F465202

General Info

Members Datasets Scaffolds Average Seq Length
573 283 571 170

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0192111|Ga0373937_0192111_1080_1691
Length 203
Sequence VAVPFPEPTAPASSRTEVFLRYLDFFRSRLTAKLLALPEEEQRRSRLPSGWTPLELVKHLRYVELRWLEWGFEGRDVGDPWGDHQGGPEGRWSVGPEETAATLLNGLHVQAARSRAIISAHTLDEVGELGERWDGADPATLERVLFHLLQEYARHVGHLDVIVELAAGRSGELKAPLSLKTPLSRPCRPRSGSGTRPDPRSRS

Samples

Sample ID Description Type Environment
1 2880489317 Micromonospora ureilytica DSM 101692 Isolate Unclassified
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
32 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
33 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
67 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
80 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
148 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
149 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
152 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
153 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
156 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
157 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
162 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
163 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
167 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
170 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
182 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
183 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
184 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
185 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
186 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
187 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
188 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
189 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
190 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
191 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
192 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
193 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
202 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
203 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
204 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
205 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
206 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
207 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
208 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
209 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
210 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
211 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
212 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
213 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
214 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
215 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
221 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
222 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
223 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
231 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
232 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
233 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
234 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
235 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
236 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
237 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
243 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
244 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
245 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
246 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
247 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
248 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
249 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
250 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
251 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
252 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
263 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
264 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
265 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
266 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
267 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
268 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
269 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
271 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
272 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
273 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
279 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
280 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 8001781756 Catellatospora tritici NEAU-YM18 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1.4
Isolates 0.35

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 9.95
Rhizosphere 86.91
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10029025 3300003659 Bacteria 1187
2 Ga0070658_10141021 3300005327 Bacteria 2013
3 Ga0070683_100014040 3300005329 Bacteria 6995
4 Ga0070683_100360737 3300005329 Bacteria 1384
5 Ga0070680_100015620 3300005336 Bacteria 5956
6 Ga0068868_100393585 3300005338 Bacteria 1194
7 Ga0070660_100199279 3300005339 Bacteria 1624
8 Ga0070691_10268898 3300005341 Bacteria 920
9 Ga0070687_100147428 3300005343 Bacteria 1377
10 Ga0070661_100848816 3300005344 Bacteria 751
11 Ga0070661_100868193 3300005344 Bacteria 743
12 Ga0070692_10190736 3300005345 Bacteria 1194
13 Ga0070668_100233078 3300005347 Bacteria 1523
14 Ga0070671_100137337 3300005355 Bacteria 2061
15 Ga0070671_100815066 3300005355 Bacteria 813
16 Ga0070671_101067202 3300005355 Bacteria 709
17 Ga0070674_101039394 3300005356 Bacteria 721
18 Ga0070659_100029115 3300005366 Bacteria 4267
19 Ga0070667_100877264 3300005367 Bacteria 835
20 Ga0070667_101112811 3300005367 Bacteria 738
21 Ga0070709_10064337 3300005434 Bacteria 2345
22 Ga0070709_10064802 3300005434 Bacteria 2337
23 Ga0070714_100048325 3300005435 Bacteria 3618
24 Ga0070714_100219311 3300005435 Bacteria 1747
25 Ga0070714_100613556 3300005435 Bacteria 1045
26 Ga0070714_100945510 3300005435 Bacteria 837
27 Ga0070713_100134735 3300005436 Bacteria 2182
28 Ga0070713_100332697 3300005436 Bacteria 1405
29 Ga0070713_100363345 3300005436 Bacteria 1345
30 Ga0070713_100448460 3300005436 Bacteria 1211
31 Ga0070713_100573424 3300005436 Bacteria 1070
32 Ga0070713_100574162 3300005436 Bacteria 1069
33 Ga0070710_10155331 3300005437 Bacteria 1414
34 Ga0070710_10176595 3300005437 Bacteria 1334
35 Ga0070710_10192509 3300005437 Bacteria 1283
36 Ga0070710_10230833 3300005437 Bacteria 1181
37 Ga0070711_100067353 3300005439 Bacteria 2512
38 Ga0070711_100211157 3300005439 Bacteria 1503
39 Ga0070711_100475244 3300005439 Bacteria 1026
40 Ga0070711_100827660 3300005439 Bacteria 786
41 Ga0070694_100269354 3300005444 Bacteria 1295
42 Ga0070708_100032331 3300005445 Bacteria 4537
43 Ga0070708_100033055 3300005445 Bacteria 4493
44 Ga0070708_100085548 3300005445 Bacteria 2862
45 Ga0070708_100137595 3300005445 Bacteria 2263
46 Ga0070663_100014876 3300005455 Bacteria 5004
47 Ga0070681_10339299 3300005458 Bacteria 1412
48 Ga0070681_10466905 3300005458 Bacteria 1175
49 Ga0070685_10128377 3300005466 Bacteria 1583
50 Ga0070706_100043355 3300005467 Bacteria 4157
51 Ga0070706_100048227 3300005467 Bacteria 3931
52 Ga0070706_100050251 3300005467 Bacteria 3848
53 Ga0070706_100065671 3300005467 Bacteria 3356
