 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
46 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
47 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
48 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
49 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
50 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
83 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
84 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
85 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
86 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
87 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
88 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
89 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
90 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
91 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
92 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
93 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
94 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
95 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
98 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
99 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
108 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
109 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
110 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
114 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
115 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
119 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
120 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
121 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
122 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
123 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
124 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
125 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
126 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
142 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
143 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
144 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
145 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
146 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
149 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
153 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
156 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
157 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
158 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
159 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
160 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
161 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
162 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
171 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
172 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
173 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
174 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
175 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
176 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
177 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
178 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
179 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
180 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
181 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
182 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
185 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
188 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
189 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
190 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
191 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
192 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
193 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
209 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
210 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
211 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
212 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
213 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
214 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
215 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
216 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
217 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
218 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
222 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 10.1
Rhizosphere 89.72
Stem 0
Stem Tuber 0
Unclassified 13.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068868_100873546 3300005338 Unclassified 816
2 Ga0070658_10029027 3300005327 Bacteria 4442
3 Ga0070683_100033099 3300005329 Bacteria 4711
4 Ga0070683_100176363 3300005329 Bacteria 2029
5 Ga0070680_100020222 3300005336 Bacteria 5282
6 Ga0070660_100279618 3300005339 Bacteria 1365
7 Ga0070691_10065565 3300005341 Bacteria 1754
8 Ga0070687_100935544 3300005343 Unclassified 624
9 Ga0070661_100493760 3300005344 Unclassified 979
10 Ga0070671_100377321 3300005355 Unclassified 1212
11 Ga0070659_100566540 3300005366 Bacteria 973
12 Ga0070709_10215543 3300005434 Bacteria 1366
13 Ga0070714_100017044 3300005435 Bacteria 5880
14 Ga0070714_100041854 3300005435 Bacteria 3868
15 Ga0070714_100082104 3300005435 Bacteria 2807
16 Ga0070714_100133382 3300005435 Bacteria 2221
17 Ga0070714_100456265 3300005435 Bacteria 1215
18 Ga0070714_101202173 3300005435 Bacteria 739
19 Ga0070714_101668086 3300005435 Unclassified 623
20 Ga0070713_100089995 3300005436 Bacteria 2637
21 Ga0070713_100131149 3300005436 Bacteria 2210
22 Ga0070713_100148289 3300005436 Bacteria 2084
23 Ga0070713_100400577 3300005436 Bacteria 1282
24 Ga0070710_10005551 3300005437 Bacteria 6004
25 Ga0070710_10374342 3300005437 Bacteria 948
