F465271

General Info

Members Datasets Scaffolds Average Seq Length
574 212 1148 195

Family's Representative Sequence

Representative Sequence 3300005290|Ga0065712_10091565|Ga0065712_100915652
Length 222
Sequence MHSSASGDACAGKNATQVESKMSIVASLPRQNIFKKEAQMFYQKLNSVWHKRALNLFMVVVLAHWAEHLAQAYQIYVLGWPRPKAGGFLGLFYPWLVSSEVLHYGYAIVMLIGIWTLRRGFSGTSRKWWTVALVIQFWHHIEHAVLQWQALTHHYWLGSPVPVSFVQMLLPKFRVEIHLFYNTIVFIPMMIGMYYHMFPPKGEESATCSCALHREPIQAIAA

Samples

Sample ID Description Type Environment
1 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
2 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
128 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
131 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
132 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
133 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
134 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
135 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
136 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
137 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
138 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
139 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
140 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
141 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
149 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
150 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
151 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
152 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
155 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
158 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
159 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
160 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
161 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
162 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
163 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
164 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
165 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
166 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
167 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
169 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
170 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
171 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
172 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
173 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
174 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
175 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
176 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
177 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
178 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
179 3300049666 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A4_B_2_control Metagenome Rhizosphere
180 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
181 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
182 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
183 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
184 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
185 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
186 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
187 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
188 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
189 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
190 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
191 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
192 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
193 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
194 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
195 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
196 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
197 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
198 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
199 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
200 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
201 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
202 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
203 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
204 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
205 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
206 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
207 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
211 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.22
Rhizosphere 98.43
Stem 0
Stem Tuber 0
Unclassified 21.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10091565 3300005290 Unclassified 2367
2 CNAas_1000502 3300000532 Bacteria 3817
3 JGI24737J22298_10040427 3300001990 Bacteria 1431
4 JGI24751J29686_10000068 3300002459 Bacteria 59791
5 JGI25406J46586_10032531 3300003203 Unclassified 1937
6 JGI25406J46586_10158701 3300003203 Unclassified 660
7 Ga0065712_10097736 3300005290 Unclassified 2141
8 Ga0065715_10010393 3300005293 Bacteria 3485
9 Ga0065715_10102534 3300005293 Bacteria 3106
10 Ga0065715_10126835 3300005293 Bacteria 2100
11 Ga0065715_10135545 3300005293 Bacteria 1936
12 Ga0065715_10168205 3300005293 Bacteria 1568
13 Ga0065715_10774891 3300005293 Unclassified 620
14 Ga0065707_10007088 3300005295 Bacteria 4695
15 Ga0065707_10202980 3300005295 Bacteria 1302
16 Ga0070676_10013112 3300005328 Unclassified 4541
17 Ga0070676_10953492 3300005328 Bacteria 642
18 Ga0070670_100000043 3300005331 Bacteria 141622
19 Ga0070670_100000227 3300005331 Bacteria 51904
20 Ga0070670_100029315 3300005331 Bacteria 4737
21 Ga0070670_100045638 3300005331 Bacteria 3768
22 Ga0070670_100346009 3300005331 Bacteria 1305
23 Ga0070670_100973900 3300005331 Unclassified 771
24 Ga0068869_100121259 3300005334 Bacteria 2000
25 Ga0068869_100125468 3300005334 Unclassified 1968
26 Ga0070680_100047969 3300005336 Unclassified 3479
27 Ga0070682_100007097 3300005337 Bacteria 6305