54 Ga0070706_100069289 3300005467 Bacteria 3263
55 Ga0070707_100169391 3300005468 Bacteria 2128
56 Ga0070707_100404443 3300005468 Bacteria 1325
57 Ga0070707_100507796 3300005468 Bacteria 1167
58 Ga0070707_101442947 3300005468 Bacteria 655
59 Ga0070698_100003440 3300005471 Bacteria 17405
60 Ga0070698_100004116 3300005471 Bacteria 15988
61 Ga0070698_100135372 3300005471 Bacteria 2418
62 Ga0070698_100794875 3300005471 Unclassified 890
63 Ga0070699_100003864 3300005518 Bacteria 13243
64 Ga0070699_100243621 3300005518 Bacteria 1605
65 Ga0070679_100256115 3300005530 Bacteria 1705
66 Ga0070679_101053203 3300005530 Bacteria 758
67 Ga0070684_100018443 3300005535 Bacteria 5748
68 Ga0070684_100261701 3300005535 Unclassified 1583
69 Ga0070684_100502606 3300005535 Bacteria 1123
70 Ga0070697_100001583 3300005536 Bacteria 17360
71 Ga0068853_100061610 3300005539 Bacteria 3245
72 Ga0070695_100271032 3300005545 Bacteria 1243
73 Ga0070696_100069953 3300005546 Bacteria 2467
74 Ga0070693_100070759 3300005547 Bacteria 2053
75 Ga0070693_100121064 3300005547 Bacteria 1623
76 Ga0070665_100551477 3300005548 Bacteria 1165
77 Ga0068855_101192413 3300005563 Bacteria 792
78 Ga0070664_100036667 3300005564 Bacteria 4119
79 Ga0070664_100238486 3300005564 Bacteria 1632
80 Ga0068857_100306938 3300005577 Bacteria 1463
81 Ga0068856_100031132 3300005614 Bacteria 5219
82 Ga0068856_100304210 3300005614 Bacteria 1612
83 Ga0070702_100004107 3300005615 Bacteria 6605
84 Ga0068852_100017952 3300005616 Bacteria 5564
85 Ga0068852_100213025 3300005616 Bacteria 1834
86 Ga0068852_100295380 3300005616 Bacteria 1566
87 Ga0068859_100037750 3300005617 Bacteria 4848
88 Ga0068864_100428941 3300005618 Bacteria 1261
89 Ga0068864_100520220 3300005618 Bacteria 1147
90 Ga0068866_10054001 3300005718 Bacteria 2057
91 Ga0068861_100734528 3300005719 Bacteria 921
92 Ga0068863_100244492 3300005841 Bacteria 1732
93 Ga0068858_100807146 3300005842 Bacteria 915
94 Ga0068858_101084167 3300005842 Bacteria 786
95 Ga0068860_100758139 3300005843 Bacteria 982
96 Ga0068862_100717693 3300005844 Bacteria 970
97 Ga0081540_1013958 3300005983 Bacteria 5184
98 Ga0070717_10002454 3300006028 Bacteria 13084
99 Ga0070717_10017942 3300006028 Bacteria 5519
100 Ga0070717_10077573 3300006028 Bacteria 2782
101 Ga0070717_10277541 3300006028 Bacteria 1485
102 Ga0070717_10333918 3300006028 Bacteria 1352
103 Ga0075432_10080755 3300006058 Bacteria 1179
104 Ga0070715_10006414 3300006163 Bacteria 3998
105 Ga0070715_10098656 3300006163 Bacteria 1358
106 Ga0070715_10146180 3300006163 Bacteria 1153
107 Ga0070716_100004600 3300006173 Bacteria 6615
108 Ga0070716_100025592 3300006173 Bacteria 3150
109 Ga0070716_100165794 3300006173 Bacteria 1436
110 Ga0070716_100284580 3300006173 Bacteria 1142
111 Ga0070712_100078412 3300006175 Bacteria 2384
112 Ga0070712_100275958 3300006175 Bacteria 1352
113 Ga0070712_100499431 3300006175 Bacteria 1019
114 Ga0070712_100613227 3300006175 Bacteria 922
115 Ga0097621_100033364 3300006237 Bacteria 4099
116 Ga0068871_100095092 3300006358 Bacteria 2488
117 Ga0075431_100672683 3300006847 Bacteria 1014
118 Ga0075434_100168309 3300006871 Bacteria 2211
119 Ga0075434_101147512 3300006871 Bacteria 790
120 Ga0068865_100399390 3300006881 Bacteria 1125
121 Ga0075436_100253587 3300006914 Bacteria 1253
122 Ga0075436_100369745 3300006914 Bacteria 1035
123 Ga0097620_100037749 3300006931 Bacteria 4848
124 Ga0075435_101247758 3300007076 Bacteria 650
125 Ga0105251_10067796 3300009011 Bacteria 1666
126 Ga0105245_10298348 3300009098 Bacteria 1580
127 Ga0105245_10392014 3300009098 Unclassified 1386
128 Ga0105247_10565517 3300009101 Bacteria 838
129 Ga0105247_10648530 3300009101 Unclassified 788
130 Ga0105243_10266900 3300009148 Bacteria 1535
131 Ga0105241_10126691 3300009174 Bacteria 2063
132 Ga0105241_10555710 3300009174 Bacteria 1031
133 Ga0105242_10037586 3300009176 Bacteria 3889
134 Ga0105242_12114280 3300009176 Bacteria 607
135 Ga0105248_10067129 3300009177 Bacteria 4027
136 Ga0105248_11107872 3300009177 Bacteria 895
137 Ga0105248_12023076 3300009177 Bacteria 655
138 Ga0105237_10275373 3300009545 Bacteria 1686
139 Ga0105237_10421629 3300009545 Bacteria 1340
140 Ga0105238_10478866 3300009551 Bacteria 1244
141 Ga0105249_10413527 3300009553 Bacteria 1381
142 Ga0099796_10158825 3300010159 Bacteria 895
143 Ga0105246_12209923 3300011119 Bacteria 536
144 Ga0157339_1019463 3300012505 Bacteria 708
145 Ga0157338_1014245 3300012515 Bacteria 854
146 Ga0157373_10050968 3300013100 Bacteria 2947
147 Ga0157371_10040204 3300013102 Bacteria 3341
148 Ga0157370_10684455 3300013104 Bacteria 936
149 Ga0157370_10787676 3300013104 Bacteria 865
150 Ga0157369_10711836 3300013105 Bacteria 1034
151 Ga0157369_10749161 3300013105 Bacteria 1005
152 Ga0157374_10796910 3300013296 Bacteria 960
153 Ga0157378_10294788 3300013297 Bacteria 1568
154 Ga0163162_10200659 3300013306 Bacteria 2123
155 Ga0157375_10020740 3300013308 Bacteria 6012
156 Ga0157375_10156132 3300013308 Bacteria 2421
157 Ga0163163_10004668 3300014325 Bacteria 11717
158 Ga0163163_10228230 3300014325 Bacteria 1911
159 Ga0163163_10476624 3300014325 Bacteria 1309
160 Ga0163163_10810195 3300014325 Bacteria 1000
161 Ga0157377_10375734 3300014745 Bacteria 961
162 Ga0157377_10444227 3300014745 Bacteria 894
163 Ga0157379_10917237 3300014968 Bacteria 832
164 Ga0197907_11237433 3300020069 Bacteria 886
165 Ga0206355_1042905 3300020076 Bacteria 822
166 Ga0206354_10964236 3300020081 Bacteria 2219
167 Ga0206353_10002787 3300020082 Bacteria 2499
168 Ga0206353_10271275 3300020082 Bacteria 1418
169 Ga0213874_10048771 3300021377 Bacteria 1293
170 Ga0213875_10001784 3300021388 Bacteria 13446
171 Ga0213875_10258731 3300021388 Bacteria 821
172 Ga0207653_10059550 3300025885 Bacteria 1285
173 Ga0207692_10005120 3300025898 Bacteria 5231
174 Ga0207692_10014198 3300025898 Bacteria 3475
175 Ga0207692_10044866 3300025898 Bacteria 2208
176 Ga0207692_10467519 3300025898 Bacteria 796
177 Ga0207642_10021730 3300025899 Bacteria 2532
178 Ga0207710_10289506 3300025900 Bacteria 825
179 Ga0207688_10002720 3300025901 Bacteria 9572
180 Ga0207680_10741171 3300025903 Bacteria 704
181 Ga0207685_10005240 3300025905 Bacteria 3400
182 Ga0207685_10008491 3300025905 Bacteria 2928
183 Ga0207685_10040776 3300025905 Bacteria 1733
184 Ga0207699_10016549 3300025906 Bacteria 3860
185 Ga0207699_10108480 3300025906 Bacteria 1775
186 Ga0207699_10115967 3300025906 Bacteria 1724
187 Ga0207699_10182037 3300025906 Bacteria 1413
188 Ga0207643_10008137 3300025908 Bacteria 5626
189 Ga0207705_10354696 3300025909 Bacteria 1130
190 Ga0207684_10001773 3300025910 Bacteria 22776
191 Ga0207684_10058486 3300025910 Bacteria 3271
192 Ga0207684_10070134 3300025910 Bacteria 2979
193 Ga0207684_10085769 3300025910 Bacteria 2682
194 Ga0207654_10074522 3300025911 Bacteria 2026
195 Ga0207707_10417777 3300025912 Bacteria 1150
196 Ga0207693_10026332 3300025915 Bacteria 4603
197 Ga0207693_10032835 3300025915 Bacteria 4096
198 Ga0207693_10040765 3300025915 Bacteria 3657
199 Ga0207693_10436823 3300025915 Bacteria 1023
200 Ga0207663_10008970 3300025916 Bacteria 5263
201 Ga0207663_10016125 3300025916 Bacteria 4135
202 Ga0207663_10095512 3300025916 Bacteria 1983
203 Ga0207663_10198142 3300025916 Bacteria 1447
204 Ga0207663_10359590 3300025916 Bacteria 1104
205 Ga0207660_10578311 3300025917 Bacteria 914
206 Ga0207662_10005891 3300025918 Bacteria 6575
207 Ga0207657_10070890 3300025919 Bacteria 2953
208 Ga0207649_10190254 3300025920 Bacteria 1443
209 Ga0207646_10045854 3300025922 Bacteria 3923