26 Ga0070710_10965966 3300005437 Bacteria 619
27 Ga0070710_11180612 3300005437 Bacteria 565
28 Ga0070711_100037868 3300005439 Bacteria 3238
29 Ga0070711_100122256 3300005439 Bacteria 1927
30 Ga0070711_100189184 3300005439 Bacteria 1581
31 Ga0070705_100558626 3300005440 Bacteria 879
32 Ga0070694_100535929 3300005444 Bacteria 936
33 Ga0070708_101608034 3300005445 Unclassified 605
34 Ga0070663_101558836 3300005455 Bacteria 588
35 Ga0070678_101431265 3300005456 Bacteria 646
36 Ga0070681_10105062 3300005458 Bacteria 2766
37 Ga0070681_10154961 3300005458 Bacteria 2216
38 Ga0070707_100053472 3300005468 Bacteria 3872
39 Ga0070707_101247126 3300005468 Bacteria 710
40 Ga0070698_100175864 3300005471 Bacteria 2080
41 Ga0070698_100369649 3300005471 Bacteria 1366
42 Ga0070679_100153869 3300005530 Bacteria 2275
43 Ga0070679_100224782 3300005530 Bacteria 1837
44 Ga0070684_100068484 3300005535 Bacteria 3119
45 Ga0070684_100220955 3300005535 Bacteria 1728
46 Ga0070684_100737054 3300005535 Unclassified 919
47 Ga0070684_102031398 3300005535 Unclassified 542
48 Ga0070695_100009706 3300005545 Bacteria 5732
49 Ga0070696_101017416 3300005546 Unclassified 693
50 Ga0070696_101710802 3300005546 Bacteria 542
51 Ga0070704_100154544 3300005549 Bacteria 1808
52 Ga0068856_100057152 3300005614 Bacteria 3851
53 Ga0068856_100904213 3300005614 Bacteria 902
54 Ga0070702_101027901 3300005615 Bacteria 654
55 Ga0070702_101077657 3300005615 Bacteria 641
56 Ga0068862_102328216 3300005844 Bacteria 547
57 Ga0070717_10008777 3300006028 Bacteria 7567
58 Ga0070717_10012173 3300006028 Bacteria 6559
59 Ga0070717_10024498 3300006028 Bacteria 4792
60 Ga0070717_10071173 3300006028 Bacteria 2900
61 Ga0070717_10080258 3300006028 Bacteria 2737
62 Ga0070717_10272507 3300006028 Bacteria 1499
63 Ga0070717_10842112 3300006028 Bacteria 834
64 Ga0070715_10001143 3300006163 Bacteria 7581
65 Ga0070715_10711507 3300006163 Bacteria 601
66 Ga0070716_100007577 3300006173 Bacteria 5354
67 Ga0070716_101053950 3300006173 Bacteria 646
68 Ga0070712_100136857 3300006175 Bacteria 1864
69 Ga0070712_100145704 3300006175 Bacteria 1812
70 Ga0070712_101151912 3300006175 Bacteria 674
71 Ga0070712_101174053 3300006175 Bacteria 667
72 Ga0070712_101733128 3300006175 Bacteria 547
73 Ga0070712_101909732 3300006175 Unclassified 520
74 Ga0075433_10193155 3300006852 Bacteria 1811
75 Ga0075434_100032113 3300006871 Bacteria 5176
76 Ga0075436_100104450 3300006914 Bacteria 1975
77 Ga0075436_100345329 3300006914 Unclassified 1072
78 Ga0075435_100468767 3300007076 Bacteria 1087
79 Ga0099795_10177152 3300007788 Unclassified 889
80 Ga0105240_10123304 3300009093 Bacteria 3118
81 Ga0105240_10467621 3300009093 Bacteria 1408
82 Ga0105240_10959699 3300009093 Bacteria 916
83 Ga0105245_10407924 3300009098 Bacteria 1359
84 Ga0105245_10798074 3300009098 Bacteria 982
85 Ga0105241_10155395 3300009174 Bacteria 1875
86 Ga0105241_10399684 3300009174 Unclassified 1205
87 Ga0105248_12765200 3300009177 Bacteria 560
88 Ga0105237_10284587 3300009545 Bacteria 1656
89 Ga0157369_10060976 3300013105 Bacteria 4067
90 Ga0157369_10209514 3300013105 Bacteria 2043
91 Ga0157369_11737868 3300013105 Bacteria 634
92 Ga0163162_10148966 3300013306 Bacteria 2457
93 Ga0157372_10044465 3300013307 Bacteria 4922
94 Ga0157372_10371525 3300013307 Bacteria 1666
95 Ga0157372_11282815 3300013307 Bacteria 845
96 Ga0157372_11295488 3300013307 Unclassified 841
97 Ga0157372_12670598 3300013307 Unclassified 573
98 Ga0163163_11280075 3300014325 Bacteria 795
99 Ga0182008_10372909 3300014497 Unclassified 761
100 Ga0157376_10007904 3300014969 Bacteria 7630
101 Ga0157376_11681760 3300014969 Unclassified 670
102 Ga0157376_12136908 3300014969 Bacteria 598
103 Ga0213871_10002024 3300021441 Bacteria 3625
104 Ga0224712_10292303 3300022467 Bacteria 760
105 Ga0207692_10626526 3300025898 Unclassified 693
106 Ga0207685_10002797 3300025905 Bacteria 4087
107 Ga0207685_10290741 3300025905 Bacteria 805
108 Ga0207699_10008441 3300025906 Bacteria 5085
109 Ga0207699_10084715 3300025906 Bacteria 1975
110 Ga0207654_10246069 3300025911 Bacteria 1197
111 Ga0207707_10929245 3300025912 Bacteria 718
112 Ga0207707_11133051 3300025912 Unclassified 636
113 Ga0207695_10468837 3300025913 Bacteria 1142
114 Ga0207695_10943445 3300025913 Bacteria 742
115 Ga0207695_11549892 3300025913 Bacteria 543
116 Ga0207671_10100020 3300025914 Bacteria 2195
117 Ga0207693_10000920 3300025915 Bacteria 26422
118 Ga0207693_10056091 3300025915 Bacteria 3089
119 Ga0207693_10984969 3300025915 Bacteria 644
120 Ga0207663_10040434 3300025916 Bacteria 2834
121 Ga0207663_10049943 3300025916 Bacteria 2597
122 Ga0207663_11268661 3300025916 Unclassified 593
123 Ga0207660_11165498 3300025917 Bacteria 627
124 Ga0207657_10007057 3300025919 Bacteria 11541
125 Ga0207649_10840893 3300025920 Bacteria 718
126 Ga0207652_10070692 3300025921 Bacteria 3031
127 Ga0207652_10083310 3300025921 Bacteria 2800
128 Ga0207652_10519587 3300025921 Unclassified 1071
129 Ga0207646_10003186 3300025922 Bacteria 18746
130 Ga0207646_10720675 3300025922 Bacteria 891
131 Ga0207694_11023191 3300025924 Unclassified 699
132 Ga0207687_10070400 3300025927 Bacteria 2497
133 Ga0207687_11795156 3300025927 Bacteria 525
134 Ga0207700_10181093 3300025928 Bacteria 1764
135 Ga0207700_10495829 3300025928 Bacteria 1080
136 Ga0207664_10005724 3300025929 Bacteria 8499
137 Ga0207664_10012625 3300025929 Bacteria 6044
138 Ga0207664_10027641 3300025929 Bacteria 4303
139 Ga0207664_10052104 3300025929 Bacteria 3235
140 Ga0207664_10212947 3300025929 Bacteria 1673
141 Ga0207664_10248641 3300025929 Bacteria 1551
142 Ga0207664_10260880 3300025929 Bacteria 1515
143 Ga0207664_11898742 3300025929 Unclassified 518
144 Ga0207644_10413472 3300025931 Bacteria 1104
145 Ga0207644_11021615 3300025931 Bacteria 694
146 Ga0207690_11694655 3300025932 Bacteria 528
147 Ga0207665_10000247 3300025939 Bacteria 37247