28 Ga0070682_100021112 3300005337 Bacteria 3838
29 Ga0068868_101220639 3300005338 Bacteria 696
30 Ga0070692_10070215 3300005345 Bacteria 1864
31 Ga0070692_10125851 3300005345 Bacteria 1435
32 Ga0070692_10319548 3300005345 Unclassified 954
33 Ga0070669_100016695 3300005353 Bacteria 5240
34 Ga0070675_100117719 3300005354 Bacteria 2255
35 Ga0070675_100418594 3300005354 Unclassified 1198
36 Ga0070673_100040520 3300005364 Bacteria 3574
37 Ga0070673_100271816 3300005364 Bacteria 1484
38 Ga0070673_100583670 3300005364 Bacteria 1018
39 Ga0070673_100964520 3300005364 Unclassified 793
40 Ga0070673_101217569 3300005364 Bacteria 706
41 Ga0070688_100419840 3300005365 Bacteria 994
42 Ga0070659_100255495 3300005366 Unclassified 1453
43 Ga0070703_10001807 3300005406 Bacteria 6324
44 Ga0070701_10019202 3300005438 Bacteria 3226
45 Ga0070701_10213387 3300005438 Bacteria 1147
46 Ga0070701_10329239 3300005438 Bacteria 947
47 Ga0070701_10548297 3300005438 Bacteria 758
48 Ga0070705_100005979 3300005440 Bacteria 5951
49 Ga0070705_100069522 3300005440 Bacteria 2123
50 Ga0070705_100072130 3300005440 Bacteria 2091
51 Ga0070705_100074717 3300005440 Unclassified 2061
52 Ga0070705_100125353 3300005440 Bacteria 1666
53 Ga0070705_100341992 3300005440 Unclassified 1088
54 Ga0070705_100756333 3300005440 Bacteria 769
55 Ga0070700_100000048 3300005441 Bacteria 89854
56 Ga0070700_100014924 3300005441 Unclassified 4394
57 Ga0070700_100016681 3300005441 Unclassified 4186
58 Ga0070700_100044342 3300005441 Bacteria 2739
59 Ga0070700_100127821 3300005441 Bacteria 1711
60 Ga0070694_100016648 3300005444 Unclassified 4630
61 Ga0070694_100027227 3300005444 Bacteria 3712
62 Ga0070694_100066173 3300005444 Bacteria 2478
63 Ga0070694_100150617 3300005444 Bacteria 1698
64 Ga0070694_100189835 3300005444 Bacteria 1525
65 Ga0070694_100374949 3300005444 Bacteria 1108
66 Ga0070662_100141511 3300005457 Bacteria 1865
67 Ga0070681_10013767 3300005458 Bacteria 8052
68 Ga0070681_10302769 3300005458 Archaea 1508
69 Ga0070681_10442687 3300005458 Unclassified 1211
70 Ga0068867_100033103 3300005459 Bacteria 3741
71 Ga0068867_100164236 3300005459 Bacteria 1753
72 Ga0068867_100205996 3300005459 Bacteria 1577
73 Ga0070685_10127324 3300005466 Unclassified 1588
74 Ga0070707_100659815 3300005468 Bacteria 1009
75 Ga0070698_100256703 3300005471 Bacteria 1680
76 Ga0070699_100159154 3300005518 Bacteria 1998
77 Ga0070699_100535028 3300005518 Bacteria 1066
78 Ga0070699_100772547 3300005518 Bacteria 879
79 Ga0070679_100098383 3300005530 Bacteria 2913
80 Ga0070697_100064900 3300005536 Bacteria 2982
81 Ga0070697_101186044 3300005536 Unclassified 680
82 Ga0068853_100063483 3300005539 Bacteria 3199
83 Ga0068853_100270013 3300005539 Unclassified 1566
84 Ga0068853_100452409 3300005539 Bacteria 1208
85 Ga0068853_100761689 3300005539 Bacteria 926
86 Ga0070672_100775290 3300005543 Bacteria 843
87 Ga0070695_100105053 3300005545 Unclassified 1908
88 Ga0070695_100146586 3300005545 Bacteria 1643
89 Ga0070695_100190259 3300005545 Bacteria 1460
90 Ga0070695_100894924 3300005545 Unclassified 716
91 Ga0070696_100032685 3300005546 Bacteria 3571
92 Ga0070696_100173107 3300005546 Bacteria 1597
93 Ga0070696_100282365 3300005546 Bacteria 1266
94 Ga0070696_100387480 3300005546 Unclassified 1090
95 Ga0070693_100003084 3300005547 Bacteria 7730
96 Ga0070693_100012866 3300005547 Unclassified 4248
97 Ga0070693_100014205 3300005547 Bacteria 4074
98 Ga0070693_100039390 3300005547 Bacteria 2647
99 Ga0070693_100049168 3300005547 Bacteria 2404
100 Ga0070693_100165062 3300005547 Unclassified 1414
101 Ga0070693_100879129 3300005547 Unclassified 670
102 Ga0070704_100037211 3300005549 Unclassified 3323
103 Ga0070704_100481559 3300005549 Unclassified 1074
104 Ga0070704_100871151 3300005549 Bacteria 808
105 Ga0070664_100097953 3300005564 Bacteria 2547
106 Ga0068857_100098974 3300005577 Bacteria 2615
107 Ga0068857_100159843 3300005577 Bacteria 2044
108 Ga0068857_100191631 3300005577 Bacteria 1862
109 Ga0068857_100218662 3300005577 Bacteria 1739
110 Ga0068857_100451509 3300005577 Unclassified 1202
111 Ga0068854_100018355 3300005578 Unclassified 4696
112 Ga0068854_100093702 3300005578 Bacteria 2239
113 Ga0068854_100222498 3300005578 Unclassified 1494
114 Ga0068856_100171002 3300005614 Bacteria 2185
115 Ga0070702_100053274 3300005615 Bacteria 2324
116 Ga0070702_100121012 3300005615 Bacteria 1639
117 Ga0070702_100220193 3300005615 Bacteria 1268
118 Ga0068852_100060606 3300005616 Bacteria 3285
119 Ga0068852_100564905 3300005616 Unclassified 1139
120 Ga0068852_100834423 3300005616 Unclassified 937
121 Ga0068859_100000207 3300005617 Bacteria 58182
122 Ga0068859_100029377 3300005617 Bacteria 5516
123 Ga0068859_100037988 3300005617 Bacteria 4832
124 Ga0068859_100044121 3300005617 Unclassified 4481
125 Ga0068859_100046945 3300005617 Bacteria 4337
126 Ga0068859_100068786 3300005617 Bacteria 3575
127 Ga0068859_100082486 3300005617 Bacteria 3258
128 Ga0068859_100087095 3300005617 Bacteria 3170
129 Ga0068859_100142612 3300005617 Bacteria 2469
130 Ga0068859_100169298 3300005617 Bacteria 2265
131 Ga0068859_100182888 3300005617 Bacteria 2179
132 Ga0068859_100208826 3300005617 Bacteria 2039
133 Ga0068859_100267345 3300005617 Bacteria 1802
134 Ga0068859_100451345 3300005617 Bacteria 1382
135 Ga0068859_100525989 3300005617 Unclassified 1277
136 Ga0068859_100551083 3300005617 Bacteria 1247
137 Ga0068859_101074890 3300005617 Bacteria 885
138 Ga0068859_101197575 3300005617 Bacteria 837
139 Ga0068859_101367465 3300005617 Bacteria 781
140 Ga0068859_101412453 3300005617 Bacteria 768
141 Ga0068864_100051824 3300005618 Unclassified 3536
142 Ga0068864_100234415 3300005618 Unclassified 1698
143 Ga0068864_100282416 3300005618 Bacteria 1550
144 Ga0068864_100337888 3300005618 Bacteria 1418
145 Ga0068864_100516016 3300005618 Bacteria 1151
146 Ga0068864_100577758 3300005618 Bacteria 1089
147 Ga0068864_100598638 3300005618 Bacteria 1070
148 Ga0068864_100623194 3300005618 Unclassified 1048