210 Ga0207646_10114269 3300025922 Bacteria 2424
211 Ga0207659_10105918 3300025926 Bacteria 2128
212 Ga0207700_10005860 3300025928 Bacteria 7386
213 Ga0207700_10012586 3300025928 Bacteria 5465
214 Ga0207700_10024290 3300025928 Bacteria 4193
215 Ga0207700_10108621 3300025928 Bacteria 2228
216 Ga0207700_10374894 3300025928 Bacteria 1243
217 Ga0207700_10627367 3300025928 Bacteria 958
218 Ga0207664_10011699 3300025929 Bacteria 6253
219 Ga0207664_10022469 3300025929 Bacteria 4710
220 Ga0207664_10047453 3300025929 Bacteria 3374
221 Ga0207664_10282248 3300025929 Bacteria 1457
222 Ga0207664_10303435 3300025929 Bacteria 1405
223 Ga0207664_10359748 3300025929 Bacteria 1289
224 Ga0207664_10587846 3300025929 Bacteria 1000
225 Ga0207664_11070873 3300025929 Bacteria 721
226 Ga0207664_11273954 3300025929 Bacteria 654
227 Ga0207644_10285662 3300025931 Bacteria 1326
228 Ga0207690_10328943 3300025932 Bacteria 1203
229 Ga0207706_10168201 3300025933 Bacteria 1926
230 Ga0207709_10084292 3300025935 Bacteria 2057
231 Ga0207709_10192254 3300025935 Bacteria 1451
232 Ga0207665_10006379 3300025939 Bacteria 7824
233 Ga0207665_10010961 3300025939 Bacteria 5951
234 Ga0207665_10013444 3300025939 Bacteria 5382
235 Ga0207665_10145507 3300025939 Bacteria 1693
236 Ga0207689_10025884 3300025942 Bacteria 4914
237 Ga0207661_10172439 3300025944 Bacteria 1884
238 Ga0207661_10240621 3300025944 Bacteria 1606
239 Ga0207712_10326614 3300025961 Bacteria 1268
240 Ga0207640_10037081 3300025981 Bacteria 3065
241 Ga0207640_10087593 3300025981 Bacteria 2147
242 Ga0207639_10091602 3300026041 Bacteria 2434
243 Ga0207678_10004476 3300026067 Bacteria 12564
244 Ga0207678_10021969 3300026067 Bacteria 5593
245 Ga0207708_10128907 3300026075 Bacteria 1976
246 Ga0207702_10023801 3300026078 Bacteria 5081
247 Ga0207702_10081016 3300026078 Bacteria 2818
248 Ga0207702_10090137 3300026078 Bacteria 2683
249 Ga0207641_10922203 3300026088 Bacteria 868
250 Ga0207676_10467363 3300026095 Bacteria 1192
251 Ga0207676_10896175 3300026095 Bacteria 870
252 Ga0207674_10000753 3300026116 Bacteria 42280
253 Ga0207675_100121731 3300026118 Bacteria 2470
254 Ga0207683_10008049 3300026121 Bacteria 9013
255 Ga0207683_10311897 3300026121 Bacteria 1440
256 Ga0207698_10117086 3300026142 Bacteria 2247
257 Ga0207698_10632418 3300026142 Bacteria 1058
258 Ga0268266_10225877 3300028379 Bacteria 1723
259 Ga0268266_10248485 3300028379 Bacteria 1645
260 Ga0268265_11178797 3300028380 Bacteria 763
261 Ga0265336_10001832 3300028666 Bacteria 9257
262 Ga0265338_10002851 3300028800 Bacteria 25265
263 Ga0265770_1010893 3300030878 Unclassified 1326
264 Ga0307513_10001546 3300031456 Bacteria 32952
265 Ga0307513_10420902 3300031456 Bacteria 1066
266 Ga0307413_10337493 3300031824 Bacteria 1158
267 Ga0307409_101417515 3300031995 Bacteria 721
268 Ga0307409_101499527 3300031995 Bacteria 702
269 Ga0307414_10212280 3300032004 Bacteria 1583
270 Ga0316214_1003203 3300033545 Bacteria 2056
271 Ga0373930_0016153 3300034816 Bacteria 1409
272 Ga0373948_0023219 3300034817 Bacteria 1202
273 Ga0373948_0079454 3300034817 Bacteria 746
274 Ga0373950_0110196 3300034818 Bacteria 601
275 Ga0373938_0005876 3300034957 Bacteria 2102
276 Ga0373938_0033167 3300034957 Bacteria 1116
277 Ga0373926_0004437 3300035083 Bacteria 4602
278 Ga0373928_0008051 3300035084 Bacteria 2041
279 Ga0373929_0011720 3300035085 Bacteria 1656
280 Ga0373929_0025076 3300035085 Bacteria 1236
281 Ga0373934_0046027 3300035086 Bacteria 1725
282 Ga0373934_0057669 3300035086 Bacteria 1545
283 Ga0373934_0088587 3300035086 Bacteria 1246
284 Ga0373944_0000683 3300035089 Bacteria 8152
285 Ga0373951_0004816 3300035091 Bacteria 3178
286 Ga0373923_0002696 3300035111 Bacteria 5530
287 Ga0373932_0134907 3300035112 Bacteria 835
288 Ga0373936_0000485 3300035113 Bacteria 13452
289 Ga0373936_0008641 3300035113 Bacteria 3834
290 Ga0373936_0051787 3300035113 Bacteria 1662
291 Ga0373936_0104689 3300035113 Bacteria 1197
292 Ga0373936_0361491 3300035113 Bacteria 662
293 Ga0373939_0026969 3300035114 Bacteria 1624
294 Ga0373941_0020865 3300035115 Bacteria 1842
295 Ga0373941_0090433 3300035115 Bacteria 1049
296 Ga0373945_0001625 3300035116 Bacteria 6891
297 Ga0373945_0021555 3300035116 Bacteria 2214
298 Ga0373953_0032920 3300035117 Bacteria 2025
299 Ga0373953_0044793 3300035117 Bacteria 1770
300 Ga0373953_0081652 3300035117 Bacteria 1344
301 Ga0373954_0047903 3300035118 Bacteria 2001
302 Ga0373956_0033589 3300035119 Bacteria 2256
303 Ga0373956_0102325 3300035119 Bacteria 1329
304 Ga0373957_0015160 3300035120 Bacteria 2648
305 Ga0373957_0287301 3300035120 Bacteria 696
306 Ga0373960_0068368 3300035121 Bacteria 1093
307 Ga0373943_0000727 3300035170 Bacteria 14433
308 Ga0373943_0003240 3300035170 Bacteria 7383
309 Ga0373943_0068541 3300035170 Bacteria 1791
310 Ga0373946_0007407 3300035171 Bacteria 4011
311 Ga0373946_0010589 3300035171 Bacteria 3417
312 Ga0373946_0189440 3300035171 Bacteria 980
313 Ga0373955_0132913 3300035172 Bacteria 1454
314 Ga0373955_0151209 3300035172 Bacteria 1366
315 Ga0373924_0000149 3300035410 Bacteria 20536
316 Ga0373924_0010602 3300035410 Bacteria 3406
317 Ga0373924_0169323 3300035410 Bacteria 960
318 Ga0373924_0217381 3300035410 Bacteria 844
319 Ga0373931_0029916 3300035691 Bacteria 2800
320 Ga0373931_0049099 3300035691 Bacteria 2239
321 Ga0373935_0001103 3300035692 Bacteria 14736
322 Ga0373935_0007573 3300035692 Bacteria 6502
323 Ga0373935_0013185 3300035692 Bacteria 4983
324 Ga0373935_0021296 3300035692 Bacteria 3968
325 Ga0373935_0343110 3300035692 Bacteria 1063
326 Ga0373927_0002623 3300035695 Bacteria 13111
327 Ga0373927_0012837 3300035695 Bacteria 5571
328 Ga0373933_0001747 3300035724 Bacteria 12607
329 Ga0373933_0008088 3300035724 Bacteria 5739
330 Ga0373933_0039696 3300035724 Bacteria 2770
331 Ga0373947_0000003 3300035725 Bacteria 345338
332 Ga0373947_0001226 3300035725 Bacteria 15805
333 Ga0373947_0004858 3300035725 Bacteria 7855
334 Ga0373947_0034461 3300035725 Bacteria 2994
335 Ga0373937_0018561 3300036401 Bacteria 6213
336 Ga0373937_0027904 3300036401 Bacteria 5107
337 Ga0373937_0137202 3300036401 Bacteria 2287
338 Ga0373937_0192111 3300036401 Bacteria 1918
339 Ga0373937_0502716 3300036401 Bacteria 1152
340 Ga0372808_000908 3300036459 Bacteria 2766
341 Ga0310109_018425 3300036534 Unclassified 943
342 Ga0373925_0001846 3300037068 Bacteria 17627
343 Ga0373925_0011932 3300037068 Bacteria 6288
344 Ga0373925_0143964 3300037068 Bacteria 1867
345 Ga0373925_0179371 3300037068 Bacteria 1675
346 Ga0373925_0563150 3300037068 Bacteria 937
347 Ga0436364_0011144 3300037853 Bacteria 5566
348 Ga0436364_0871804 3300037853 Bacteria 6058
349 Ga0436364_1006127 3300037853 Bacteria 3102
350 Ga0436363_0776709 3300039450 Bacteria 743
351 Ga0436363_1357121 3300039450 Bacteria 4488
352 Ga0436362_0845838 3300039453 Bacteria 545
353 Ga0451849_0604238 3300041505 Bacteria 696
354 Ga0466963_0147263 3300044694 Bacteria 1634
355 Ga0466964_0028775 3300044706 Bacteria 2191
356 Ga0466959_0099868 3300045049 Bacteria 2078
357 Ga0466959_0690299 3300045049 Bacteria 684
358 Ga0466958_0220794 3300045836 Bacteria 1209
359 Ga0466967_0039255 3300045976 Bacteria 4068
360 Ga0466967_0078465 3300045976 Bacteria 2975
361 Ga0495592_0067251 3300046454 Bacteria 2619
362 Ga0495592_0207212 3300046454 Bacteria 1319
363 Ga0495603_0001384 3300046455 Bacteria 14074
364 Ga0495629_0060604 3300046459 Bacteria 2644
365 Ga0495629_0313156 3300046459 Bacteria 1074
366 Ga0495651_0006624 3300046462 Bacteria 8846