148 Ga0207665_10109389 3300025939 Bacteria 1940
149 Ga0207665_10402180 3300025939 Bacteria 1043
150 Ga0207711_10410325 3300025941 Bacteria 1259
151 Ga0207711_11358085 3300025941 Bacteria 653
152 Ga0207661_10923063 3300025944 Bacteria 804
153 Ga0207667_11748582 3300025949 Unclassified 587
154 Ga0207702_10269760 3300026078 Bacteria 1605
155 Ga0207702_11569370 3300026078 Unclassified 651
156 Ga0207683_10886003 3300026121 Unclassified 829
157 Ga0207698_12467477 3300026142 Bacteria 530
158 Ga0268265_11482385 3300028380 Bacteria 682
159 Ga0265337_1055201 3300028556 Unclassified 1110
160 Ga0265336_10010674 3300028666 Bacteria 3144
161 Ga0265338_10126146 3300028800 Bacteria 2030
162 Ga0265325_10163300 3300031241 Bacteria 1046
163 Ga0265325_10332501 3300031241 Unclassified 673
164 Ga0265340_10296098 3300031247 Unclassified 718
165 Ga0265339_10160011 3300031249 Bacteria 1133
166 Ga0265331_10190649 3300031250 Unclassified 925
167 Ga0265327_10174949 3300031251 Unclassified 984
168 Ga0265316_10097900 3300031344 Bacteria 2232
169 Ga0265313_10028282 3300031595 Bacteria 2917
170 Ga0265313_10128221 3300031595 Bacteria 1101
171 Ga0265314_10044092 3300031711 Bacteria 3164
172 Ga0265342_10062192 3300031712 Bacteria 2198
173 Ga0373926_0035748 3300035083 Bacteria 1763
174 Ga0373929_0034313 3300035085 Bacteria 1100
175 Ga0373934_0033658 3300035086 Bacteria 2012
176 Ga0373944_0401694 3300035089 Bacteria 528
177 Ga0373923_0142458 3300035111 Bacteria 1084
178 Ga0373936_0009693 3300035113 Bacteria 3631
179 Ga0373953_0139413 3300035117 Bacteria 1037
180 Ga0373953_0241338 3300035117 Unclassified 785
181 Ga0373954_0219284 3300035118 Bacteria 936
182 Ga0373954_0470906 3300035118 Unclassified 622
183 Ga0373960_0145081 3300035121 Unclassified 807
184 Ga0373943_0002789 3300035170 Bacteria 7945
185 Ga0373943_0390896 3300035170 Bacteria 802
186 Ga0373943_0536929 3300035170 Bacteria 686
187 Ga0373946_0004467 3300035171 Bacteria 5008
188 Ga0373955_0223890 3300035172 Bacteria 1124
189 Ga0373924_0180569 3300035410 Unclassified 929
190 Ga0373931_0541462 3300035691 Bacteria 755
191 Ga0373935_0222211 3300035692 Bacteria 1312
192 Ga0373927_0162189 3300035695 Bacteria 1464
193 Ga0373933_0419818 3300035724 Unclassified 874
194 Ga0373933_0569949 3300035724 Bacteria 743
195 Ga0373947_1240694 3300035725 Bacteria 508
196 Ga0373937_0000355 3300036401 Bacteria 42585
197 Ga0373937_0421635 3300036401 Bacteria 1267
198 Ga0373925_0082747 3300037068 Bacteria 2443
199 Ga0373925_0374524 3300037068 Bacteria 1159
200 Ga0395899_0564187 3300037312 Bacteria 730
201 Ga0395900_0135664 3300037418 Bacteria 2521
202 Ga0395900_0529262 3300037418 Bacteria 1126
203 Ga0395900_1033089 3300037418 Unclassified 741
204 Ga0395901_0026769 3300038443 Bacteria 5921
205 Ga0395901_1297036 3300038443 Bacteria 690
206 Ga0436360_0052335 3300039438 Bacteria 6752
207 Ga0451577_0212024 3300042876 Bacteria 1750
208 Ga0466969_0000591 3300044656 Bacteria 19709
209 Ga0466965_0065742 3300044683 Bacteria 1817
210 Ga0466965_0500394 3300044683 Bacteria 681
211 Ga0466966_0082306 3300044684 Bacteria 2003
212 Ga0466966_0238648 3300044684 Bacteria 1096
213 Ga0466961_0025254 3300044693 Bacteria 3821
214 Ga0466961_0025331 3300044693 Bacteria 3815
215 Ga0466961_0100878 3300044693 Bacteria 1818
216 Ga0466961_0111684 3300044693 Bacteria 1719
217 Ga0466963_0000871 3300044694 Bacteria 15281
218 Ga0466963_0001043 3300044694 Bacteria 14384
219 Ga0466963_0001689 3300044694 Bacteria 12020
220 Ga0466963_0002486 3300044694 Bacteria 10306
221 Ga0466963_0012681 3300044694 Bacteria 5162
222 Ga0466963_0014974 3300044694 Bacteria 4792
223 Ga0466963_0032721 3300044694 Bacteria 3369
224 Ga0466963_0033719 3300044694 Bacteria 3326
225 Ga0466963_0049198 3300044694 Bacteria 2787
226 Ga0466963_0067249 3300044694 Bacteria 2404
227 Ga0466963_0084756 3300044694 Bacteria 2150
228 Ga0466963_0125033 3300044694 Bacteria 1772
229 Ga0466963_0262564 3300044694 Bacteria 1212
230 Ga0466963_0439403 3300044694 Unclassified 920
231 Ga0466963_0630496 3300044694 Unclassified 757
232 Ga0466963_0662784 3300044694 Unclassified 736
233 Ga0466963_0731326 3300044694 Unclassified 698
234 Ga0466963_1198249 3300044694 Bacteria 533
235 Ga0466964_0006431 3300044706 Bacteria 4377
236 Ga0466964_0010339 3300044706 Bacteria 3520
237 Ga0466964_0010666 3300044706 Bacteria 3467
238 Ga0466964_0011937 3300044706 Bacteria 3284
239 Ga0466964_0065430 3300044706 Bacteria 1523
240 Ga0466964_0221827 3300044706 Bacteria 918
241 Ga0466964_0516926 3300044706 Bacteria 643
242 Ga0466964_0581652 3300044706 Unclassified 612
243 Ga0466964_0626531 3300044706 Bacteria 592
244 Ga0466971_0002846 3300044719 Bacteria 7336
245 Ga0466971_0009961 3300044719 Bacteria 4151
246 Ga0466971_0089829 3300044719 Bacteria 1406
247 Ga0466968_0002250 3300044735 Bacteria 7058
248 Ga0466968_0018226 3300044735 Bacteria 2814
249 Ga0466968_0050404 3300044735 Bacteria 1776
250 Ga0466968_0097976 3300044735 Bacteria 1306
251 Ga0466968_0113857 3300044735 Bacteria 1218
252 Ga0466968_0148588 3300044735 Bacteria 1076
253 Ga0466968_0244895 3300044735 Unclassified 850
254 Ga0466968_0300860 3300044735 Bacteria 771
255 Ga0466968_0305447 3300044735 Unclassified 766
256 Ga0466968_0443659 3300044735 Bacteria 641
257 Ga0466968_0749286 3300044735 Bacteria 501
258 Ga0466970_0077611 3300044765 Bacteria 1791
259 Ga0466970_0144889 3300044765 Bacteria 1310
260 Ga0466957_0007870 3300044842 Bacteria 6044
261 Ga0466957_0015917 3300044842 Bacteria 4396
262 Ga0466957_0015978 3300044842 Bacteria 4386
263 Ga0466957_0062440 3300044842 Bacteria 2288
264 Ga0466957_0241772 3300044842 Bacteria 1198
265 Ga0466957_0303934 3300044842 Bacteria 1072
266 Ga0466960_0022463 3300044901 Bacteria 2821
267 Ga0466960_0057200 3300044901 Bacteria 1901
268 Ga0466960_0192142 3300044901 Bacteria 1111
269 Ga0466960_0777107 3300044901 Bacteria 579
270 Ga0466959_0006164 3300045049 Bacteria 8285