149 Ga0068864_100701834 3300005618 Bacteria 988
150 Ga0068861_100181629 3300005719 Bacteria 1752
151 Ga0068861_100366217 3300005719 Bacteria 1269
152 Ga0068861_100418302 3300005719 Bacteria 1194
153 Ga0068851_10050416 3300005834 Bacteria 2113
154 Ga0068870_10037503 3300005840 Bacteria 2499
155 Ga0068870_10038390 3300005840 Bacteria 2473
156 Ga0068863_100089850 3300005841 Unclassified 2913
157 Ga0068863_100110287 3300005841 Bacteria 2620
158 Ga0068863_100494584 3300005841 Bacteria 1204
159 Ga0068863_101027068 3300005841 Bacteria 828
160 Ga0068858_100133598 3300005842 Unclassified 2327
161 Ga0068858_100546823 3300005842 Bacteria 1121
162 Ga0068858_100594975 3300005842 Bacteria 1073
163 Ga0068858_100725234 3300005842 Bacteria 968
164 Ga0068860_100018412 3300005843 Bacteria 6793
165 Ga0068860_100030919 3300005843 Bacteria 5148
166 Ga0068860_100055137 3300005843 Bacteria 3778
167 Ga0068860_100079708 3300005843 Bacteria 3114
168 Ga0068860_100117332 3300005843 Bacteria 2546
169 Ga0068860_100150690 3300005843 Unclassified 2239
170 Ga0068860_100158824 3300005843 Bacteria 2179
171 Ga0068860_100676578 3300005843 Bacteria 1041
172 Ga0068860_100906601 3300005843 Bacteria 898
173 Ga0068860_101366208 3300005843 Unclassified 729
174 Ga0068862_100246724 3300005844 Unclassified 1626
175 Ga0068862_100326073 3300005844 Bacteria 1419
176 Ga0068862_100431442 3300005844 Bacteria 1239
177 Ga0068862_100505424 3300005844 Unclassified 1148
178 Ga0068862_100831283 3300005844 Unclassified 904
179 Ga0068862_101270434 3300005844 Bacteria 737
180 Ga0081539_10000647 3300005985 Bacteria 70112
181 Ga0081539_10001765 3300005985 Bacteria 34462
182 Ga0081539_10012447 3300005985 Bacteria 6557
183 Ga0081539_10052280 3300005985 Bacteria 2296
184 Ga0097621_100013933 3300006237 Bacteria 6005
185 Ga0097621_100355065 3300006237 Bacteria 1304
186 Ga0068871_100011966 3300006358 Bacteria 6387
187 Ga0068871_100562442 3300006358 Bacteria 1034
188 Ga0068871_100601944 3300006358 Bacteria 1000
189 Ga0075430_100020984 3300006846 Bacteria 5553
190 Ga0075431_100081550 3300006847 Bacteria 3340
191 Ga0075431_100107944 3300006847 Bacteria 2872
192 Ga0075431_100456541 3300006847 Bacteria 1273
193 Ga0075434_100002163 3300006871 Bacteria 17125
194 Ga0075434_100723558 3300006871 Unclassified 1012
195 Ga0075434_100848359 3300006871 Unclassified 929
196 Ga0075429_100049184 3300006880 Bacteria 3666
197 Ga0075429_100280287 3300006880 Bacteria 1460
198 Ga0075429_100292879 3300006880 Bacteria 1425
199 Ga0068865_100109805 3300006881 Bacteria 2033
200 Ga0097620_100000207 3300006931 Bacteria 58182
201 Ga0097620_100029377 3300006931 Bacteria 5516
202 Ga0097620_100037982 3300006931 Bacteria 4832
203 Ga0097620_100044121 3300006931 Unclassified 4481
204 Ga0097620_100046944 3300006931 Bacteria 4337
205 Ga0097620_100068789 3300006931 Bacteria 3575
206 Ga0097620_100082484 3300006931 Bacteria 3258
207 Ga0097620_100087094 3300006931 Bacteria 3170
208 Ga0097620_100142609 3300006931 Bacteria 2469
209 Ga0097620_100169304 3300006931 Bacteria 2265
210 Ga0097620_100182887 3300006931 Bacteria 2179
211 Ga0097620_100208829 3300006931 Bacteria 2039
212 Ga0097620_100267345 3300006931 Bacteria 1802
213 Ga0097620_100360943 3300006931 Archaea 1548
214 Ga0097620_100451357 3300006931 Bacteria 1382
215 Ga0097620_100525983 3300006931 Unclassified 1277
216 Ga0097620_100551077 3300006931 Bacteria 1247
217 Ga0097620_101075003 3300006931 Bacteria 885
218 Ga0097620_101197535 3300006931 Bacteria 837
219 Ga0097620_101367464 3300006931 Bacteria 781
220 Ga0097620_101412443 3300006931 Bacteria 768
221 Ga0105251_10041367 3300009011 Bacteria 2243
222 Ga0105240_10704591 3300009093 Bacteria 1102
223 Ga0111539_10006037 3300009094 Bacteria 15643
224 Ga0111539_10009645 3300009094 Bacteria 12186
225 Ga0111539_10032213 3300009094 Bacteria 6368
226 Ga0111539_11656094 3300009094 Unclassified 742
227 Ga0105245_10444690 3300009098 Bacteria 1304
228 Ga0105245_10634192 3300009098 Unclassified 1098
229 Ga0105245_10751986 3300009098 Bacteria 1011
230 Ga0105245_11066931 3300009098 Bacteria 853
231 Ga0105247_10001051 3300009101 Bacteria 20694
232 Ga0105247_10006496 3300009101 Bacteria 7236
233 Ga0105247_10062782 3300009101 Bacteria 2305
234 Ga0105247_10096468 3300009101 Unclassified 1885
235 Ga0105247_10098264 3300009101 Bacteria 1868
236 Ga0105247_10102411 3300009101 Bacteria 1832
237 Ga0105247_10183069 3300009101 Bacteria 1399
238 Ga0105247_10388279 3300009101 Unclassified 991
239 Ga0105247_10622697 3300009101 Unclassified 803
240 Ga0105247_10837853 3300009101 Bacteria 705
241 Ga0114129_10868732 3300009147 Bacteria 1145
242 Ga0114129_11074680 3300009147 Bacteria 1009
243 Ga0114129_11444586 3300009147 Bacteria 847
244 Ga0105243_10019614 3300009148 Bacteria 5126
245 Ga0105243_10026094 3300009148 Bacteria 4471
246 Ga0105243_10026455 3300009148 Bacteria 4440
247 Ga0105243_10034902 3300009148 Unclassified 3898
248 Ga0105241_10039257 3300009174 Bacteria 3570
249 Ga0105241_10061924 3300009174 Unclassified 2883
250 Ga0105241_10131047 3300009174 Bacteria 2030
251 Ga0105241_10134849 3300009174 Bacteria 2003
252 Ga0105241_10142086 3300009174 Bacteria 1955
253 Ga0105241_10227505 3300009174 Bacteria 1571
254 Ga0105241_10425840 3300009174 Bacteria 1169
255 Ga0105242_10010579 3300009176 Bacteria 7085
256 Ga0105242_10475838 3300009176 Bacteria 1183
257 Ga0105248_10015997 3300009177 Bacteria 8258
258 Ga0105248_10030761 3300009177 Bacteria 5997
259 Ga0105248_10083059 3300009177 Bacteria 3603
260 Ga0105248_10130296 3300009177 Bacteria 2837
261 Ga0105248_10342313 3300009177 Bacteria 1683
262 Ga0105248_10399628 3300009177 Bacteria 1547
263 Ga0105248_10577837 3300009177 Unclassified 1268
264 Ga0105248_11124817 3300009177 Unclassified 888
265 Ga0105248_11129633 3300009177 Bacteria 886
266 Ga0105237_10000527 3300009545 Bacteria 53805
267 Ga0105237_10098317 3300009545 Bacteria 2918
268 Ga0105237_10759441 3300009545 Bacteria 976
269 Ga0105238_10007273 3300009551 Bacteria 11084