367 Ga0495651_0008458 3300046462 Bacteria 7886
368 Ga0495651_0053856 3300046462 Bacteria 3096
369 Ga0495653_0000860 3300046463 Bacteria 23415
370 Ga0495653_0001704 3300046463 Bacteria 17301
371 Ga0495653_0009010 3300046463 Bacteria 8161
372 Ga0495653_0019571 3300046463 Bacteria 5489
373 Ga0495580_0044897 3300046472 Bacteria 3141
374 Ga0495580_0778062 3300046472 Bacteria 622
375 Ga0495582_0000407 3300046473 Bacteria 23526
376 Ga0495582_0034197 3300046473 Bacteria 2794
377 Ga0495639_0000391 3300046475 Bacteria 20675
378 Ga0495639_0033585 3300046475 Bacteria 2291
379 Ga0495662_0000493 3300046476 Bacteria 17984
380 Ga0495662_0005884 3300046476 Bacteria 6133
381 Ga0495664_0002387 3300046477 Bacteria 10069
382 Ga0495664_0010848 3300046477 Bacteria 5122
383 Ga0495664_0213228 3300046477 Bacteria 1169
384 Ga0495594_0020198 3300046499 Bacteria 3547
385 Ga0495608_0016466 3300046511 Bacteria 5115
386 Ga0495618_0010578 3300046514 Bacteria 5583
387 Ga0495618_0016668 3300046514 Bacteria 4499
388 Ga0495618_0045350 3300046514 Bacteria 2773
389 Ga0495618_0250874 3300046514 Bacteria 1110
390 Ga0495628_0011251 3300046516 Bacteria 7572
391 Ga0495628_0045480 3300046516 Bacteria 3490
392 Ga0495628_0194297 3300046516 Bacteria 1531
393 Ga0495628_0210601 3300046516 Bacteria 1462
394 Ga0495630_0024109 3300046517 Bacteria 4499
395 Ga0495630_0154400 3300046517 Bacteria 1747
396 Ga0495666_0002579 3300046526 Bacteria 9013
397 Ga0495652_0002162 3300046529 Bacteria 20674
398 Ga0495652_0004111 3300046529 Bacteria 14043
399 Ga0495652_0089883 3300046529 Bacteria 2513
400 Ga0495652_0231837 3300046529 Bacteria 1380
401 Ga0495665_0000203 3300046531 Bacteria 30479
402 Ga0495665_0017134 3300046531 Bacteria 3897
403 Ga0495665_0227435 3300046531 Bacteria 964
404 Ga0495640_0000775 3300046533 Bacteria 24102
405 Ga0495640_0035189 3300046533 Bacteria 3545
406 Ga0495640_0060128 3300046533 Bacteria 2585
407 Ga0495586_0003951 3300046535 Bacteria 7958
408 Ga0495586_0343761 3300046535 Bacteria 856
409 Ga0495587_0024731 3300046536 Bacteria 3677
410 Ga0495587_0025861 3300046536 Bacteria 3583
411 Ga0495587_0083353 3300046536 Bacteria 1852
412 Ga0495587_0145785 3300046536 Bacteria 1350
413 Ga0495645_0002225 3300046543 Bacteria 13197
414 Ga0495645_0033031 3300046543 Bacteria 3775
415 Ga0495645_0227106 3300046543 Bacteria 1252
416 Ga0495645_0594651 3300046543 Bacteria 681
417 Ga0495622_0108705 3300046557 Bacteria 1270
418 Ga0495667_0000438 3300046559 Bacteria 26630
419 Ga0495667_0003068 3300046559 Bacteria 11207
420 Ga0495667_0013204 3300046559 Bacteria 5593
421 Ga0495634_0021968 3300046642 Bacteria 4500
422 Ga0495634_0174095 3300046642 Bacteria 1351
423 Ga0495635_0001463 3300046663 Bacteria 15789
424 Ga0495635_0012246 3300046663 Bacteria 6009
425 Ga0495588_0026823 3300046674 Bacteria 2877
426 Ga0495657_0001503 3300046675 Bacteria 20091
427 Ga0495657_0012738 3300046675 Bacteria 6236
428 Ga0495657_0014590 3300046675 Bacteria 5766
429 Ga0495657_0031213 3300046675 Bacteria 3725
430 Ga0495599_0012859 3300046678 Bacteria 5165
431 Ga0495599_0084989 3300046678 Bacteria 1976
432 Ga0495599_0134135 3300046678 Bacteria 1537
433 Ga0495599_0191664 3300046678 Bacteria 1257
434 Ga0495623_0021062 3300046679 Bacteria 4212
435 Ga0495623_0133953 3300046679 Bacteria 1480
436 Ga0495623_0142783 3300046679 Bacteria 1422
437 Ga0495646_0002110 3300046680 Bacteria 12063
438 Ga0495646_0015564 3300046680 Bacteria 4826
439 Ga0495646_0292504 3300046680 Bacteria 863
440 Ga0495658_0014557 3300046683 Bacteria 4022
441 Ga0495658_0238010 3300046683 Bacteria 1143
442 Ga0495613_0003348 3300046689 Bacteria 11979
443 Ga0495613_0557966 3300046689 Bacteria 766
444 Ga0495624_0013486 3300046690 Bacteria 5571
445 Ga0495624_0015402 3300046690 Bacteria 5163
446 Ga0495624_0601487 3300046690 Bacteria 655
447 Ga0495600_0024821 3300046809 Bacteria 3859
448 Ga0495600_0741528 3300046809 Bacteria 588
449 Ga0495581_0000558 3300047315 Bacteria 19300
450 Ga0495581_0083744 3300047315 Bacteria 1848
451 Ga0495604_0053376 3300047317 Bacteria 3124
452 Ga0495604_0093443 3300047317 Bacteria 2225
453 Ga0495674_0000802 3300047319 Bacteria 29886
454 Ga0495674_0011335 3300047319 Bacteria 8415
455 Ga0495674_0019380 3300047319 Bacteria 6314
456 Ga0495674_0025644 3300047319 Bacteria 5401
457 Ga0495674_0426360 3300047319 Bacteria 1068
458 Ga0495676_0021052 3300047321 Bacteria 5707
459 Ga0495676_0044476 3300047321 Bacteria 3624
460 Ga0495680_0004275 3300047322 Bacteria 13699
461 Ga0495680_0007158 3300047322 Bacteria 10278
462 Ga0495680_0018970 3300047322 Bacteria 5824
463 Ga0495675_0011986 3300047444 Bacteria 5450
464 Ga0495675_0022936 3300047444 Bacteria 3978
465 Ga0495675_0083184 3300047444 Bacteria 2015
466 Ga0495675_0448575 3300047444 Bacteria 746
467 Ga0495684_0002672 3300047471 Bacteria 14126
468 Ga0495684_0015029 3300047471 Bacteria 5961
469 Ga0495684_0027388 3300047471 Bacteria 4376
470 Ga0495593_0002039 3300047673 Bacteria 12048
471 Ga0495593_0015945 3300047673 Bacteria 4244
472 Ga0495602_0015587 3300048088 Bacteria 7665
473 Ga0495602_0021484 3300048088 Bacteria 6351
474 Ga0495602_0033234 3300048088 Bacteria 4842
475 Ga0495602_0567336 3300048088 Bacteria 784
476 Ga0495602_0691413 3300048088 Bacteria 693
477 Ga0495614_0004672 3300048089 Bacteria 6171
478 Ga0496100_0269563 3300048903 Bacteria 1265
479 Ga0496100_0464663 3300048903 Bacteria 971
480 Ga0496101_0206076 3300048904 Bacteria 1522
481 Ga0496101_0301856 3300048904 Bacteria 1254
482 Ga0496101_0322407 3300048904 Bacteria 1212
483 Ga0496102_0038007 3300048905 Bacteria 4342
484 Ga0496102_0149392 3300048905 Bacteria 2195
485 Ga0496104_0005096 3300048907 Bacteria 11465
486 Ga0496104_0051267 3300048907 Bacteria 3895
487 Ga0496104_0090332 3300048907 Bacteria 2926
488 Ga0496104_0121879 3300048907 Bacteria 2503
489 Ga0496104_0316545 3300048907 Bacteria 1473
490 Ga0496104_0389303 3300048907 Bacteria 1306
491 Ga0496104_0532498 3300048907 Bacteria 1086
492 Ga0496105_0020894 3300048908 Bacteria 5294
493 Ga0496105_0035872 3300048908 Bacteria 4084
494 Ga0496105_0267089 3300048908 Bacteria 1382
495 Ga0496105_0360126 3300048908 Bacteria 1160
496 Ga0496105_0399877 3300048908 Bacteria 1090
497 Ga0496105_0525905 3300048908 Bacteria 926
498 Ga0496106_0049792 3300048909 Bacteria 3157
499 Ga0496107_0134612 3300048910 Bacteria 1826
500 Ga0496107_0449392 3300048910 Bacteria 957
501 Ga0496108_0083473 3300048911 Bacteria 2710
502 Ga0496108_0105849 3300048911 Bacteria 2402
503 Ga0496108_0116442 3300048911 Bacteria 2289
504 Ga0496108_0132480 3300048911 Bacteria 2142
505 Ga0496109_0064709 3300048912 Bacteria 3346
506 Ga0496109_0126985 3300048912 Bacteria 2378
507 Ga0496109_0296510 3300048912 Bacteria 1524
508 Ga0496109_0440299 3300048912 Unclassified 1231
509 Ga0496109_1199885 3300048912 Bacteria 695
510 Ga0496110_0139997 3300048913 Bacteria 2187
511 Ga0496110_0206902 3300048913 Bacteria 1783
512 Ga0496110_0414277 3300048913 Bacteria 1228
513 Ga0496110_0493055 3300048913 Bacteria 1116
514 Ga0496110_0915181 3300048913 Bacteria 783
515 Ga0496111_0355233 3300048914 Bacteria 1085
516 Ga0496111_0575614 3300048914 Bacteria 825
517 Ga0496112_0037816 3300048915 Bacteria 4712
518 Ga0496112_0179302 3300048915 Bacteria 2082
519 Ga0496112_0397218 3300048915 Bacteria 1318
520 Ga0496112_0663093 3300048915 Bacteria 972
521 Ga0496112_0850049 3300048915 Bacteria 836
522 Ga0496112_1435255 3300048915 Bacteria 604
523 Ga0496113_0093470 3300048916 Bacteria 2321
524 Ga0496113_0363895 3300048916 Bacteria 1160
525 Ga0496114_0007721 3300048917 Bacteria 8509