271 Ga0466959_0070978 3300045049 Bacteria 2523
272 Ga0466959_0132717 3300045049 Bacteria 1764
273 Ga0466958_0001514 3300045836 Bacteria 11125
274 Ga0466958_0005900 3300045836 Bacteria 6620
275 Ga0466958_0008230 3300045836 Bacteria 5775
276 Ga0466958_0017218 3300045836 Bacteria 4173
277 Ga0466958_0026435 3300045836 Bacteria 3430
278 Ga0466958_0056485 3300045836 Bacteria 2384
279 Ga0466958_0398368 3300045836 Bacteria 889
280 Ga0466958_0422748 3300045836 Bacteria 861
281 Ga0466967_0000173 3300045976 Bacteria 26504
282 Ga0466967_0001483 3300045976 Bacteria 13692
283 Ga0466967_0009541 3300045976 Bacteria 7209
284 Ga0466967_0025980 3300045976 Bacteria 4840
285 Ga0466967_0030265 3300045976 Bacteria 4541
286 Ga0466967_0035242 3300045976 Bacteria 4257
287 Ga0466967_0037934 3300045976 Bacteria 4129
288 Ga0466967_0046397 3300045976 Bacteria 3782
289 Ga0466967_0048433 3300045976 Bacteria 3710
290 Ga0466967_0056230 3300045976 Bacteria 3468
291 Ga0466967_0071866 3300045976 Bacteria 3099
292 Ga0466967_0080509 3300045976 Bacteria 2939
293 Ga0466967_0133655 3300045976 Bacteria 2305
294 Ga0466967_0155053 3300045976 Bacteria 2144
295 Ga0466967_0194025 3300045976 Bacteria 1920
296 Ga0466967_0219134 3300045976 Bacteria 1807
297 Ga0466967_0473342 3300045976 Bacteria 1226
298 Ga0466967_1078260 3300045976 Unclassified 800
299 Ga0466967_1448233 3300045976 Bacteria 684
300 Ga0495592_0000635 3300046454 Bacteria 24391
301 Ga0495592_0000769 3300046454 Bacteria 22286
302 Ga0495592_0255814 3300046454 Bacteria 1155
303 Ga0495592_0366300 3300046454 Bacteria 920
304 Ga0495603_0012764 3300046455 Bacteria 5080
305 Ga0495603_0387814 3300046455 Bacteria 801
306 Ga0495629_0048615 3300046459 Bacteria 2973
307 Ga0495629_0331547 3300046459 Unclassified 1039
308 Ga0495629_0351677 3300046459 Bacteria 1005
309 Ga0495641_0021247 3300046461 Bacteria 3268
310 Ga0495641_0056809 3300046461 Bacteria 1773
311 Ga0495641_0057633 3300046461 Bacteria 1759
312 Ga0495641_0264111 3300046461 Unclassified 774
313 Ga0495641_0300788 3300046461 Unclassified 723
314 Ga0495651_0000029 3300046462 Bacteria 105042
315 Ga0495651_0403323 3300046462 Bacteria 892
316 Ga0495651_0462084 3300046462 Bacteria 818
317 Ga0495653_0003221 3300046463 Bacteria 13077
318 Ga0495653_0036940 3300046463 Bacteria 3843
319 Ga0495653_0071061 3300046463 Bacteria 2603
320 Ga0495653_0093395 3300046463 Bacteria 2194
321 Ga0495653_0223265 3300046463 Bacteria 1265
322 Ga0495653_0546534 3300046463 Bacteria 717
323 Ga0495580_0050971 3300046472 Bacteria 2926
324 Ga0495580_0531272 3300046472 Bacteria 783
325 Ga0495582_0170642 3300046473 Bacteria 1238
326 Ga0495582_0182664 3300046473 Bacteria 1195
327 Ga0495582_0250913 3300046473 Bacteria 1015
328 Ga0495582_0264042 3300046473 Bacteria 987
329 Ga0495582_0312659 3300046473 Unclassified 904
330 Ga0495605_0063632 3300046474 Bacteria 1759
331 Ga0495639_0002681 3300046475 Bacteria 7730
332 Ga0495639_0329808 3300046475 Unclassified 764
333 Ga0495662_0011724 3300046476 Bacteria 4285
334 Ga0495662_0014853 3300046476 Bacteria 3783
335 Ga0495664_0007196 3300046477 Bacteria 6170
336 Ga0495664_0045576 3300046477 Bacteria 2600
337 Ga0495664_0135257 3300046477 Bacteria 1493
338 Ga0495664_0244377 3300046477 Unclassified 1085
339 Ga0495664_0353612 3300046477 Unclassified 884
340 Ga0495664_0614618 3300046477 Bacteria 645
341 Ga0495584_0066410 3300046491 Bacteria 1814
342 Ga0495594_0232163 3300046499 Bacteria 1052
343 Ga0495594_0342603 3300046499 Bacteria 851
344 Ga0495594_0475781 3300046499 Unclassified 710
345 Ga0495594_0488433 3300046499 Unclassified 700
346 Ga0495607_0112495 3300046501 Bacteria 1441
347 Ga0495608_0008612 3300046511 Bacteria 7142
348 Ga0495608_0117279 3300046511 Bacteria 1708
349 Ga0495608_0558337 3300046511 Bacteria 689
350 Ga0495618_0001935 3300046514 Bacteria 13569
351 Ga0495618_0159673 3300046514 Bacteria 1437
352 Ga0495618_0171347 3300046514 Bacteria 1381
353 Ga0495618_0187311 3300046514 Bacteria 1313
354 Ga0495618_0279493 3300046514 Bacteria 1041
355 Ga0495628_0000016 3300046516 Bacteria 170260
356 Ga0495628_0081995 3300046516 Bacteria 2505
357 Ga0495628_0817008 3300046516 Unclassified 651
358 Ga0495630_0010255 3300046517 Bacteria 6760
359 Ga0495630_0041538 3300046517 Bacteria 3434
360 Ga0495630_0102755 3300046517 Bacteria 2162
361 Ga0495630_0423075 3300046517 Unclassified 1020
362 Ga0495630_0756489 3300046517 Unclassified 742
363 Ga0495631_0152875 3300046518 Bacteria 990
364 Ga0495644_0034283 3300046523 Bacteria 1916
365 Ga0495663_0054293 3300046525 Bacteria 1247
366 Ga0495666_0001728 3300046526 Bacteria 10773
367 Ga0495666_0114151 3300046526 Bacteria 1268
368 Ga0495642_0049361 3300046528 Bacteria 1728
369 Ga0495652_0001228 3300046529 Bacteria 28728
370 Ga0495652_0011063 3300046529 Bacteria 8176
371 Ga0495652_0075687 3300046529 Bacteria 2795
372 Ga0495652_0305759 3300046529 Bacteria 1154
373 Ga0495652_0367901 3300046529 Bacteria 1025
374 Ga0495665_0020866 3300046531 Bacteria 3519
375 Ga0495640_0047657 3300046533 Bacteria 2965
376 Ga0495640_0055771 3300046533 Bacteria 2702
377 Ga0495640_0224494 3300046533 Bacteria 1183
378 Ga0495640_0321382 3300046533 Bacteria 958
379 Ga0495586_0026226 3300046535 Bacteria 3118
380 Ga0495586_0103981 3300046535 Bacteria 1577
381 Ga0495586_0146656 3300046535 Bacteria 1326
382 Ga0495586_0167849 3300046535 Bacteria 1239
383 Ga0495587_0000434 3300046536 Bacteria 29352
384 Ga0495587_0021328 3300046536 Bacteria 3994
385 Ga0495587_0231021 3300046536 Bacteria 1042
386 Ga0495598_0052853 3300046537 Bacteria 1229
387 Ga0495609_0047750 3300046538 Bacteria 1915
388 Ga0495645_0000367 3300046543 Bacteria 31425
389 Ga0495645_0009395 3300046543 Bacteria 6836
390 Ga0495645_0191154 3300046543 Bacteria 1395
391 Ga0495645_0972668 3300046543 Unclassified 500
392 Ga0495667_0028356 3300046559 Bacteria 3770
393 Ga0495667_0062525 3300046559 Bacteria 2439