270 Ga0105238_10011962 3300009551 Bacteria 8743
271 Ga0105238_10013077 3300009551 Bacteria 8373
272 Ga0105238_10558442 3300009551 Bacteria 1150
273 Ga0105249_10004831 3300009553 Bacteria 11634
274 Ga0105239_10121913 3300010375 Bacteria 2896
275 Ga0105239_10250868 3300010375 Bacteria 1988
276 Ga0105246_10016964 3300011119 Bacteria 4623
277 Ga0105246_10151738 3300011119 Bacteria 1754
278 Ga0157373_10016867 3300013100 Bacteria 5325
279 Ga0157373_10070345 3300013100 Bacteria 2473
280 Ga0157373_10245082 3300013100 Unclassified 1267
281 Ga0157373_10446666 3300013100 Unclassified 930
282 Ga0157373_10501364 3300013100 Bacteria 877
283 Ga0157373_10597541 3300013100 Bacteria 803
284 Ga0157374_10424883 3300013296 Bacteria 1328
285 Ga0157374_10461529 3300013296 Bacteria 1272
286 Ga0163162_10011478 3300013306 Bacteria 8639
287 Ga0163162_10030790 3300013306 Bacteria 5317
288 Ga0163162_10214914 3300013306 Bacteria 2053
289 Ga0163162_10257192 3300013306 Bacteria 1878
290 Ga0163162_10639852 3300013306 Viruses 1188
291 Ga0157375_10151641 3300013308 Unclassified 2454
292 Ga0157375_11292693 3300013308 Unclassified 857
293 Ga0163163_10000144 3300014325 Bacteria 74369
294 Ga0163163_10000277 3300014325 Bacteria 51205
295 Ga0163163_10238254 3300014325 Bacteria 1869
296 Ga0157380_10055707 3300014326 Unclassified 3141
297 Ga0157380_10354725 3300014326 Unclassified 1374
298 Ga0157380_10609331 3300014326 Bacteria 1082
299 Ga0157377_10042016 3300014745 Bacteria 2538
300 Ga0157377_10135661 3300014745 Bacteria 1508
301 Ga0157377_10286778 3300014745 Bacteria 1081
302 Ga0157377_10702360 3300014745 Bacteria 734
303 Ga0157379_10109748 3300014968 Unclassified 2478
304 Ga0157379_10602421 3300014968 Bacteria 1026
305 Ga0157379_10733726 3300014968 Bacteria 929
306 Ga0157379_10916157 3300014968 Bacteria 832
307 Ga0163161_10362791 3300017792 Bacteria 1154
308 Ga0213876_10000041 3300021384 Bacteria 169380
309 Ga0207653_10001772 3300025885 Bacteria 6902
310 Ga0207710_10000781 3300025900 Bacteria 17349
311 Ga0207710_10001517 3300025900 Bacteria 11502
312 Ga0207710_10143538 3300025900 Bacteria 1154
313 Ga0207710_10200417 3300025900 Bacteria 986
314 Ga0207688_10333096 3300025901 Bacteria 933
315 Ga0207647_10011219 3300025904 Bacteria 6292
316 Ga0207647_10152787 3300025904 Unclassified 1349
317 Ga0207645_10117623 3300025907 Unclassified 1724
318 Ga0207643_10036414 3300025908 Unclassified 2760
319 Ga0207643_10065629 3300025908 Bacteria 2080
320 Ga0207643_10072283 3300025908 Bacteria 1987
321 Ga0207643_10260300 3300025908 Bacteria 1071
322 Ga0207654_10004797 3300025911 Bacteria 6848
323 Ga0207654_10024452 3300025911 Bacteria 3248
324 Ga0207654_10069234 3300025911 Bacteria 2090
325 Ga0207654_10583271 3300025911 Bacteria 797
326 Ga0207707_10016424 3300025912 Bacteria 6457
327 Ga0207707_10515367 3300025912 Bacteria 1019
328 Ga0207671_10002025 3300025914 Bacteria 22288
329 Ga0207671_10621434 3300025914 Unclassified 861
330 Ga0207662_10232554 3300025918 Bacteria 1204
331 Ga0207662_10472207 3300025918 Bacteria 860
332 Ga0207652_10176470 3300025921 Bacteria 1919
333 Ga0207646_10147775 3300025922 Bacteria 2118
334 Ga0207681_10063574 3300025923 Bacteria 2545
335 Ga0207681_10215169 3300025923 Bacteria 1483
336 Ga0207681_10446921 3300025923 Bacteria 1051
337 Ga0207694_10007574 3300025924 Bacteria 8229
338 Ga0207694_10054987 3300025924 Bacteria 3090
339 Ga0207650_10000009 3300025925 Bacteria 483583
340 Ga0207650_10000027 3300025925 Bacteria 257466
341 Ga0207650_10141229 3300025925 Unclassified 1894
342 Ga0207650_10668784 3300025925 Unclassified 876
343 Ga0207659_10301050 3300025926 Bacteria 1317
344 Ga0207659_10531365 3300025926 Unclassified 998
345 Ga0207659_10553029 3300025926 Bacteria 978
346 Ga0207659_10850042 3300025926 Bacteria 784
347 Ga0207706_10090232 3300025933 Unclassified 2695
348 Ga0207686_10021977 3300025934 Bacteria 3669
349 Ga0207686_10145536 3300025934 Bacteria 1643
350 Ga0207709_10017508 3300025935 Bacteria 3999
351 Ga0207709_10104646 3300025935 Unclassified 1879
352 Ga0207709_10975824 3300025935 Bacteria 692
353 Ga0207670_10007884 3300025936 Bacteria 5980
354 Ga0207670_10837100 3300025936 Bacteria 768
355 Ga0207704_10015988 3300025938 Unclassified 3843
356 Ga0207704_10522371 3300025938 Unclassified 960
357 Ga0207711_10017288 3300025941 Bacteria 5993
358 Ga0207711_10035762 3300025941 Bacteria 4212
359 Ga0207711_10074354 3300025941 Bacteria 2955
360 Ga0207711_10196986 3300025941 Unclassified 1837
361 Ga0207711_10749195 3300025941 Viruses 910
362 Ga0207689_10087514 3300025942 Bacteria 2559
363 Ga0207689_10115799 3300025942 Bacteria 2203
364 Ga0207689_10507913 3300025942 Bacteria 1010
365 Ga0207689_10510427 3300025942 Bacteria 1008
366 Ga0207689_10533927 3300025942 Bacteria 984
367 Ga0207679_10839414 3300025945 Bacteria 839
368 Ga0207667_10260055 3300025949 Bacteria 1775
369 Ga0207651_10030399 3300025960 Bacteria 3439
370 Ga0207651_10205036 3300025960 Unclassified 1583
371 Ga0207651_10223805 3300025960 Bacteria 1523
372 Ga0207651_10304849 3300025960 Bacteria 1326
373 Ga0207712_10008739 3300025961 Bacteria 6407
374 Ga0207640_10165470 3300025981 Unclassified 1642
375 Ga0207640_10213254 3300025981 Unclassified 1472
376 Ga0207640_10295062 3300025981 Unclassified 1280
377 Ga0207640_10403118 3300025981 Bacteria 1114
378 Ga0207703_10387975 3300026035 Unclassified 1293
379 Ga0207639_10536221 3300026041 Unclassified 1073
380 Ga0207708_10000054 3300026075 Bacteria 103599
381 Ga0207708_10003279 3300026075 Bacteria 11927
382 Ga0207708_10026258 3300026075 Unclassified 4406
383 Ga0207708_10047366 3300026075 Unclassified 3273
384 Ga0207708_10086782 3300026075 Bacteria 2408
385 Ga0207708_10218165 3300026075 Bacteria 1527
386 Ga0207641_10124985 3300026088 Bacteria 2302
387 Ga0207641_10234064 3300026088 Bacteria 1708
388 Ga0207641_10318471 3300026088 Bacteria 1474
389 Ga0207641_10386289 3300026088 Bacteria 1342
390 Ga0207641_10398130 3300026088 Bacteria 1322
391 Ga0207641_10548230 3300026088 Bacteria 1127