526 Ga0496114_0114375 3300048917 Bacteria 2314
527 Ga0496114_0239038 3300048917 Bacteria 1597
528 Ga0496114_0416722 3300048917 Bacteria 1189
529 Ga0496114_0710817 3300048917 Bacteria 881
530 Ga0496115_0034348 3300048918 Bacteria 4008
531 Ga0496115_0067897 3300048918 Bacteria 2885
532 Ga0496115_0163963 3300048918 Bacteria 1838
533 Ga0496115_0254671 3300048918 Bacteria 1444
534 Ga0496115_0332316 3300048918 Bacteria 1241
535 Ga0496119_0038268 3300048922 Bacteria 3103
536 Ga0496126_0637055 3300048929 Bacteria 836
537 Ga0501036_0012559 3300049572 Bacteria 7025
538 Ga0501038_0919970 3300049574 Bacteria 645
539 Ga0501039_0013828 3300049575 Bacteria 6176
540 Ga0501040_0317184 3300049576 Bacteria 1115
541 Ga0501041_0032760 3300049577 Bacteria 3141
542 Ga0501048_0042854 3300049582 Bacteria 3240
543 Ga0501048_0852785 3300049582 Bacteria 655
544 Ga0501071_0357447 3300049587 Bacteria 1112
545 Ga0501072_0033213 3300049588 Bacteria 4043
546 Ga0501072_0531112 3300049588 Bacteria 930
547 Ga0501074_0185713 3300049590 Bacteria 1482
548 Ga0501075_0187548 3300049591 Bacteria 1577
549 Ga0501076_0021383 3300049592 Bacteria 4962
550 Ga0501077_0073512 3300049593 Bacteria 2166
551 Ga0501079_0037041 3300049741 Bacteria 3758
552 Ga0501083_0083673 3300049744 Bacteria 2114
553 Ga0501035_0349071 3300049822 Bacteria 1238
554 Ga0501045_0019154 3300049824 Bacteria 4875
555 nmdc:mga05p37_52911_c1 3300050507 Bacteria 4994
556 nmdc:mga09592_76809_c1 3300050508 Bacteria 2841
557 nmdc:mga0qj67_263500_c1 3300050509 Bacteria 1398
558 nmdc:mga06r32_422800_c1 3300050510 Bacteria 1314
559 nmdc:mga0n895_85576_c1 3300050512 Bacteria 3148
560 nmdc:mga08x19_101779_c1 3300050514 Bacteria 1907
561 nmdc:mga08x19_454042_c1 3300050514 Bacteria 902
562 Ga0495601_0024576 3300053077 Bacteria 3711
563 Ga0495601_0163482 3300053077 Bacteria 1455
564 Ga0495601_0504979 3300053077 Bacteria 780
565 Ga0495612_0061681 3300053078 Bacteria 1553
566 Ga0495612_0084120 3300053078 Bacteria 1340
567 Ga0495595_0017261 3300053084 Bacteria 3105
568 Ga0500616_0000144 3300053153 Bacteria 121889
569 Ga0501084_0187740 3300054114 Bacteria 1744
570 Ga0501082_0123193 3300060353 Bacteria 2248
571 Ga0501082_0360661 3300060353 Bacteria 1268

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300021377 Ga0213874_10048771 Ga0213874_100487712 140
2 3300039450 Ga0436363_1357121 Ga0436363_1357121_919_1440 140
3 3300037853 Ga0436364_0011144 Ga0436364_0011144_4383_4841 149
4 3300039453 Ga0436362_0845838 Ga0436362_0845838_21_479 149
5 3300045049 Ga0466959_0690299 Ga0466959_0690299_155_613 152
6 3300049587 Ga0501071_0357447 Ga0501071_0357447_15_473 152
7 3300005435 Ga0070714_100048325 Ga0070714_1000483253 161
8 3300005467 Ga0070706_100043355 Ga0070706_1000433552 163
9 3300005536 Ga0070697_100001583 Ga0070697_1000015836 163
10 3300025910 Ga0207684_10085769 Ga0207684_100857694 163
11 3300035410 Ga0373924_0169323 Ga0373924_0169323_127_636 163
12 3300050507 nmdc:mga05p37_52911_c1 nmdc:mga05p37_52911_c1_2989_3480 163
13 3300050508 nmdc:mga09592_76809_c1 nmdc:mga09592_76809_c1_225_716 163
14 3300050510 nmdc:mga06r32_422800_c1 nmdc:mga06r32_422800_c1_522_1013 163
15 iso_pu_bacteria 2880489317 2880491246 164
16 iso_pu_bacteria 8001781756 8001790339 165
17 3300020069 Ga0197907_11237433 Ga0197907_112374331 166
18 3300020076 Ga0206355_1042905 Ga0206355_10429051 166
19 3300021388 Ga0213875_10001784 Ga0213875_100017846 166
20 3300021388 Ga0213875_10258731 Ga0213875_102587312 166
21 3300037853 Ga0436364_0871804 Ga0436364_0871804_1869_2408 166
22 3300037853 Ga0436364_1006127 Ga0436364_1006127_2499_3032 166
23 3300005436 Ga0070713_100573424 Ga0070713_1005734242 167
24 3300006175 Ga0070712_100613227 Ga0070712_1006132271 167
25 3300006847 Ga0075431_100672683 Ga0075431_1006726831 167
26 3300009545 Ga0105237_10275373 Ga0105237_102753732 167
27 3300025928 Ga0207700_10627367 Ga0207700_106273672 167
28 3300030878 Ga0265770_1010893 Ga0265770_10108932 167
29 3300035113 Ga0373936_0104689 Ga0373936_0104689_127_630 167
30 3300035410 Ga0373924_0217381 Ga0373924_0217381_42_545 167
31 3300035692 Ga0373935_0021296 Ga0373935_0021296_3015_3518 167
32 3300037068 Ga0373925_0143964 Ga0373925_0143964_166_669 167
33 3300046477 Ga0495664_0010848 Ga0495664_0010848_3426_3929 167
34 3300046514 Ga0495618_0045350 Ga0495618_0045350_333_836 167
35 3300046516 Ga0495628_0194297 Ga0495628_0194297_617_1120 167
36 3300046531 Ga0495665_0227435 Ga0495665_0227435_246_749 167
37 3300046533 Ga0495640_0060128 Ga0495640_0060128_1224_1727 167
38 3300046535 Ga0495586_0343761 Ga0495586_0343761_96_599 167
39 3300046543 Ga0495645_0227106 Ga0495645_0227106_538_1041 167
40 3300046642 Ga0495634_0174095 Ga0495634_0174095_107_610 167
41 3300046678 Ga0495599_0084989 Ga0495599_0084989_906_1409 167
42 3300046680 Ga0495646_0292504 Ga0495646_0292504_100_603 167
43 3300047319 Ga0495674_0025644 Ga0495674_0025644_1242_1745 167
44 3300048088 Ga0495602_0691413 Ga0495602_0691413_145_648 167
45 3300048905 Ga0496102_0038007 Ga0496102_0038007_2717_3220 167
46 3300049572 Ga0501036_0012559 Ga0501036_0012559_2113_2616 167
47 3300049575 Ga0501039_0013828 Ga0501039_0013828_2112_2615 167
48 3300049577 Ga0501041_0032760 Ga0501041_0032760_697_1200 167
49 3300049582 Ga0501048_0042854 Ga0501048_0042854_2220_2723 167
50 3300049588 Ga0501072_0033213 Ga0501072_0033213_2425_2928 167
51 3300049590 Ga0501074_0185713 Ga0501074_0185713_661_1164 167
52 3300049591 Ga0501075_0187548 Ga0501075_0187548_470_973 167
53 3300049592 Ga0501076_0021383 Ga0501076_0021383_2812_3315 167
54 3300049593 Ga0501077_0073512 Ga0501077_0073512_1638_2141 167
55 3300049741 Ga0501079_0037041 Ga0501079_0037041_2805_3308 167
56 3300049744 Ga0501083_0083673 Ga0501083_0083673_866_1369 167
57 3300049822 Ga0501035_0349071 Ga0501035_0349071_384_887 167
58 3300049824 Ga0501045_0019154 Ga0501045_0019154_3901_4404 167
59 3300054114 Ga0501084_0187740 Ga0501084_0187740_781_1284 167
60 3300060353 Ga0501082_0123193 Ga0501082_0123193_595_1098 167
61 3300005458 Ga0070681_10466905 Ga0070681_104669052 168
62 3300031824 Ga0307413_10337493 Ga0307413_103374932 168
63 3300031995 Ga0307409_101499527 Ga0307409_1014995271 168
64 3300049574 Ga0501038_0919970 Ga0501038_0919970_71_583 168
65 3300049576 Ga0501040_0317184 Ga0501040_0317184_442_954 168
66 3300003659 JGI25404J52841_10029025 JGI25404J52841_100290251 169
67 3300005327 Ga0070658_10141021 Ga0070658_101410212 169
68 3300005329 Ga0070683_100014040 Ga0070683_1000140404 169
69 3300005329 Ga0070683_100360737 Ga0070683_1003607371 169
70 3300005336 Ga0070680_100015620 Ga0070680_1000156203 169
71 3300005338 Ga0068868_100393585 Ga0068868_1003935851 169
72 3300005339 Ga0070660_100199279 Ga0070660_1001992792 169
73 3300005341 Ga0070691_10268898 Ga0070691_102688982 169
74 3300005343 Ga0070687_100147428 Ga0070687_1001474282 169
75 3300005344 Ga0070661_100848816 Ga0070661_1008488161 169
76 3300005344 Ga0070661_100868193 Ga0070661_1008681932 169
77 3300005345 Ga0070692_10190736 Ga0070692_101907361 169
78 3300005347 Ga0070668_100233078 Ga0070668_1002330782 169
79 3300005355 Ga0070671_100137337 Ga0070671_1001373371 169
80 3300005355 Ga0070671_100815066 Ga0070671_1008150661 169
81 3300005355 Ga0070671_101067202 Ga0070671_1010672021 169
82 3300005356 Ga0070674_101039394 Ga0070674_1010393941 169
83 3300005366 Ga0070659_100029115 Ga0070659_1000291153 169
84 3300005367 Ga0070667_100877264 Ga0070667_1008772641 169
85 3300005367 Ga0070667_101112811 Ga0070667_1011128111 169
86 3300005434 Ga0070709_10064337 Ga0070709_100643372 169