394 Ga0495667_0398152 3300046559 Bacteria 867
395 Ga0495667_0512084 3300046559 Bacteria 751
396 Ga0495656_0008107 3300046615 Bacteria 3739
397 Ga0495634_0200365 3300046642 Bacteria 1240
398 Ga0495634_0205587 3300046642 Bacteria 1221
399 Ga0495634_0208878 3300046642 Unclassified 1209
400 Ga0495634_0218501 3300046642 Bacteria 1177
401 Ga0495634_0762202 3300046642 Bacteria 553
402 Ga0495611_0173314 3300046648 Bacteria 1008
403 Ga0495635_0088310 3300046663 Bacteria 2121
404 Ga0495635_0218802 3300046663 Bacteria 1288
405 Ga0495635_0255206 3300046663 Unclassified 1181
406 Ga0495635_0782561 3300046663 Bacteria 615
407 Ga0495661_0087600 3300046665 Bacteria 1780
408 Ga0495588_0249961 3300046674 Unclassified 935
409 Ga0495657_0002796 3300046675 Bacteria 14500
410 Ga0495657_0003896 3300046675 Bacteria 12010
411 Ga0495657_0108292 3300046675 Bacteria 1763
412 Ga0495657_0547502 3300046675 Unclassified 672
413 Ga0495657_0583949 3300046675 Bacteria 647
414 Ga0495599_0000187 3300046678 Bacteria 40807
415 Ga0495599_0001457 3300046678 Bacteria 13574
416 Ga0495599_0227875 3300046678 Bacteria 1138
417 Ga0495623_0000121 3300046679 Bacteria 47882
418 Ga0495623_0053918 3300046679 Bacteria 2538
419 Ga0495646_0000742 3300046680 Bacteria 18135
420 Ga0495646_0294471 3300046680 Bacteria 860
421 Ga0495647_0035085 3300046681 Bacteria 1881
422 Ga0495647_0124002 3300046681 Unclassified 1089
423 Ga0495647_0133263 3300046681 Bacteria 1054
424 Ga0495647_0625496 3300046681 Bacteria 506
425 Ga0495658_0055353 3300046683 Bacteria 2259
426 Ga0495658_0449291 3300046683 Bacteria 823
427 Ga0495658_0617489 3300046683 Unclassified 694
428 Ga0495613_0048649 3300046689 Bacteria 3131
429 Ga0495613_0051744 3300046689 Bacteria 3026
430 Ga0495613_0096978 3300046689 Bacteria 2132
431 Ga0495613_0348970 3300046689 Bacteria 1016
432 Ga0495624_0013715 3300046690 Bacteria 5518
433 Ga0495624_0034100 3300046690 Bacteria 3294
434 Ga0495624_0055294 3300046690 Bacteria 2500
435 Ga0495589_0047317 3300046794 Bacteria 2132
436 Ga0495600_0022357 3300046809 Bacteria 4058
437 Ga0495600_0478020 3300046809 Bacteria 768
438 Ga0495581_0013623 3300047315 Bacteria 4716
439 Ga0495581_0066952 3300047315 Bacteria 2077
440 Ga0495581_0578464 3300047315 Unclassified 651
441 Ga0495581_0775892 3300047315 Unclassified 551
442 Ga0495604_0000628 3300047317 Bacteria 30365
443 Ga0495604_0053337 3300047317 Bacteria 3126
444 Ga0495604_0121086 3300047317 Bacteria 1894
445 Ga0495604_0341924 3300047317 Unclassified 996
446 Ga0495636_0028003 3300047318 Bacteria 2296
447 Ga0495674_0096821 3300047319 Bacteria 2514
448 Ga0495674_0161360 3300047319 Bacteria 1875
449 Ga0495674_0328870 3300047319 Bacteria 1244
450 Ga0495674_0612585 3300047319 Bacteria 861
451 Ga0495676_0131799 3300047321 Bacteria 1803
452 Ga0495676_0273683 3300047321 Bacteria 1145
453 Ga0495676_0453934 3300047321 Bacteria 845
454 Ga0495676_0458510 3300047321 Unclassified 840
455 Ga0495676_0585364 3300047321 Bacteria 727
456 Ga0495680_0002048 3300047322 Bacteria 21061
457 Ga0495680_0040968 3300047322 Bacteria 3685
458 Ga0495680_0056576 3300047322 Bacteria 3036
459 Ga0495680_0086017 3300047322 Bacteria 2366
460 Ga0495680_0091971 3300047322 Bacteria 2273
461 Ga0495680_0557781 3300047322 Bacteria 771
462 Ga0495675_0000031 3300047444 Bacteria 99240
463 Ga0495677_0083042 3300047445 Bacteria 1202
464 Ga0495684_0009072 3300047471 Bacteria 7681
465 Ga0495684_0041052 3300047471 Bacteria 3546
466 Ga0495684_0074185 3300047471 Bacteria 2584
467 Ga0495684_0134268 3300047471 Bacteria 1857
468 Ga0495684_0179522 3300047471 Bacteria 1570
469 Ga0495684_0201006 3300047471 Bacteria 1469
470 Ga0495593_0018216 3300047673 Bacteria 3948
471 Ga0495593_0078079 3300047673 Bacteria 1715
472 Ga0495602_0000133 3300048088 Bacteria 69392
473 Ga0495602_0018304 3300048088 Bacteria 7000
474 Ga0495602_0213416 3300048088 Bacteria 1463
475 Ga0495614_0011907 3300048089 Bacteria 3822
476 Ga0496100_0011817 3300048903 Bacteria 4981
477 Ga0496100_0099642 3300048903 Bacteria 2000
478 Ga0496100_0183828 3300048903 Bacteria 1513
479 Ga0496100_0200765 3300048903 Bacteria 1453
480 Ga0496100_0502937 3300048903 Archaea 934
481 Ga0496100_1269450 3300048903 Bacteria 581
482 Ga0496101_0189621 3300048904 Bacteria 1586
483 Ga0496101_0254915 3300048904 Bacteria 1367
484 Ga0496101_0406060 3300048904 Unclassified 1073
485 Ga0496101_0463292 3300048904 Bacteria 1000
486 Ga0496101_0568599 3300048904 Unclassified 896
487 Ga0496101_0694904 3300048904 Bacteria 803
488 Ga0496102_0353437 3300048905 Bacteria 1384
489 Ga0496102_0650753 3300048905 Unclassified 977
490 Ga0496103_0037168 3300048906 Bacteria 2983
491 Ga0496104_0005551 3300048907 Bacteria 11047
492 Ga0496104_0055658 3300048907 Bacteria 3740
493 Ga0496104_0322206 3300048907 Bacteria 1458
494 Ga0496104_0536779 3300048907 Unclassified 1080
495 Ga0496105_0039159 3300048908 Bacteria 3906
496 Ga0496105_0070205 3300048908 Bacteria 2895
497 Ga0496105_0652155 3300048908 Bacteria 812
498 Ga0496106_0063164 3300048909 Bacteria 2813
499 Ga0496106_0939491 3300048909 Bacteria 682
500 Ga0496107_0026994 3300048910 Bacteria 4075
501 Ga0496107_0202988 3300048910 Bacteria 1473
502 Ga0496107_0469156 3300048910 Bacteria 934
503 Ga0496107_0557468 3300048910 Bacteria 848
504 Ga0496107_0753134 3300048910 Bacteria 715
505 Ga0496108_0089334 3300048911 Bacteria 2618
506 Ga0496108_0136557 3300048911 Bacteria 2110
507 Ga0496108_0144943 3300048911 Bacteria 2047
508 Ga0496108_0255584 3300048911 Bacteria 1524
509 Ga0496109_0025610 3300048912 Bacteria 5257
510 Ga0496109_0073674 3300048912 Bacteria 3138
511 Ga0496109_0090085 3300048912 Bacteria 2836
512 Ga0496109_0441457 3300048912 Bacteria 1229
513 Ga0496110_0089715 3300048913 Bacteria 2748
514 Ga0496110_0252728 3300048913 Bacteria 1604
515 Ga0496110_0816642 3300048913 Unclassified 837
516 Ga0496111_0016883 3300048914 Bacteria 5038