392 Ga0207641_11368954 3300026088 Bacteria 709
393 Ga0207648_10043100 3300026089 Unclassified 3962
394 Ga0207648_10044454 3300026089 Bacteria 3897
395 Ga0207648_10219421 3300026089 Bacteria 1690
396 Ga0207676_10052034 3300026095 Bacteria 3200
397 Ga0207676_10085765 3300026095 Bacteria 2571
398 Ga0207676_10117763 3300026095 Bacteria 2234
399 Ga0207676_10160757 3300026095 Bacteria 1946
400 Ga0207676_10262631 3300026095 Bacteria 1560
401 Ga0207676_10288723 3300026095 Bacteria 1492
402 Ga0207676_10315083 3300026095 Bacteria 1434
403 Ga0207676_10482733 3300026095 Unclassified 1174
404 Ga0207676_10597758 3300026095 Bacteria 1059
405 Ga0207676_10675229 3300026095 Bacteria 999
406 Ga0207676_10854297 3300026095 Unclassified 890
407 Ga0207676_11036371 3300026095 Bacteria 809
408 Ga0207676_11615227 3300026095 Bacteria 646
409 Ga0207674_10011002 3300026116 Bacteria 10177
410 Ga0207674_10042623 3300026116 Bacteria 4685
411 Ga0207674_10068111 3300026116 Bacteria 3582
412 Ga0207674_10169725 3300026116 Bacteria 2135
413 Ga0207674_10199184 3300026116 Bacteria 1952
414 Ga0207674_10217492 3300026116 Unclassified 1859
415 Ga0207675_100010707 3300026118 Bacteria 8589
416 Ga0207675_100019188 3300026118 Bacteria 6380
417 Ga0207675_100057815 3300026118 Bacteria 3619
418 Ga0207675_100102585 3300026118 Unclassified 2696
419 Ga0207675_100104623 3300026118 Bacteria 2668
420 Ga0207675_100443161 3300026118 Bacteria 1286
421 Ga0207683_10269401 3300026121 Unclassified 1555
422 Ga0207683_10880873 3300026121 Bacteria 831
423 Ga0207698_10177460 3300026142 Bacteria 1883
424 Ga0207698_10668674 3300026142 Bacteria 1030
425 Ga0207698_10893082 3300026142 Bacteria 895
426 Ga0207428_10009187 3300027907 Bacteria 8879
427 Ga0207428_10078161 3300027907 Unclassified 2589
428 Ga0268265_10127882 3300028380 Bacteria 2106
429 Ga0268265_10167640 3300028380 Unclassified 1873
430 Ga0268265_10348295 3300028380 Bacteria 1352
431 Ga0268265_10851974 3300028380 Bacteria 892
432 Ga0268265_11471361 3300028380 Bacteria 684
433 Ga0268264_10016548 3300028381 Bacteria 6038
434 Ga0268264_10046489 3300028381 Bacteria 3605
435 Ga0268264_10049162 3300028381 Bacteria 3508
436 Ga0268264_10099803 3300028381 Bacteria 2520
437 Ga0268264_10223198 3300028381 Bacteria 1736
438 Ga0268264_10420068 3300028381 Unclassified 1289
439 Ga0268264_10431717 3300028381 Bacteria 1272
440 Ga0268264_11200762 3300028381 Bacteria 768
441 Ga0307408_100406709 3300031548 Bacteria 1170
442 Ga0307410_10254644 3300031852 Bacteria 1366
443 Ga0307406_10029796 3300031901 Unclassified 3307
444 Ga0307406_10439237 3300031901 Bacteria 1044
445 Ga0307406_10453573 3300031901 Bacteria 1029
446 Ga0307406_10535287 3300031901 Unclassified 956
447 Ga0307407_10206159 3300031903 Bacteria 1321
448 Ga0307412_10029803 3300031911 Bacteria 3428
449 Ga0307412_10311479 3300031911 Unclassified 1248
450 Ga0307416_100007084 3300032002 Bacteria 7085
451 Ga0307414_10482485 3300032004 Bacteria 1093
452 Ga0307411_10087856 3300032005 Unclassified 2160
453 Ga0307411_10213419 3300032005 Bacteria 1492
454 Ga0307415_100027410 3300032126 Unclassified 3609
455 Ga0373940_0200285 3300035088 Unclassified 656
456 Ga0373949_0111453 3300035090 Bacteria 760
457 Ga0373951_0000328 3300035091 Bacteria 14782
458 Ga0373939_0225981 3300035114 Unclassified 719
459 Ga0395900_0241259 3300037418 Bacteria 1813
460 Ga0395898_0149873 3300037466 Bacteria 2232
461 Ga0395898_0181604 3300037466 Bacteria 2011
462 Ga0395905_0590238 3300037471 Bacteria 1013
463 Ga0395901_0712270 3300038443 Bacteria 1000
464 Ga0436365_1476328 3300039437 Bacteria 212791
465 Ga0439448_0034851 3300042005 Bacteria 1610
466 Ga0451577_0560081 3300042876 Bacteria 1038
467 Ga0453683_0256643 3300044673 Bacteria 1115
468 Ga0451576_0208317 3300045051 Bacteria 2042
469 Ga0495652_0060237 3300046529 Bacteria 3209
470 Ga0495587_0309975 3300046536 Unclassified 882
471 Ga0495623_0100666 3300046679 Unclassified 1761
472 Ga0496106_0052312 3300048909 Bacteria 3081
473 Ga0496108_0143093 3300048911 Bacteria 2061
474 Ga0496108_0863048 3300048911 Bacteria 778
475 Ga0496110_0254356 3300048913 Bacteria 1599
476 Ga0496112_0030842 3300048915 Bacteria 5194
477 Ga0496112_0863265 3300048915 Unclassified 828
478 Ga0496113_0093321 3300048916 Unclassified 2323
479 Ga0501291_059008 3300049514 Bacteria 717
480 Ga0501291_066926 3300049514 Bacteria 688
481 Ga0501292_004069 3300049515 Bacteria 1981
482 Ga0501295_105667 3300049518 Unclassified 664
483 Ga0501296_003436 3300049519 Bacteria 1689
484 Ga0501297_009138 3300049520 Bacteria 1104
485 Ga0501297_012960 3300049520 Bacteria 974
486 Ga0501297_041885 3300049520 Bacteria 647
487 Ga0501298_005390 3300049521 Bacteria 2050
488 Ga0501298_006803 3300049521 Bacteria 1881
489 Ga0501299_001044 3300049522 Bacteria 3438
490 Ga0501299_029023 3300049522 Unclassified 1057
491 Ga0501038_0009450 3300049574 Bacteria 8948
492 Ga0501075_0557236 3300049591 Bacteria 875
493 Ga0501076_0552587 3300049592 Bacteria 949
494 Ga0501076_0647117 3300049592 Bacteria 872
495 Ga0501198_004595 3300049649 Unclassified 1921
496 Ga0501198_016584 3300049649 Bacteria 1140
497 Ga0501206_023470 3300049653 Bacteria 889
498 Ga0501207_000720 3300049654 Unclassified 3884
499 Ga0501207_015413 3300049654 Bacteria 1176
500 Ga0501209_056087 3300049656 Bacteria 1087
501 Ga0501216_001504 3300049660 Unclassified 3153
502 Ga0501216_003701 3300049660 Bacteria 2245
503 Ga0501216_017516 3300049660 Bacteria 1226
504 Ga0501216_035774 3300049660 Bacteria 934
505 Ga0501217_009106 3300049661 Bacteria 2153
506 Ga0501217_049137 3300049661 Bacteria 1097
507 Ga0501217_053704 3300049661 Bacteria 1059
508 Ga0501223_006541 3300049663 Unclassified 2407
509 Ga0501223_009174 3300049663 Bacteria 2008
510 Ga0501223_012237 3300049663 Bacteria 1717
511 Ga0501223_032493 3300049663 Bacteria 1015
512 Ga0501224_010908 3300049664 Bacteria 1334
513 Ga0501227_004450 3300049665 Bacteria 3013
514 Ga0501227_061893 3300049665 Bacteria 961
515 Ga0501228_012933 3300049666 Bacteria 864