87 3300005434 Ga0070709_10064802 Ga0070709_100648023 169
88 3300005435 Ga0070714_100219311 Ga0070714_1002193112 169
89 3300005435 Ga0070714_100613556 Ga0070714_1006135562 169
90 3300005435 Ga0070714_100945510 Ga0070714_1009455101 169
91 3300005436 Ga0070713_100134735 Ga0070713_1001347352 169
92 3300005436 Ga0070713_100332697 Ga0070713_1003326972 169
93 3300005436 Ga0070713_100363345 Ga0070713_1003633452 169
94 3300005436 Ga0070713_100448460 Ga0070713_1004484602 169
95 3300005436 Ga0070713_100574162 Ga0070713_1005741621 169
96 3300005437 Ga0070710_10155331 Ga0070710_101553312 169
97 3300005437 Ga0070710_10176595 Ga0070710_101765952 169
98 3300005437 Ga0070710_10192509 Ga0070710_101925092 169
99 3300005437 Ga0070710_10230833 Ga0070710_102308332 169
100 3300005439 Ga0070711_100067353 Ga0070711_1000673532 169
101 3300005439 Ga0070711_100211157 Ga0070711_1002111571 169
102 3300005439 Ga0070711_100475244 Ga0070711_1004752442 169
103 3300005439 Ga0070711_100827660 Ga0070711_1008276602 169
104 3300005444 Ga0070694_100269354 Ga0070694_1002693542 169
105 3300005445 Ga0070708_100032331 Ga0070708_1000323315 169
106 3300005445 Ga0070708_100033055 Ga0070708_1000330553 169
107 3300005445 Ga0070708_100085548 Ga0070708_1000855483 169
108 3300005445 Ga0070708_100137595 Ga0070708_1001375952 169
109 3300005455 Ga0070663_100014876 Ga0070663_1000148765 169
110 3300005458 Ga0070681_10339299 Ga0070681_103392991 169
111 3300005466 Ga0070685_10128377 Ga0070685_101283772 169
112 3300005467 Ga0070706_100048227 Ga0070706_1000482273 169
113 3300005467 Ga0070706_100050251 Ga0070706_1000502512 169
114 3300005467 Ga0070706_100065671 Ga0070706_1000656714 169
115 3300005467 Ga0070706_100069289 Ga0070706_1000692892 169
116 3300005468 Ga0070707_100169391 Ga0070707_1001693912 169
117 3300005468 Ga0070707_100404443 Ga0070707_1004044432 169
118 3300005468 Ga0070707_100507796 Ga0070707_1005077962 169
119 3300005468 Ga0070707_101442947 Ga0070707_1014429471 169
120 3300005471 Ga0070698_100003440 Ga0070698_10000344010 169
121 3300005471 Ga0070698_100004116 Ga0070698_10000411610 169
122 3300005471 Ga0070698_100135372 Ga0070698_1001353723 169
123 3300005471 Ga0070698_100794875 Ga0070698_1007948752 169
124 3300005518 Ga0070699_100003864 Ga0070699_1000038643 169
125 3300005518 Ga0070699_100243621 Ga0070699_1002436213 169
126 3300005530 Ga0070679_100256115 Ga0070679_1002561152 169
127 3300005530 Ga0070679_101053203 Ga0070679_1010532031 169
128 3300005535 Ga0070684_100018443 Ga0070684_1000184435 169
129 3300005535 Ga0070684_100261701 Ga0070684_1002617012 169
130 3300005535 Ga0070684_100502606 Ga0070684_1005026062 169
131 3300005539 Ga0068853_100061610 Ga0068853_1000616104 169
132 3300005545 Ga0070695_100271032 Ga0070695_1002710322 169
133 3300005546 Ga0070696_100069953 Ga0070696_1000699533 169
134 3300005547 Ga0070693_100070759 Ga0070693_1000707593 169
135 3300005547 Ga0070693_100121064 Ga0070693_1001210643 169
136 3300005548 Ga0070665_100551477 Ga0070665_1005514772 169
137 3300005563 Ga0068855_101192413 Ga0068855_1011924131 169
138 3300005564 Ga0070664_100036667 Ga0070664_1000366674 169
139 3300005564 Ga0070664_100238486 Ga0070664_1002384862 169
140 3300005577 Ga0068857_100306938 Ga0068857_1003069381 169
141 3300005614 Ga0068856_100031132 Ga0068856_1000311326 169
142 3300005614 Ga0068856_100304210 Ga0068856_1003042102 169
143 3300005615 Ga0070702_100004107 Ga0070702_1000041074 169
144 3300005616 Ga0068852_100017952 Ga0068852_1000179525 169
145 3300005616 Ga0068852_100213025 Ga0068852_1002130252 169
146 3300005616 Ga0068852_100295380 Ga0068852_1002953802 169
147 3300005617 Ga0068859_100037750 Ga0068859_1000377503 169
148 3300005618 Ga0068864_100428941 Ga0068864_1004289412 169
149 3300005618 Ga0068864_100520220 Ga0068864_1005202202 169
150 3300005718 Ga0068866_10054001 Ga0068866_100540013 169
151 3300005719 Ga0068861_100734528 Ga0068861_1007345281 169
152 3300005841 Ga0068863_100244492 Ga0068863_1002444922 169
153 3300005842 Ga0068858_100807146 Ga0068858_1008071462 169
154 3300005842 Ga0068858_101084167 Ga0068858_1010841672 169
155 3300005843 Ga0068860_100758139 Ga0068860_1007581392 169
156 3300005844 Ga0068862_100717693 Ga0068862_1007176932 169
157 3300005983 Ga0081540_1013958 Ga0081540_10139584 169
158 3300006028 Ga0070717_10002454 Ga0070717_100024546 169
159 3300006028 Ga0070717_10017942 Ga0070717_100179423 169
160 3300006028 Ga0070717_10077573 Ga0070717_100775733 169
161 3300006028 Ga0070717_10277541 Ga0070717_102775412 169
162 3300006028 Ga0070717_10333918 Ga0070717_103339182 169
163 3300006058 Ga0075432_10080755 Ga0075432_100807552 169
164 3300006163 Ga0070715_10006414 Ga0070715_100064143 169
165 3300006163 Ga0070715_10098656 Ga0070715_100986562 169
166 3300006163 Ga0070715_10146180 Ga0070715_101461802 169
167 3300006173 Ga0070716_100004600 Ga0070716_1000046005 169
168 3300006173 Ga0070716_100025592 Ga0070716_1000255922 169
169 3300006173 Ga0070716_100165794 Ga0070716_1001657942 169
170 3300006173 Ga0070716_100284580 Ga0070716_1002845802 169
171 3300006175 Ga0070712_100078412 Ga0070712_1000784121 169
172 3300006175 Ga0070712_100275958 Ga0070712_1002759582 169
173 3300006175 Ga0070712_100499431 Ga0070712_1004994311 169
174 3300006237 Ga0097621_100033364 Ga0097621_1000333642 169
175 3300006358 Ga0068871_100095092 Ga0068871_1000950922 169
176 3300006871 Ga0075434_100168309 Ga0075434_1001683092 169
177 3300006871 Ga0075434_101147512 Ga0075434_1011475122 169
178 3300006881 Ga0068865_100399390 Ga0068865_1003993902 169
179 3300006914 Ga0075436_100253587 Ga0075436_1002535872 169
180 3300006914 Ga0075436_100369745 Ga0075436_1003697452 169
181 3300006931 Ga0097620_100037749 Ga0097620_1000377493 169
182 3300007076 Ga0075435_101247758 Ga0075435_1012477582 169
183 3300009011 Ga0105251_10067796 Ga0105251_100677962 169
184 3300009098 Ga0105245_10298348 Ga0105245_102983482 169
185 3300009098 Ga0105245_10392014 Ga0105245_103920142 169
186 3300009101 Ga0105247_10565517 Ga0105247_105655172 169
187 3300009101 Ga0105247_10648530 Ga0105247_106485302 169
188 3300009148 Ga0105243_10266900 Ga0105243_102669002 169
189 3300009174 Ga0105241_10126691 Ga0105241_101266912 169
190 3300009174 Ga0105241_10555710 Ga0105241_105557101 169
191 3300009176 Ga0105242_10037586 Ga0105242_100375862 169
192 3300009176 Ga0105242_12114280 Ga0105242_121142801 169
193 3300009177 Ga0105248_10067129 Ga0105248_100671295 169
194 3300009177 Ga0105248_11107872 Ga0105248_111078722 169
195 3300009177 Ga0105248_12023076 Ga0105248_120230762 169
196 3300009545 Ga0105237_10421629 Ga0105237_104216291 169
197 3300009551 Ga0105238_10478866 Ga0105238_104788662 169
198 3300009553 Ga0105249_10413527 Ga0105249_104135272 169
199 3300010159 Ga0099796_10158825 Ga0099796_101588252 169
200 3300011119 Ga0105246_12209923 Ga0105246_122099231 169
201 3300012505 Ga0157339_1019463 Ga0157339_10194632 169
202 3300012515 Ga0157338_1014245 Ga0157338_10142451 169
203 3300013100 Ga0157373_10050968 Ga0157373_100509683 169
204 3300013102 Ga0157371_10040204 Ga0157371_100402042 169
205 3300013104 Ga0157370_10684455 Ga0157370_106844552 169
206 3300013104 Ga0157370_10787676 Ga0157370_107876762 169
207 3300013105 Ga0157369_10711836 Ga0157369_107118362 169
208 3300013105 Ga0157369_10749161 Ga0157369_107491612 169
209 3300013296 Ga0157374_10796910 Ga0157374_107969102 169
210 3300013297 Ga0157378_10294788 Ga0157378_102947882 169
211 3300013306 Ga0163162_10200659 Ga0163162_102006592 169
212 3300013308 Ga0157375_10020740 Ga0157375_100207402 169
213 3300013308 Ga0157375_10156132 Ga0157375_101561323 169