517 Ga0496111_0079586 3300048914 Bacteria 2391
518 Ga0496111_0325031 3300048914 Bacteria 1139
519 Ga0496111_0573456 3300048914 Bacteria 827
520 Ga0496112_0037033 3300048915 Bacteria 4761
521 Ga0496112_0097016 3300048915 Bacteria 2918
522 Ga0496112_0493536 3300048915 Bacteria 1160
523 Ga0496112_0873842 3300048915 Bacteria 822
524 Ga0496113_0080781 3300048916 Bacteria 2491
525 Ga0496113_0539786 3300048916 Unclassified 936
526 Ga0496114_0092279 3300048917 Bacteria 2572
527 Ga0496114_0204420 3300048917 Bacteria 1731
528 Ga0496114_0232350 3300048917 Unclassified 1620
529 Ga0496114_0261975 3300048917 Bacteria 1522
530 Ga0496115_0004285 3300048918 Bacteria 10329
531 Ga0496115_0175756 3300048918 Bacteria 1770
532 Ga0496115_0418166 3300048918 Bacteria 1086
533 Ga0496115_0543255 3300048918 Bacteria 929
534 Ga0501067_0002804 3300049583 Bacteria 9587
535 Ga0501067_0222378 3300049583 Bacteria 1051
536 Ga0501069_0155700 3300049585 Bacteria 1314
537 Ga0501070_1298386 3300049586 Bacteria 556
538 nmdc:mga0n895_16746_c1 3300050512 Bacteria 6736
539 nmdc:mga0rr50_80843_c1 3300050513 Bacteria 2506
540 nmdc:mga08x19_47476_c1 3300050514 Bacteria 2748
541 nmdc:mga0a205_239560_c1 3300050515 Bacteria 1695
542 Ga0495601_0001112 3300053077 Bacteria 14736
543 Ga0495601_0017959 3300053077 Bacteria 4300
544 Ga0495601_0059478 3300053077 Bacteria 2423
545 Ga0495601_0195966 3300053077 Bacteria 1320
546 Ga0495601_0467013 3300053077 Bacteria 815
547 Ga0495601_0600093 3300053077 Unclassified 706
548 Ga0495601_0748153 3300053077 Bacteria 622
549 Ga0495612_0005613 3300053078 Bacteria 5185
550 Ga0495612_0016048 3300053078 Bacteria 3001
551 Ga0495612_0019018 3300053078 Bacteria 2749
552 Ga0495612_0099490 3300053078 Unclassified 1237
553 Ga0495612_0121809 3300053078 Bacteria 1122
554 Ga0495595_0010724 3300053084 Bacteria 3818
555 Ga0495595_0152537 3300053084 Bacteria 1137
556 Ga0495595_0202045 3300053084 Bacteria 989
557 Ga0495595_0271437 3300053084 Bacteria 851
558 Ga0495595_0426313 3300053084 Bacteria 673
559 Ga0495595_0493782 3300053084 Bacteria 623
560 Ga0495619_0001848 3300053085 Bacteria 14098
561 Ga0495619_0034416 3300053085 Bacteria 3293
562 Ga0495619_0043663 3300053085 Bacteria 2940
563 Ga0495619_0086108 3300053085 Bacteria 2123
564 Ga0495619_0518236 3300053085 Unclassified 819
565 Ga0495619_0624231 3300053085 Bacteria 736
566 Ga0500566_0264115 3300053094 Bacteria 829
567 Ga0466962_0002207 3300061719 Bacteria 9202
568 Ga0466962_0006327 3300061719 Bacteria 5682
569 Ga0466962_0022218 3300061719 Bacteria 3047
570 Ga0466962_0095403 3300061719 Bacteria 1426
571 Ga0466962_0109315 3300061719 Bacteria 1331
572 Ga0466962_0110852 3300061719 Bacteria 1321
573 Ga0466962_0144375 3300061719 Bacteria 1153
574 Ga0466962_0293136 3300061719 Unclassified 804
575 Ga0068868_100873546
576 Ga0070658_10029027
577 Ga0070683_100033099
578 Ga0070683_100176363
579 Ga0070680_100020222
580 Ga0070660_100279618
581 Ga0070691_10065565
582 Ga0070687_100935544
583 Ga0070661_100493760
584 Ga0070671_100377321
585 Ga0070659_100566540
586 Ga0070709_10215543
587 Ga0070714_100017044
588 Ga0070714_100041854
589 Ga0070714_100082104
590 Ga0070714_100133382
591 Ga0070714_100456265
592 Ga0070714_101202173
593 Ga0070714_101668086
594 Ga0070713_100089995
595 Ga0070713_100131149
596 Ga0070713_100148289
597 Ga0070713_100400577
598 Ga0070710_10005551
599 Ga0070710_10374342
600 Ga0070710_10965966
601 Ga0070710_11180612
602 Ga0070711_100037868
603 Ga0070711_100122256
604 Ga0070711_100189184
605 Ga0070705_100558626
606 Ga0070694_100535929
607 Ga0070708_101608034
608 Ga0070663_101558836
609 Ga0070678_101431265
610 Ga0070681_10105062
611 Ga0070681_10154961
612 Ga0070707_100053472
613 Ga0070707_101247126
614 Ga0070698_100175864
615 Ga0070698_100369649
616 Ga0070679_100153869
617 Ga0070679_100224782
618 Ga0070684_100068484
619 Ga0070684_100220955
620 Ga0070684_100737054
621 Ga0070684_102031398
622 Ga0070695_100009706
623 Ga0070696_101017416
624 Ga0070696_101710802
625 Ga0070704_100154544
626 Ga0068856_100057152
627 Ga0068856_100904213
628 Ga0070702_101027901
629 Ga0070702_101077657
630 Ga0068862_102328216
631 Ga0070717_10008777
632 Ga0070717_10012173
633 Ga0070717_10024498
634 Ga0070717_10071173
635 Ga0070717_10080258
636 Ga0070717_10272507
637 Ga0070717_10842112
638 Ga0070715_10001143
639 Ga0070715_10711507
640 Ga0070716_100007577
641 Ga0070716_101053950
642 Ga0070712_100136857
643 Ga0070712_100145704
644 Ga0070712_101151912
645 Ga0070712_101174053
646 Ga0070712_101733128
647 Ga0070712_101909732
648 Ga0075433_10193155
649 Ga0075434_100032113
650 Ga0075436_100104450
651 Ga0075436_100345329
652 Ga0075435_100468767
653 Ga0099795_10177152
654 Ga0105240_10123304
655 Ga0105240_10467621
656 Ga0105240_10959699
657 Ga0105245_10407924
658 Ga0105245_10798074
659 Ga0105241_10155395
660 Ga0105241_10399684
661 Ga0105248_12765200
662 Ga0105237_10284587
663 Ga0157369_10060976
664 Ga0157369_10209514
665 Ga0157369_11737868
666 Ga0163162_10148966
667 Ga0157372_10044465
668 Ga0157372_10371525
669 Ga0157372_11282815
670 Ga0157372_11295488
671 Ga0157372_12670598
672 Ga0163163_11280075
673 Ga0182008_10372909
674 Ga0157376_10007904
675 Ga0157376_11681760
676 Ga0157376_12136908
677 Ga0213871_10002024
678 Ga0224712_10292303
679 Ga0207692_10626526
680 Ga0207685_10002797
681 Ga0207685_10290741
682 Ga0207699_10008441
683 Ga0207699_10084715
684 Ga0207654_10246069
685 Ga0207707_10929245
686 Ga0207707_11133051
687 Ga0207695_10468837
688 Ga0207695_10943445
689 Ga0207695_11549892
690 Ga0207671_10100020
691 Ga0207693_10000920
692 Ga0207693_10056091
693 Ga0207693_10984969
694 Ga0207663_10040434
695 Ga0207663_10049943
696 Ga0207663_11268661
697 Ga0207660_11165498
698 Ga0207657_10007057
699 Ga0207649_10840893
700 Ga0207652_10070692
701 Ga0207652_10083310
702 Ga0207652_10519587
703 Ga0207646_10003186
704 Ga0207646_10720675
705 Ga0207694_11023191