516 Ga0501233_048791 3300049668 Bacteria 1019
517 Ga0501233_052325 3300049668 Bacteria 992
518 Ga0501233_058782 3300049668 Bacteria 949
519 Ga0501235_007448 3300049669 Bacteria 2385
520 Ga0501235_013149 3300049669 Bacteria 1820
521 Ga0501235_026850 3300049669 Bacteria 1291
522 Ga0501239_018164 3300049672 Bacteria 843
523 Ga0501239_028327 3300049672 Bacteria 723
524 Ga0501243_004037 3300049675 Bacteria 2193
525 Ga0501243_007607 3300049675 Bacteria 1658
526 Ga0501243_049986 3300049675 Bacteria 752
527 Ga0501249_010670 3300049679 Bacteria 1924
528 Ga0501249_027951 3300049679 Bacteria 1249
529 Ga0501251_012162 3300049681 Bacteria 1036
530 Ga0501256_006057 3300049685 Bacteria 1083
531 Ga0501257_023163 3300049686 Bacteria 1472
532 Ga0501257_029016 3300049686 Bacteria 1329
533 Ga0501257_045428 3300049686 Bacteria 1086
534 Ga0501259_024452 3300049688 Bacteria 1100
535 Ga0501259_027433 3300049688 Bacteria 1054
536 Ga0501260_000680 3300049689 Bacteria 2658
537 Ga0501260_010166 3300049689 Bacteria 942
538 Ga0501225_0007279 3300049705 Bacteria 3208
539 Ga0501225_0018696 3300049705 Bacteria 1919
540 Ga0501229_010507 3300049706 Bacteria 1169
541 Ga0501234_016539 3300049707 Bacteria 1164
542 Ga0501263_037776 3300049760 Bacteria 701
543 Ga0501268_014978 3300049765 Unclassified 1270
544 Ga0501270_020367 3300049767 Bacteria 1004
545 Ga0501272_029689 3300049769 Bacteria 690
546 Ga0501273_038135 3300049770 Unclassified 704
547 Ga0501275_040642 3300049772 Unclassified 650
548 Ga0501279_021784 3300049775 Bacteria 917
549 Ga0501280_025274 3300049776 Bacteria 904
550 Ga0501280_052703 3300049776 Bacteria 688
551 Ga0501283_001236 3300049779 Unclassified 3368
552 Ga0501283_063790 3300049779 Unclassified 669
553 Ga0501226_007607 3300049853 Bacteria 1214
554 nmdc:mga05p37_786242_c1 3300050507 Unclassified 1043
555 nmdc:mga05p37_788305_c1 3300050507 Bacteria 1042
556 nmdc:mga09592_199956_c1 3300050508 Unclassified 1730
557 nmdc:mga09592_255146_c1 3300050508 Bacteria 1520
558 nmdc:mga09592_272354_c1 3300050508 Bacteria 1468
559 nmdc:mga0qj67_220805_c1 3300050509 Bacteria 1539
560 nmdc:mga06r32_141589_c1 3300050510 Unclassified 2381
561 nmdc:mga08y16_20920_c1 3300050511 Bacteria 6908
562 nmdc:mga08y16_276158_c1 3300050511 Bacteria 1734
563 nmdc:mga08y16_337924_c1 3300050511 Bacteria 1548
564 nmdc:mga08y16_49665_c1 3300050511 Bacteria 4390
565 nmdc:mga08y16_767005_c1 3300050511 Bacteria 959
566 nmdc:mga0n895_507369_c1 3300050512 Bacteria 1215
567 nmdc:mga0n895_79361_c1 3300050512 Bacteria 3269
568 nmdc:mga0a205_179315_c1 3300050515 Bacteria 2013
569 nmdc:mga0a205_29515_c2 3300050515 Bacteria 2340
570 nmdc:mga0a205_57440_c1 3300050515 Bacteria 3758
571 nmdc:mga0a205_83461_c1 3300050515 Bacteria 3086
572 Ga0590071_000310 3300059421 Bacteria 14261
573 Ga0590075_006270 3300059424 Bacteria 2821
574 Ga0590077_000676 3300059426 Bacteria 9080
575 Ga0065712_10091565
576 CNAas_1000502
577 JGI24737J22298_10040427
578 JGI24751J29686_10000068
579 JGI25406J46586_10032531
580 JGI25406J46586_10158701
581 Ga0065712_10097736
582 Ga0065715_10010393
583 Ga0065715_10102534
584 Ga0065715_10126835
585 Ga0065715_10135545
586 Ga0065715_10168205
587 Ga0065715_10774891
588 Ga0065707_10007088
589 Ga0065707_10202980
590 Ga0070676_10013112
591 Ga0070676_10953492
592 Ga0070670_100000043
593 Ga0070670_100000227
594 Ga0070670_100029315
595 Ga0070670_100045638
596 Ga0070670_100346009
597 Ga0070670_100973900
598 Ga0068869_100121259
599 Ga0068869_100125468
600 Ga0070680_100047969
601 Ga0070682_100007097
602 Ga0070682_100021112
603 Ga0068868_101220639
604 Ga0070692_10070215
605 Ga0070692_10125851
606 Ga0070692_10319548
607 Ga0070669_100016695
608 Ga0070675_100117719
609 Ga0070675_100418594
610 Ga0070673_100040520
611 Ga0070673_100271816
612 Ga0070673_100583670
613 Ga0070673_100964520
614 Ga0070673_101217569
615 Ga0070688_100419840
616 Ga0070659_100255495
617 Ga0070703_10001807
618 Ga0070701_10019202
619 Ga0070701_10213387
620 Ga0070701_10329239
621 Ga0070701_10548297
622 Ga0070705_100005979
623 Ga0070705_100069522
624 Ga0070705_100072130
625 Ga0070705_100074717
626 Ga0070705_100125353
627 Ga0070705_100341992
628 Ga0070705_100756333
629 Ga0070700_100000048
630 Ga0070700_100014924
631 Ga0070700_100016681
632 Ga0070700_100044342
633 Ga0070700_100127821
634 Ga0070694_100016648
635 Ga0070694_100027227
636 Ga0070694_100066173
637 Ga0070694_100150617
638 Ga0070694_100189835
639 Ga0070694_100374949
640 Ga0070662_100141511
641 Ga0070681_10013767
642 Ga0070681_10302769
643 Ga0070681_10442687
644 Ga0068867_100033103
645 Ga0068867_100164236
646 Ga0068867_100205996
647 Ga0070685_10127324
648 Ga0070707_100659815
649 Ga0070698_100256703
650 Ga0070699_100159154
651 Ga0070699_100535028
652 Ga0070699_100772547
653 Ga0070679_100098383
654 Ga0070697_100064900
655 Ga0070697_101186044
656 Ga0068853_100063483
657 Ga0068853_100270013
658 Ga0068853_100452409
659 Ga0068853_100761689
660 Ga0070672_100775290
661 Ga0070695_100105053
662 Ga0070695_100146586
663 Ga0070695_100190259
664 Ga0070695_100894924
665 Ga0070696_100032685
666 Ga0070696_100173107
667 Ga0070696_100282365
668 Ga0070696_100387480
669 Ga0070693_100003084
670 Ga0070693_100012866
671 Ga0070693_100014205
672 Ga0070693_100039390
673 Ga0070693_100049168
674 Ga0070693_100165062
675 Ga0070693_100879129
676 Ga0070704_100037211
677 Ga0070704_100481559
678 Ga0070704_100871151
679 Ga0070664_100097953
680 Ga0068857_100098974
681 Ga0068857_100159843
682 Ga0068857_100191631
683 Ga0068857_100218662
684 Ga0068857_100451509
685 Ga0068854_100018355
686 Ga0068854_100093702
687 Ga0068854_100222498
688 Ga0068856_100171002
689 Ga0070702_100053274
690 Ga0070702_100121012
691 Ga0070702_100220193
692 Ga0068852_100060606
693 Ga0068852_100564905
694 Ga0068852_100834423
695 Ga0068859_100000207
696 Ga0068859_100029377
697 Ga0068859_100037988
698 Ga0068859_100044121
699 Ga0068859_100046945
700 Ga0068859_100068786
701 Ga0068859_100082486
702 Ga0068859_100087095
703 Ga0068859_100142612