214 3300014325 Ga0163163_10004668 Ga0163163_1000466813 169
215 3300014325 Ga0163163_10228230 Ga0163163_102282302 169
216 3300014325 Ga0163163_10476624 Ga0163163_104766242 169
217 3300014325 Ga0163163_10810195 Ga0163163_108101952 169
218 3300014745 Ga0157377_10375734 Ga0157377_103757341 169
219 3300014745 Ga0157377_10444227 Ga0157377_104442271 169
220 3300014968 Ga0157379_10917237 Ga0157379_109172371 169
221 3300020081 Ga0206354_10964236 Ga0206354_109642363 169
222 3300020082 Ga0206353_10002787 Ga0206353_100027872 169
223 3300020082 Ga0206353_10271275 Ga0206353_102712752 169
224 3300025885 Ga0207653_10059550 Ga0207653_100595502 169
225 3300025898 Ga0207692_10005120 Ga0207692_100051205 169
226 3300025898 Ga0207692_10014198 Ga0207692_100141984 169
227 3300025898 Ga0207692_10044866 Ga0207692_100448662 169
228 3300025898 Ga0207692_10467519 Ga0207692_104675192 169
229 3300025899 Ga0207642_10021730 Ga0207642_100217303 169
230 3300025900 Ga0207710_10289506 Ga0207710_102895061 169
231 3300025901 Ga0207688_10002720 Ga0207688_100027203 169
232 3300025903 Ga0207680_10741171 Ga0207680_107411711 169
233 3300025905 Ga0207685_10005240 Ga0207685_100052403 169
234 3300025905 Ga0207685_10008491 Ga0207685_100084914 169
235 3300025905 Ga0207685_10040776 Ga0207685_100407762 169
236 3300025906 Ga0207699_10016549 Ga0207699_100165492 169
237 3300025906 Ga0207699_10108480 Ga0207699_101084802 169
238 3300025906 Ga0207699_10115967 Ga0207699_101159672 169
239 3300025906 Ga0207699_10182037 Ga0207699_101820372 169
240 3300025908 Ga0207643_10008137 Ga0207643_100081375 169
241 3300025909 Ga0207705_10354696 Ga0207705_103546962 169
242 3300025910 Ga0207684_10001773 Ga0207684_1000177310 169
243 3300025910 Ga0207684_10058486 Ga0207684_100584863 169
244 3300025910 Ga0207684_10070134 Ga0207684_100701343 169
245 3300025911 Ga0207654_10074522 Ga0207654_100745222 169
246 3300025912 Ga0207707_10417777 Ga0207707_104177771 169
247 3300025915 Ga0207693_10026332 Ga0207693_100263325 169
248 3300025915 Ga0207693_10032835 Ga0207693_100328353 169
249 3300025915 Ga0207693_10040765 Ga0207693_100407654 169
250 3300025915 Ga0207693_10436823 Ga0207693_104368232 169
251 3300025916 Ga0207663_10008970 Ga0207663_100089702 169
252 3300025916 Ga0207663_10016125 Ga0207663_100161254 169
253 3300025916 Ga0207663_10095512 Ga0207663_100955122 169
254 3300025916 Ga0207663_10198142 Ga0207663_101981422 169
255 3300025916 Ga0207663_10359590 Ga0207663_103595902 169
256 3300025917 Ga0207660_10578311 Ga0207660_105783112 169
257 3300025918 Ga0207662_10005891 Ga0207662_100058918 169
258 3300025919 Ga0207657_10070890 Ga0207657_100708902 169
259 3300025920 Ga0207649_10190254 Ga0207649_101902541 169
260 3300025922 Ga0207646_10045854 Ga0207646_100458545 169
261 3300025922 Ga0207646_10114269 Ga0207646_101142693 169
262 3300025926 Ga0207659_10105918 Ga0207659_101059182 169
263 3300025928 Ga0207700_10005860 Ga0207700_100058608 169
264 3300025928 Ga0207700_10012586 Ga0207700_100125866 169
265 3300025928 Ga0207700_10024290 Ga0207700_100242902 169
266 3300025928 Ga0207700_10108621 Ga0207700_101086213 169
267 3300025928 Ga0207700_10374894 Ga0207700_103748942 169
268 3300025929 Ga0207664_10011699 Ga0207664_100116993 169
269 3300025929 Ga0207664_10022469 Ga0207664_100224695 169
270 3300025929 Ga0207664_10047453 Ga0207664_100474534 169
271 3300025929 Ga0207664_10282248 Ga0207664_102822482 169
272 3300025929 Ga0207664_10303435 Ga0207664_103034352 169
273 3300025929 Ga0207664_10359748 Ga0207664_103597482 169
274 3300025929 Ga0207664_10587846 Ga0207664_105878462 169
275 3300025929 Ga0207664_11070873 Ga0207664_110708732 169
276 3300025929 Ga0207664_11273954 Ga0207664_112739541 169
277 3300025931 Ga0207644_10285662 Ga0207644_102856622 169
278 3300025932 Ga0207690_10328943 Ga0207690_103289432 169
279 3300025933 Ga0207706_10168201 Ga0207706_101682011 169
280 3300025935 Ga0207709_10084292 Ga0207709_100842922 169
281 3300025935 Ga0207709_10192254 Ga0207709_101922542 169
282 3300025939 Ga0207665_10006379 Ga0207665_100063797 169
283 3300025939 Ga0207665_10010961 Ga0207665_100109617 169
284 3300025939 Ga0207665_10013444 Ga0207665_100134444 169
285 3300025939 Ga0207665_10145507 Ga0207665_101455072 169
286 3300025942 Ga0207689_10025884 Ga0207689_100258845 169
287 3300025944 Ga0207661_10172439 Ga0207661_101724392 169
288 3300025944 Ga0207661_10240621 Ga0207661_102406212 169
289 3300025961 Ga0207712_10326614 Ga0207712_103266143 169
290 3300025981 Ga0207640_10037081 Ga0207640_100370814 169
291 3300025981 Ga0207640_10087593 Ga0207640_100875931 169
292 3300026041 Ga0207639_10091602 Ga0207639_100916021 169
293 3300026067 Ga0207678_10004476 Ga0207678_100044768 169
294 3300026067 Ga0207678_10021969 Ga0207678_100219694 169
295 3300026075 Ga0207708_10128907 Ga0207708_101289071 169
296 3300026078 Ga0207702_10023801 Ga0207702_100238015 169
297 3300026078 Ga0207702_10081016 Ga0207702_100810161 169
298 3300026078 Ga0207702_10090137 Ga0207702_100901374 169
299 3300026088 Ga0207641_10922203 Ga0207641_109222031 169
300 3300026095 Ga0207676_10467363 Ga0207676_104673632 169
301 3300026095 Ga0207676_10896175 Ga0207676_108961752 169
302 3300026116 Ga0207674_10000753 Ga0207674_1000075313 169
303 3300026118 Ga0207675_100121731 Ga0207675_1001217314 169
304 3300026121 Ga0207683_10008049 Ga0207683_100080495 169
305 3300026121 Ga0207683_10311897 Ga0207683_103118972 169
306 3300026142 Ga0207698_10117086 Ga0207698_101170862 169
307 3300026142 Ga0207698_10632418 Ga0207698_106324182 169
308 3300028379 Ga0268266_10225877 Ga0268266_102258773 169
309 3300028379 Ga0268266_10248485 Ga0268266_102484853 169
310 3300028380 Ga0268265_11178797 Ga0268265_111787972 169
311 3300028666 Ga0265336_10001832 Ga0265336_100018322 169
312 3300028800 Ga0265338_10002851 Ga0265338_1000285133 169
313 3300031456 Ga0307513_10001546 Ga0307513_1000154635 169
314 3300031456 Ga0307513_10420902 Ga0307513_104209022 169
315 3300031995 Ga0307409_101417515 Ga0307409_1014175152 169
316 3300032004 Ga0307414_10212280 Ga0307414_102122801 169
317 3300033545 Ga0316214_1003203 Ga0316214_10032032 169
318 3300034816 Ga0373930_0016153 Ga0373930_0016153_251_769 169
319 3300034817 Ga0373948_0023219 Ga0373948_0023219_325_843 169
320 3300034817 Ga0373948_0079454 Ga0373948_0079454_42_551 169
321 3300034818 Ga0373950_0110196 Ga0373950_0110196_47_556 169
322 3300034957 Ga0373938_0005876 Ga0373938_0005876_1093_1602 169
323 3300034957 Ga0373938_0033167 Ga0373938_0033167_392_910 169
324 3300035083 Ga0373926_0004437 Ga0373926_0004437_1657_2175 169
325 3300035084 Ga0373928_0008051 Ga0373928_0008051_718_1227 169
326 3300035085 Ga0373929_0011720 Ga0373929_0011720_673_1182 169
327 3300035085 Ga0373929_0025076 Ga0373929_0025076_431_949 169
328 3300035086 Ga0373934_0046027 Ga0373934_0046027_904_1422 169
329 3300035086 Ga0373934_0057669 Ga0373934_0057669_88_597 169
330 3300035086 Ga0373934_0088587 Ga0373934_0088587_159_668 169
331 3300035089 Ga0373944_0000683 Ga0373944_0000683_2949_3467 169
332 3300035091 Ga0373951_0004816 Ga0373951_0004816_2198_2716 169
333 3300035111 Ga0373923_0002696 Ga0373923_0002696_2003_2521 169
334 3300035112 Ga0373932_0134907 Ga0373932_0134907_65_583 169
335 3300035113 Ga0373936_0000485 Ga0373936_0000485_11087_11605 169
336 3300035113 Ga0373936_0008641 Ga0373936_0008641_2054_2572 169
337 3300035113 Ga0373936_0051787 Ga0373936_0051787_254_772 169
338 3300035113 Ga0373936_0361491 Ga0373936_0361491_105_623 169
339 3300035114 Ga0373939_0026969 Ga0373939_0026969_493_1011 169
340 3300035115 Ga0373941_0020865 Ga0373941_0020865_43_552 169