706 Ga0207687_10070400
707 Ga0207687_11795156
708 Ga0207700_10181093
709 Ga0207700_10495829
710 Ga0207664_10005724
711 Ga0207664_10012625
712 Ga0207664_10027641
713 Ga0207664_10052104
714 Ga0207664_10212947
715 Ga0207664_10248641
716 Ga0207664_10260880
717 Ga0207664_11898742
718 Ga0207644_10413472
719 Ga0207644_11021615
720 Ga0207690_11694655
721 Ga0207665_10000247
722 Ga0207665_10109389
723 Ga0207665_10402180
724 Ga0207711_10410325
725 Ga0207711_11358085
726 Ga0207661_10923063
727 Ga0207667_11748582
728 Ga0207702_10269760
729 Ga0207702_11569370
730 Ga0207683_10886003
731 Ga0207698_12467477
732 Ga0268265_11482385
733 Ga0265337_1055201
734 Ga0265336_10010674
735 Ga0265338_10126146
736 Ga0265325_10163300
737 Ga0265325_10332501
738 Ga0265340_10296098
739 Ga0265339_10160011
740 Ga0265331_10190649
741 Ga0265327_10174949
742 Ga0265316_10097900
743 Ga0265313_10028282
744 Ga0265313_10128221
745 Ga0265314_10044092
746 Ga0265342_10062192
747 Ga0373926_0035748
748 Ga0373929_0034313
749 Ga0373934_0033658
750 Ga0373944_0401694
751 Ga0373923_0142458
752 Ga0373936_0009693
753 Ga0373953_0139413
754 Ga0373953_0241338
755 Ga0373954_0219284
756 Ga0373954_0470906
757 Ga0373960_0145081
758 Ga0373943_0002789
759 Ga0373943_0390896
760 Ga0373943_0536929
761 Ga0373946_0004467
762 Ga0373955_0223890
763 Ga0373924_0180569
764 Ga0373931_0541462
765 Ga0373935_0222211
766 Ga0373927_0162189
767 Ga0373933_0419818
768 Ga0373933_0569949
769 Ga0373947_1240694
770 Ga0373937_0000355
771 Ga0373937_0421635
772 Ga0373925_0082747
773 Ga0373925_0374524
774 Ga0395899_0564187
775 Ga0395900_0135664
776 Ga0395900_0529262
777 Ga0395900_1033089
778 Ga0395901_0026769
779 Ga0395901_1297036
780 Ga0436360_0052335
781 Ga0451577_0212024
782 Ga0466969_0000591
783 Ga0466965_0065742
784 Ga0466965_0500394
785 Ga0466966_0082306
786 Ga0466966_0238648
787 Ga0466961_0025254
788 Ga0466961_0025331
789 Ga0466961_0100878
790 Ga0466961_0111684
791 Ga0466963_0000871
792 Ga0466963_0001043
793 Ga0466963_0001689
794 Ga0466963_0002486
795 Ga0466963_0012681
796 Ga0466963_0014974
797 Ga0466963_0032721
798 Ga0466963_0033719
799 Ga0466963_0049198
800 Ga0466963_0067249
801 Ga0466963_0084756
802 Ga0466963_0125033
803 Ga0466963_0262564
804 Ga0466963_0439403
805 Ga0466963_0630496
806 Ga0466963_0662784
807 Ga0466963_0731326
808 Ga0466963_1198249
809 Ga0466964_0006431
810 Ga0466964_0010339
811 Ga0466964_0010666
812 Ga0466964_0011937
813 Ga0466964_0065430
814 Ga0466964_0221827
815 Ga0466964_0516926
816 Ga0466964_0581652
817 Ga0466964_0626531
818 Ga0466971_0002846
819 Ga0466971_0009961
820 Ga0466971_0089829
821 Ga0466968_0002250
822 Ga0466968_0018226
823 Ga0466968_0050404
824 Ga0466968_0097976
825 Ga0466968_0113857
826 Ga0466968_0148588
827 Ga0466968_0244895
828 Ga0466968_0300860
829 Ga0466968_0305447
830 Ga0466968_0443659
831 Ga0466968_0749286
832 Ga0466970_0077611
833 Ga0466970_0144889
834 Ga0466957_0007870
835 Ga0466957_0015917
836 Ga0466957_0015978
837 Ga0466957_0062440
838 Ga0466957_0241772
839 Ga0466957_0303934
840 Ga0466960_0022463
841 Ga0466960_0057200
842 Ga0466960_0192142
843 Ga0466960_0777107
844 Ga0466959_0006164
845 Ga0466959_0070978
846 Ga0466959_0132717
847 Ga0466958_0001514
848 Ga0466958_0005900
849 Ga0466958_0008230
850 Ga0466958_0017218
851 Ga0466958_0026435
852 Ga0466958_0056485
853 Ga0466958_0398368
854 Ga0466958_0422748
855 Ga0466967_0000173
856 Ga0466967_0001483
857 Ga0466967_0009541
858 Ga0466967_0025980
859 Ga0466967_0030265
860 Ga0466967_0035242
861 Ga0466967_0037934
862 Ga0466967_0046397
863 Ga0466967_0048433
864 Ga0466967_0056230
865 Ga0466967_0071866
866 Ga0466967_0080509
867 Ga0466967_0133655
868 Ga0466967_0155053
869 Ga0466967_0194025
870 Ga0466967_0219134
871 Ga0466967_0473342
872 Ga0466967_1078260
873 Ga0466967_1448233
874 Ga0495592_0000635
875 Ga0495592_0000769
876 Ga0495592_0255814
877 Ga0495592_0366300
878 Ga0495603_0012764
879 Ga0495603_0387814
880 Ga0495629_0048615
881 Ga0495629_0331547
882 Ga0495629_0351677
883 Ga0495641_0021247
884 Ga0495641_0056809
885 Ga0495641_0057633
886 Ga0495641_0264111
887 Ga0495641_0300788
888 Ga0495651_0000029
889 Ga0495651_0403323
890 Ga0495651_0462084
891 Ga0495653_0003221
892 Ga0495653_0036940
893 Ga0495653_0071061
894 Ga0495653_0093395
895 Ga0495653_0223265
896 Ga0495653_0546534
897 Ga0495580_0050971
898 Ga0495580_0531272
899 Ga0495582_0170642
900 Ga0495582_0182664
901 Ga0495582_0250913
902 Ga0495582_0264042
903 Ga0495582_0312659
904 Ga0495605_0063632
905 Ga0495639_0002681
906 Ga0495639_0329808
907 Ga0495662_0011724
908 Ga0495662_0014853
909 Ga0495664_0007196
910 Ga0495664_0045576
911 Ga0495664_0135257
912 Ga0495664_0244377
913 Ga0495664_0353612
914 Ga0495664_0614618
915 Ga0495584_0066410
916 Ga0495594_0232163
917 Ga0495594_0342603
918 Ga0495594_0475781
919 Ga0495594_0488433
920 Ga0495607_0112495
921 Ga0495608_0008612
922 Ga0495608_0117279
923 Ga0495608_0558337
924 Ga0495618_0001935
925 Ga0495618_0159673
926 Ga0495618_0171347
927 Ga0495618_0187311
928 Ga0495618_0279493
929 Ga0495628_0000016
930 Ga0495628_0081995
931 Ga0495628_0817008
932 Ga0495630_0010255
933 Ga0495630_0041538
934 Ga0495630_0102755
935 Ga0495630_0423075
936 Ga0495630_0756489
937 Ga0495631_0152875
938 Ga0495644_0034283
939 Ga0495663_0054293
940 Ga0495666_0001728
941 Ga0495666_0114151
942 Ga0495642_0049361
943 Ga0495652_0001228
944 Ga0495652_0011063
945 Ga0495652_0075687
946 Ga0495652_0305759
947 Ga0495652_0367901
948 Ga0495665_0020866
949 Ga0495640_0047657
950 Ga0495640_0055771
951 Ga0495640_0224494
952 Ga0495640_0321382
953 Ga0495586_0026226
954 Ga0495586_0103981
955 Ga0495586_0146656
956 Ga0495586_0167849
957 Ga0495587_0000434
958 Ga0495587_0021328
959 Ga0495587_0231021
960 Ga0495598_0052853
961 Ga0495609_0047750
962 Ga0495645_0000367
963 Ga0495645_0009395
964 Ga0495645_0191154
965 Ga0495645_0972668
966 Ga0495667_0028356
967 Ga0495667_0062525
968 Ga0495667_0398152