704 Ga0068859_100169298
705 Ga0068859_100182888
706 Ga0068859_100208826
707 Ga0068859_100267345
708 Ga0068859_100451345
709 Ga0068859_100525989
710 Ga0068859_100551083
711 Ga0068859_101074890
712 Ga0068859_101197575
713 Ga0068859_101367465
714 Ga0068859_101412453
715 Ga0068864_100051824
716 Ga0068864_100234415
717 Ga0068864_100282416
718 Ga0068864_100337888
719 Ga0068864_100516016
720 Ga0068864_100577758
721 Ga0068864_100598638
722 Ga0068864_100623194
723 Ga0068864_100701834
724 Ga0068861_100181629
725 Ga0068861_100366217
726 Ga0068861_100418302
727 Ga0068851_10050416
728 Ga0068870_10037503
729 Ga0068870_10038390
730 Ga0068863_100089850
731 Ga0068863_100110287
732 Ga0068863_100494584
733 Ga0068863_101027068
734 Ga0068858_100133598
735 Ga0068858_100546823
736 Ga0068858_100594975
737 Ga0068858_100725234
738 Ga0068860_100018412
739 Ga0068860_100030919
740 Ga0068860_100055137
741 Ga0068860_100079708
742 Ga0068860_100117332
743 Ga0068860_100150690
744 Ga0068860_100158824
745 Ga0068860_100676578
746 Ga0068860_100906601
747 Ga0068860_101366208
748 Ga0068862_100246724
749 Ga0068862_100326073
750 Ga0068862_100431442
751 Ga0068862_100505424
752 Ga0068862_100831283
753 Ga0068862_101270434
754 Ga0081539_10000647
755 Ga0081539_10001765
756 Ga0081539_10012447
757 Ga0081539_10052280
758 Ga0097621_100013933
759 Ga0097621_100355065
760 Ga0068871_100011966
761 Ga0068871_100562442
762 Ga0068871_100601944
763 Ga0075430_100020984
764 Ga0075431_100081550
765 Ga0075431_100107944
766 Ga0075431_100456541
767 Ga0075434_100002163
768 Ga0075434_100723558
769 Ga0075434_100848359
770 Ga0075429_100049184
771 Ga0075429_100280287
772 Ga0075429_100292879
773 Ga0068865_100109805
774 Ga0097620_100000207
775 Ga0097620_100029377
776 Ga0097620_100037982
777 Ga0097620_100044121
778 Ga0097620_100046944
779 Ga0097620_100068789
780 Ga0097620_100082484
781 Ga0097620_100087094
782 Ga0097620_100142609
783 Ga0097620_100169304
784 Ga0097620_100182887
785 Ga0097620_100208829
786 Ga0097620_100267345
787 Ga0097620_100360943
788 Ga0097620_100451357
789 Ga0097620_100525983
790 Ga0097620_100551077
791 Ga0097620_101075003
792 Ga0097620_101197535
793 Ga0097620_101367464
794 Ga0097620_101412443
795 Ga0105251_10041367
796 Ga0105240_10704591
797 Ga0111539_10006037
798 Ga0111539_10009645
799 Ga0111539_10032213
800 Ga0111539_11656094
801 Ga0105245_10444690
802 Ga0105245_10634192
803 Ga0105245_10751986
804 Ga0105245_11066931
805 Ga0105247_10001051
806 Ga0105247_10006496
807 Ga0105247_10062782
808 Ga0105247_10096468
809 Ga0105247_10098264
810 Ga0105247_10102411
811 Ga0105247_10183069
812 Ga0105247_10388279
813 Ga0105247_10622697
814 Ga0105247_10837853
815 Ga0114129_10868732
816 Ga0114129_11074680
817 Ga0114129_11444586
818 Ga0105243_10019614
819 Ga0105243_10026094
820 Ga0105243_10026455
821 Ga0105243_10034902
822 Ga0105241_10039257
823 Ga0105241_10061924
824 Ga0105241_10131047
825 Ga0105241_10134849
826 Ga0105241_10142086
827 Ga0105241_10227505
828 Ga0105241_10425840
829 Ga0105242_10010579
830 Ga0105242_10475838
831 Ga0105248_10015997
832 Ga0105248_10030761
833 Ga0105248_10083059
834 Ga0105248_10130296
835 Ga0105248_10342313
836 Ga0105248_10399628
837 Ga0105248_10577837
838 Ga0105248_11124817
839 Ga0105248_11129633
840 Ga0105237_10000527
841 Ga0105237_10098317
842 Ga0105237_10759441
843 Ga0105238_10007273
844 Ga0105238_10011962
845 Ga0105238_10013077
846 Ga0105238_10558442
847 Ga0105249_10004831
848 Ga0105239_10121913
849 Ga0105239_10250868
850 Ga0105246_10016964
851 Ga0105246_10151738
852 Ga0157373_10016867
853 Ga0157373_10070345
854 Ga0157373_10245082
855 Ga0157373_10446666
856 Ga0157373_10501364
857 Ga0157373_10597541
858 Ga0157374_10424883
859 Ga0157374_10461529
860 Ga0163162_10011478
861 Ga0163162_10030790
862 Ga0163162_10214914
863 Ga0163162_10257192
864 Ga0163162_10639852
865 Ga0157375_10151641
866 Ga0157375_11292693
867 Ga0163163_10000144
868 Ga0163163_10000277
869 Ga0163163_10238254
870 Ga0157380_10055707
871 Ga0157380_10354725
872 Ga0157380_10609331
873 Ga0157377_10042016
874 Ga0157377_10135661
875 Ga0157377_10286778
876 Ga0157377_10702360
877 Ga0157379_10109748
878 Ga0157379_10602421
879 Ga0157379_10733726
880 Ga0157379_10916157
881 Ga0163161_10362791
882 Ga0213876_10000041
883 Ga0207653_10001772
884 Ga0207710_10000781
885 Ga0207710_10001517
886 Ga0207710_10143538
887 Ga0207710_10200417
888 Ga0207688_10333096
889 Ga0207647_10011219
890 Ga0207647_10152787
891 Ga0207645_10117623
892 Ga0207643_10036414
893 Ga0207643_10065629
894 Ga0207643_10072283
895 Ga0207643_10260300
896 Ga0207654_10004797
897 Ga0207654_10024452
898 Ga0207654_10069234
899 Ga0207654_10583271
900 Ga0207707_10016424
901 Ga0207707_10515367
902 Ga0207671_10002025
903 Ga0207671_10621434
904 Ga0207662_10232554
905 Ga0207662_10472207
906 Ga0207652_10176470
907 Ga0207646_10147775
908 Ga0207681_10063574
909 Ga0207681_10215169
910 Ga0207681_10446921
911 Ga0207694_10007574
912 Ga0207694_10054987
913 Ga0207650_10000009
914 Ga0207650_10000027
915 Ga0207650_10141229
916 Ga0207650_10668784
917 Ga0207659_10301050
918 Ga0207659_10531365
919 Ga0207659_10553029
920 Ga0207659_10850042
921 Ga0207706_10090232
922 Ga0207686_10021977
923 Ga0207686_10145536
924 Ga0207709_10017508
925 Ga0207709_10104646
926 Ga0207709_10975824
927 Ga0207670_10007884
928 Ga0207670_10837100
929 Ga0207704_10015988
930 Ga0207704_10522371
931 Ga0207711_10017288
932 Ga0207711_10035762
933 Ga0207711_10074354
934 Ga0207711_10196986
935 Ga0207711_10749195
936 Ga0207689_10087514
937 Ga0207689_10115799
938 Ga0207689_10507913
939 Ga0207689_10510427
940 Ga0207689_10533927
941 Ga0207679_10839414
942 Ga0207667_10260055
943 Ga0207651_10030399
944 Ga0207651_10205036
945 Ga0207651_10223805
946 Ga0207651_10304849
947 Ga0207712_10008739
948 Ga0207640_10165470
949 Ga0207640_10213254
950 Ga0207640_10295062
951 Ga0207640_10403118
952 Ga0207703_10387975
953 Ga0207639_10536221
954 Ga0207708_10000054
955 Ga0207708_10003279
956 Ga0207708_10026258
957 Ga0207708_10047366
958 Ga0207708_10086782