969 Ga0495667_0512084
970 Ga0495656_0008107
971 Ga0495634_0200365
972 Ga0495634_0205587
973 Ga0495634_0208878
974 Ga0495634_0218501
975 Ga0495634_0762202
976 Ga0495611_0173314
977 Ga0495635_0088310
978 Ga0495635_0218802
979 Ga0495635_0255206
980 Ga0495635_0782561
981 Ga0495661_0087600
982 Ga0495588_0249961
983 Ga0495657_0002796
984 Ga0495657_0003896
985 Ga0495657_0108292
986 Ga0495657_0547502
987 Ga0495657_0583949
988 Ga0495599_0000187
989 Ga0495599_0001457
990 Ga0495599_0227875
991 Ga0495623_0000121
992 Ga0495623_0053918
993 Ga0495646_0000742
994 Ga0495646_0294471
995 Ga0495647_0035085
996 Ga0495647_0124002
997 Ga0495647_0133263
998 Ga0495647_0625496
999 Ga0495658_0055353
1000 Ga0495658_0449291
1001 Ga0495658_0617489
1002 Ga0495613_0048649
1003 Ga0495613_0051744
1004 Ga0495613_0096978
1005 Ga0495613_0348970
1006 Ga0495624_0013715
1007 Ga0495624_0034100
1008 Ga0495624_0055294
1009 Ga0495589_0047317
1010 Ga0495600_0022357
1011 Ga0495600_0478020
1012 Ga0495581_0013623
1013 Ga0495581_0066952
1014 Ga0495581_0578464
1015 Ga0495581_0775892
1016 Ga0495604_0000628
1017 Ga0495604_0053337
1018 Ga0495604_0121086
1019 Ga0495604_0341924
1020 Ga0495636_0028003
1021 Ga0495674_0096821
1022 Ga0495674_0161360
1023 Ga0495674_0328870
1024 Ga0495674_0612585
1025 Ga0495676_0131799
1026 Ga0495676_0273683
1027 Ga0495676_0453934
1028 Ga0495676_0458510
1029 Ga0495676_0585364
1030 Ga0495680_0002048
1031 Ga0495680_0040968
1032 Ga0495680_0056576
1033 Ga0495680_0086017
1034 Ga0495680_0091971
1035 Ga0495680_0557781
1036 Ga0495675_0000031
1037 Ga0495677_0083042
1038 Ga0495684_0009072
1039 Ga0495684_0041052
1040 Ga0495684_0074185
1041 Ga0495684_0134268
1042 Ga0495684_0179522
1043 Ga0495684_0201006
1044 Ga0495593_0018216
1045 Ga0495593_0078079
1046 Ga0495602_0000133
1047 Ga0495602_0018304
1048 Ga0495602_0213416
1049 Ga0495614_0011907
1050 Ga0496100_0011817
1051 Ga0496100_0099642
1052 Ga0496100_0183828
1053 Ga0496100_0200765
1054 Ga0496100_0502937
1055 Ga0496100_1269450
1056 Ga0496101_0189621
1057 Ga0496101_0254915
1058 Ga0496101_0406060
1059 Ga0496101_0463292
1060 Ga0496101_0568599
1061 Ga0496101_0694904
1062 Ga0496102_0353437
1063 Ga0496102_0650753
1064 Ga0496103_0037168
1065 Ga0496104_0005551
1066 Ga0496104_0055658
1067 Ga0496104_0322206
1068 Ga0496104_0536779
1069 Ga0496105_0039159
1070 Ga0496105_0070205
1071 Ga0496105_0652155
1072 Ga0496106_0063164
1073 Ga0496106_0939491
1074 Ga0496107_0026994
1075 Ga0496107_0202988
1076 Ga0496107_0469156
1077 Ga0496107_0557468
1078 Ga0496107_0753134
1079 Ga0496108_0089334
1080 Ga0496108_0136557
1081 Ga0496108_0144943
1082 Ga0496108_0255584
1083 Ga0496109_0025610
1084 Ga0496109_0073674
1085 Ga0496109_0090085
1086 Ga0496109_0441457
1087 Ga0496110_0089715
1088 Ga0496110_0252728
1089 Ga0496110_0816642
1090 Ga0496111_0016883
1091 Ga0496111_0079586
1092 Ga0496111_0325031
1093 Ga0496111_0573456
1094 Ga0496112_0037033
1095 Ga0496112_0097016
1096 Ga0496112_0493536
1097 Ga0496112_0873842
1098 Ga0496113_0080781
1099 Ga0496113_0539786
1100 Ga0496114_0092279
1101 Ga0496114_0204420
1102 Ga0496114_0232350
1103 Ga0496114_0261975
1104 Ga0496115_0004285
1105 Ga0496115_0175756
1106 Ga0496115_0418166
1107 Ga0496115_0543255
1108 Ga0501067_0002804
1109 Ga0501067_0222378
1110 Ga0501069_0155700
1111 Ga0501070_1298386
1112 nmdc:mga0n895_16746_c1
1113 nmdc:mga0rr50_80843_c1
1114 nmdc:mga08x19_47476_c1
1115 nmdc:mga0a205_239560_c1
1116 Ga0495601_0001112
1117 Ga0495601_0017959
1118 Ga0495601_0059478
1119 Ga0495601_0195966
1120 Ga0495601_0467013
1121 Ga0495601_0600093
1122 Ga0495601_0748153
1123 Ga0495612_0005613
1124 Ga0495612_0016048
1125 Ga0495612_0019018
1126 Ga0495612_0099490
1127 Ga0495612_0121809
1128 Ga0495595_0010724
1129 Ga0495595_0152537
1130 Ga0495595_0202045
1131 Ga0495595_0271437
1132 Ga0495595_0426313
1133 Ga0495595_0493782
1134 Ga0495619_0001848
1135 Ga0495619_0034416
1136 Ga0495619_0043663
1137 Ga0495619_0086108
1138 Ga0495619_0518236
1139 Ga0495619_0624231
1140 Ga0500566_0264115
1141 Ga0466962_0002207
1142 Ga0466962_0006327
1143 Ga0466962_0022218
1144 Ga0466962_0095403
1145 Ga0466962_0109315
1146 Ga0466962_0110852
1147 Ga0466962_0144375
1148 Ga0466962_0293136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mmn-assembly2.cif.gz_E structural and biochemical analysis of type ii free methionine-r-sulfoxide reductase from thermoplasma acidophilum 0.8171 5 85
1vhm-assembly1.cif.gz_A crystal structure of an hypothetical protein 0.7847 9 86
5i5l-assembly1.cif.gz_A-2 the photosensory module (pas-gaf-phy) of the bacterial phytochrome agp1 (atbphp1) in the pr form, chromophore modelled with an endocyclic double bond in pyrrole ring a 0.7837 5 93
6ob8-assembly1.cif.gz_A crystal structure of a dual sensor histidine kinase in green light illuminated state 0.7793 4 95
5hsq-assembly1.cif.gz_A-2 the surface engineered photosensory module (pas-gaf-phy) of the bacterial phytochrome agp1 (atbphp1) in the pr form, chromophore modelled with an endocyclic double bond in pyrrole ring a. 0.7669 2 93
ID Description Score Start End Superfamily
6mghD00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.8304 5 89 3.30.450.40
4rq9A02 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7884 2 89 3.30.450.40
1vhmA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7847 9 86 3.30.450.40
af_P76245_4_163_3.30.450.40 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7829 1 88 3.30.450.40
3oovB00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;GAF domain 0.7756 2 88 3.30.450.40
ID Description Score Start End GO Terms
AF-A0A7W0YTW8-F1-model_v4 GAF domain-containing protein 0.9615 1 63
AF-A0A7Y5X0F3-F1-model_v4 GAF domain-containing protein 0.9342 2 86
AF-A0A538IFB0-F1-model_v4 GAF domain-containing protein 0.8625 1 99
AF-A0A538GKA8-F1-model_v4 Uncharacterized protein 0.8607 5 95
AF-A0A6I3BRY3-F1-model_v4 GAF domain-containing protein 0.8585 3 98

Map