959 Ga0207708_10218165
960 Ga0207641_10124985
961 Ga0207641_10234064
962 Ga0207641_10318471
963 Ga0207641_10386289
964 Ga0207641_10398130
965 Ga0207641_10548230
966 Ga0207641_11368954
967 Ga0207648_10043100
968 Ga0207648_10044454
969 Ga0207648_10219421
970 Ga0207676_10052034
971 Ga0207676_10085765
972 Ga0207676_10117763
973 Ga0207676_10160757
974 Ga0207676_10262631
975 Ga0207676_10288723
976 Ga0207676_10315083
977 Ga0207676_10482733
978 Ga0207676_10597758
979 Ga0207676_10675229
980 Ga0207676_10854297
981 Ga0207676_11036371
982 Ga0207676_11615227
983 Ga0207674_10011002
984 Ga0207674_10042623
985 Ga0207674_10068111
986 Ga0207674_10169725
987 Ga0207674_10199184
988 Ga0207674_10217492
989 Ga0207675_100010707
990 Ga0207675_100019188
991 Ga0207675_100057815
992 Ga0207675_100102585
993 Ga0207675_100104623
994 Ga0207675_100443161
995 Ga0207683_10269401
996 Ga0207683_10880873
997 Ga0207698_10177460
998 Ga0207698_10668674
999 Ga0207698_10893082
1000 Ga0207428_10009187
1001 Ga0207428_10078161
1002 Ga0268265_10127882
1003 Ga0268265_10167640
1004 Ga0268265_10348295
1005 Ga0268265_10851974
1006 Ga0268265_11471361
1007 Ga0268264_10016548
1008 Ga0268264_10046489
1009 Ga0268264_10049162
1010 Ga0268264_10099803
1011 Ga0268264_10223198
1012 Ga0268264_10420068
1013 Ga0268264_10431717
1014 Ga0268264_11200762
1015 Ga0307408_100406709
1016 Ga0307410_10254644
1017 Ga0307406_10029796
1018 Ga0307406_10439237
1019 Ga0307406_10453573
1020 Ga0307406_10535287
1021 Ga0307407_10206159
1022 Ga0307412_10029803
1023 Ga0307412_10311479
1024 Ga0307416_100007084
1025 Ga0307414_10482485
1026 Ga0307411_10087856
1027 Ga0307411_10213419
1028 Ga0307415_100027410
1029 Ga0373940_0200285
1030 Ga0373949_0111453
1031 Ga0373951_0000328
1032 Ga0373939_0225981
1033 Ga0395900_0241259
1034 Ga0395898_0149873
1035 Ga0395898_0181604
1036 Ga0395905_0590238
1037 Ga0395901_0712270
1038 Ga0436365_1476328
1039 Ga0439448_0034851
1040 Ga0451577_0560081
1041 Ga0453683_0256643
1042 Ga0451576_0208317
1043 Ga0495652_0060237
1044 Ga0495587_0309975
1045 Ga0495623_0100666
1046 Ga0496106_0052312
1047 Ga0496108_0143093
1048 Ga0496108_0863048
1049 Ga0496110_0254356
1050 Ga0496112_0030842
1051 Ga0496112_0863265
1052 Ga0496113_0093321
1053 Ga0501291_059008
1054 Ga0501291_066926
1055 Ga0501292_004069
1056 Ga0501295_105667
1057 Ga0501296_003436
1058 Ga0501297_009138
1059 Ga0501297_012960
1060 Ga0501297_041885
1061 Ga0501298_005390
1062 Ga0501298_006803
1063 Ga0501299_001044
1064 Ga0501299_029023
1065 Ga0501038_0009450
1066 Ga0501075_0557236
1067 Ga0501076_0552587
1068 Ga0501076_0647117
1069 Ga0501198_004595
1070 Ga0501198_016584
1071 Ga0501206_023470
1072 Ga0501207_000720
1073 Ga0501207_015413
1074 Ga0501209_056087
1075 Ga0501216_001504
1076 Ga0501216_003701
1077 Ga0501216_017516
1078 Ga0501216_035774
1079 Ga0501217_009106
1080 Ga0501217_049137
1081 Ga0501217_053704
1082 Ga0501223_006541
1083 Ga0501223_009174
1084 Ga0501223_012237
1085 Ga0501223_032493
1086 Ga0501224_010908
1087 Ga0501227_004450
1088 Ga0501227_061893
1089 Ga0501228_012933
1090 Ga0501233_048791
1091 Ga0501233_052325
1092 Ga0501233_058782
1093 Ga0501235_007448
1094 Ga0501235_013149
1095 Ga0501235_026850
1096 Ga0501239_018164
1097 Ga0501239_028327
1098 Ga0501243_004037
1099 Ga0501243_007607
1100 Ga0501243_049986
1101 Ga0501249_010670
1102 Ga0501249_027951
1103 Ga0501251_012162
1104 Ga0501256_006057
1105 Ga0501257_023163
1106 Ga0501257_029016
1107 Ga0501257_045428
1108 Ga0501259_024452
1109 Ga0501259_027433
1110 Ga0501260_000680
1111 Ga0501260_010166
1112 Ga0501225_0007279
1113 Ga0501225_0018696
1114 Ga0501229_010507
1115 Ga0501234_016539
1116 Ga0501263_037776
1117 Ga0501268_014978
1118 Ga0501270_020367
1119 Ga0501272_029689
1120 Ga0501273_038135
1121 Ga0501275_040642
1122 Ga0501279_021784
1123 Ga0501280_025274
1124 Ga0501280_052703
1125 Ga0501283_001236
1126 Ga0501283_063790
1127 Ga0501226_007607
1128 nmdc:mga05p37_786242_c1
1129 nmdc:mga05p37_788305_c1
1130 nmdc:mga09592_199956_c1
1131 nmdc:mga09592_255146_c1
1132 nmdc:mga09592_272354_c1
1133 nmdc:mga0qj67_220805_c1
1134 nmdc:mga06r32_141589_c1
1135 nmdc:mga08y16_20920_c1
1136 nmdc:mga08y16_276158_c1
1137 nmdc:mga08y16_337924_c1
1138 nmdc:mga08y16_49665_c1
1139 nmdc:mga08y16_767005_c1
1140 nmdc:mga0n895_507369_c1
1141 nmdc:mga0n895_79361_c1
1142 nmdc:mga0a205_179315_c1
1143 nmdc:mga0a205_29515_c2
1144 nmdc:mga0a205_57440_c1
1145 nmdc:mga0a205_83461_c1
1146 Ga0590071_000310
1147 Ga0590075_006270
1148 Ga0590077_000676

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k0d-assembly1.cif.gz_B periplasmic sensor domain of sensor histidine kinase, adeh_2942 0.601 19 159
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.5432 20 157
5xsj-assembly1.cif.gz_L xylfii-lytsn complex 0.5301 20 157
8j0h-assembly3.cif.gz_C crystal structure of the fission yeast rex1bd protein(c4h3.06) 0.4851 18 159
3zsu-assembly1.cif.gz_A structure of the cyanoq protein from thermosynechococcus elongatus 0.4812 23 159
ID Description Score Start End Superfamily
af_Q8S8F1_85_256_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.6159 11 159 1.20.120.1770
af_A0A1D6JN65_108_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.578 24 159 1.20.120.1770
af_A0A0G2K2F0_335_464_1.20.120.350 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Voltage-gated potassium channels. Chain C 0.5556 22 161 1.20.120.350
af_Q4DB10_34_240_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5442 2 165 1.20.120.1770
af_O16271_13_246_1.20.120.1770 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A); 0.5228 18 168 1.20.120.1770
ID Description Score Start End GO Terms
AF-A0A0M8WL21-F1-model_v4 Uncharacterized protein 0.9554 17 161 GO:0016020
AF-A0A2V7SE59-F1-model_v4 HXXEE domain-containing protein 0.9531 8 166 GO:0016020
AF-A0A495WZC8-F1-model_v4 Uncharacterized protein 0.9473 11 179 GO:0016020
AF-A0A1Q5HN55-F1-model_v4 HXXEE domain-containing protein 0.9468 12 177 GO:0016020
AF-A0A2L2XPU0-F1-model_v4 Uncharacterized protein 0.9454 77 168

Map