341 3300035115 Ga0373941_0090433 Ga0373941_0090433_398_916 169
342 3300035116 Ga0373945_0001625 Ga0373945_0001625_2579_3097 169
343 3300035116 Ga0373945_0021555 Ga0373945_0021555_1018_1536 169
344 3300035117 Ga0373953_0032920 Ga0373953_0032920_60_569 169
345 3300035117 Ga0373953_0044793 Ga0373953_0044793_214_732 169
346 3300035117 Ga0373953_0081652 Ga0373953_0081652_721_1230 169
347 3300035118 Ga0373954_0047903 Ga0373954_0047903_513_1031 169
348 3300035119 Ga0373956_0033589 Ga0373956_0033589_151_660 169
349 3300035119 Ga0373956_0102325 Ga0373956_0102325_622_1140 169
350 3300035120 Ga0373957_0015160 Ga0373957_0015160_930_1448 169
351 3300035120 Ga0373957_0287301 Ga0373957_0287301_35_544 169
352 3300035121 Ga0373960_0068368 Ga0373960_0068368_542_1051 169
353 3300035170 Ga0373943_0000727 Ga0373943_0000727_11456_11974 169
354 3300035170 Ga0373943_0003240 Ga0373943_0003240_570_1088 169
355 3300035170 Ga0373943_0068541 Ga0373943_0068541_765_1283 169
356 3300035171 Ga0373946_0007407 Ga0373946_0007407_159_677 169
357 3300035171 Ga0373946_0010589 Ga0373946_0010589_1859_2377 169
358 3300035171 Ga0373946_0189440 Ga0373946_0189440_141_659 169
359 3300035172 Ga0373955_0132913 Ga0373955_0132913_192_701 169
360 3300035172 Ga0373955_0151209 Ga0373955_0151209_184_693 169
361 3300035410 Ga0373924_0000149 Ga0373924_0000149_10459_10977 169
362 3300035410 Ga0373924_0010602 Ga0373924_0010602_2192_2710 169
363 3300035691 Ga0373931_0029916 Ga0373931_0029916_1122_1631 169
364 3300035691 Ga0373931_0049099 Ga0373931_0049099_80_598 169
365 3300035692 Ga0373935_0001103 Ga0373935_0001103_317_835 169
366 3300035692 Ga0373935_0007573 Ga0373935_0007573_5248_5757 169
367 3300035692 Ga0373935_0013185 Ga0373935_0013185_1886_2404 169
368 3300035692 Ga0373935_0343110 Ga0373935_0343110_277_795 169
369 3300035695 Ga0373927_0002623 Ga0373927_0002623_6959_7477 169
370 3300035695 Ga0373927_0012837 Ga0373927_0012837_3881_4399 169
371 3300035724 Ga0373933_0001747 Ga0373933_0001747_1236_1745 169
372 3300035724 Ga0373933_0008088 Ga0373933_0008088_2003_2521 169
373 3300035724 Ga0373933_0039696 Ga0373933_0039696_1151_1660 169
374 3300035725 Ga0373947_0000003 Ga0373947_0000003_144847_145356 169
375 3300035725 Ga0373947_0001226 Ga0373947_0001226_1386_1904 169
376 3300035725 Ga0373947_0004858 Ga0373947_0004858_5507_6025 169
377 3300035725 Ga0373947_0034461 Ga0373947_0034461_783_1301 169
378 3300036401 Ga0373937_0018561 Ga0373937_0018561_3074_3583 169
379 3300036401 Ga0373937_0027904 Ga0373937_0027904_849_1358 169
380 3300036401 Ga0373937_0137202 Ga0373937_0137202_598_1116 169
381 3300036401 Ga0373937_0192111 Ga0373937_0192111_1080_1691 169
382 3300036401 Ga0373937_0502716 Ga0373937_0502716_50_571 169
383 3300036459 Ga0372808_000908 Ga0372808_000908_302_811 169
384 3300036534 Ga0310109_018425 Ga0310109_018425_278_787 169
385 3300037068 Ga0373925_0001846 Ga0373925_0001846_2107_2625 169
386 3300037068 Ga0373925_0011932 Ga0373925_0011932_1167_1685 169
387 3300037068 Ga0373925_0179371 Ga0373925_0179371_973_1482 169
388 3300037068 Ga0373925_0563150 Ga0373925_0563150_213_731 169
389 3300039450 Ga0436363_0776709 Ga0436363_0776709_131_649 169
390 3300041505 Ga0451849_0604238 Ga0451849_0604238_91_600 169
391 3300044694 Ga0466963_0147263 Ga0466963_0147263_675_1193 169
392 3300044706 Ga0466964_0028775 Ga0466964_0028775_1291_1809 169
393 3300045049 Ga0466959_0099868 Ga0466959_0099868_399_938 169
394 3300045836 Ga0466958_0220794 Ga0466958_0220794_62_601 169
395 3300045976 Ga0466967_0039255 Ga0466967_0039255_2277_2795 169
396 3300045976 Ga0466967_0078465 Ga0466967_0078465_1997_2506 169
397 3300046454 Ga0495592_0067251 Ga0495592_0067251_247_756 169
398 3300046454 Ga0495592_0207212 Ga0495592_0207212_622_1140 169
399 3300046455 Ga0495603_0001384 Ga0495603_0001384_1105_1623 169
400 3300046459 Ga0495629_0060604 Ga0495629_0060604_826_1344 169
401 3300046459 Ga0495629_0313156 Ga0495629_0313156_372_890 169
402 3300046462 Ga0495651_0006624 Ga0495651_0006624_2689_3198 169
403 3300046462 Ga0495651_0008458 Ga0495651_0008458_273_782 169
404 3300046462 Ga0495651_0053856 Ga0495651_0053856_2074_2592 169
405 3300046463 Ga0495653_0000860 Ga0495653_0000860_5539_6048 169
406 3300046463 Ga0495653_0001704 Ga0495653_0001704_13902_14420 169
407 3300046463 Ga0495653_0009010 Ga0495653_0009010_5776_6294 169
408 3300046463 Ga0495653_0019571 Ga0495653_0019571_484_993 169
409 3300046472 Ga0495580_0044897 Ga0495580_0044897_475_993 169
410 3300046472 Ga0495580_0778062 Ga0495580_0778062_18_536 169
411 3300046473 Ga0495582_0000407 Ga0495582_0000407_3524_4042 169
412 3300046473 Ga0495582_0034197 Ga0495582_0034197_2128_2646 169
413 3300046475 Ga0495639_0000391 Ga0495639_0000391_16867_17385 169
414 3300046475 Ga0495639_0033585 Ga0495639_0033585_1572_2090 169
415 3300046476 Ga0495662_0000493 Ga0495662_0000493_17308_17826 169
416 3300046476 Ga0495662_0005884 Ga0495662_0005884_4727_5245 169
417 3300046477 Ga0495664_0002387 Ga0495664_0002387_505_1023 169
418 3300046477 Ga0495664_0213228 Ga0495664_0213228_221_730 169
419 3300046499 Ga0495594_0020198 Ga0495594_0020198_268_786 169
420 3300046511 Ga0495608_0016466 Ga0495608_0016466_2711_3220 169
421 3300046514 Ga0495618_0010578 Ga0495618_0010578_2869_3387 169
422 3300046514 Ga0495618_0016668 Ga0495618_0016668_2003_2521 169
423 3300046514 Ga0495618_0250874 Ga0495618_0250874_440_949 169
424 3300046516 Ga0495628_0011251 Ga0495628_0011251_3654_4172 169
425 3300046516 Ga0495628_0045480 Ga0495628_0045480_1705_2214 169
426 3300046516 Ga0495628_0210601 Ga0495628_0210601_842_1351 169
427 3300046517 Ga0495630_0024109 Ga0495630_0024109_2003_2521 169
428 3300046517 Ga0495630_0154400 Ga0495630_0154400_881_1399 169
429 3300046526 Ga0495666_0002579 Ga0495666_0002579_7325_7843 169
430 3300046529 Ga0495652_0002162 Ga0495652_0002162_15123_15632 169
431 3300046529 Ga0495652_0004111 Ga0495652_0004111_3136_3645 169
432 3300046529 Ga0495652_0089883 Ga0495652_0089883_929_1447 169
433 3300046529 Ga0495652_0231837 Ga0495652_0231837_211_729 169
434 3300046531 Ga0495665_0000203 Ga0495665_0000203_26060_26578 169
435 3300046531 Ga0495665_0017134 Ga0495665_0017134_2590_3108 169
436 3300046533 Ga0495640_0000775 Ga0495640_0000775_2571_3089 169
437 3300046533 Ga0495640_0035189 Ga0495640_0035189_1221_1730 169
438 3300046535 Ga0495586_0003951 Ga0495586_0003951_7398_7916 169
439 3300046536 Ga0495587_0024731 Ga0495587_0024731_1232_1750 169
440 3300046536 Ga0495587_0025861 Ga0495587_0025861_1303_1812 169
441 3300046536 Ga0495587_0083353 Ga0495587_0083353_1129_1647 169
442 3300046536 Ga0495587_0145785 Ga0495587_0145785_116_625 169
443 3300046543 Ga0495645_0002225 Ga0495645_0002225_10296_10814 169
444 3300046543 Ga0495645_0033031 Ga0495645_0033031_154_672 169
445 3300046543 Ga0495645_0594651 Ga0495645_0594651_135_644 169
446 3300046557 Ga0495622_0108705 Ga0495622_0108705_150_668 169
447 3300046559 Ga0495667_0000438 Ga0495667_0000438_13439_13948 169
448 3300046559 Ga0495667_0003068 Ga0495667_0003068_3441_3959 169
449 3300046559 Ga0495667_0013204 Ga0495667_0013204_1902_2420 169
450 3300046642 Ga0495634_0021968 Ga0495634_0021968_2720_3238 169
451 3300046663 Ga0495635_0001463 Ga0495635_0001463_11871_12389 169
452 3300046663 Ga0495635_0012246 Ga0495635_0012246_902_1420 169
453 3300046674 Ga0495588_0026823 Ga0495588_0026823_2182_2700 169
454 3300046675 Ga0495657_0001503 Ga0495657_0001503_16881_17390 169
455 3300046675 Ga0495657_0012738 Ga0495657_0012738_1754_2272 169
456 3300046675 Ga0495657_0014590 Ga0495657_0014590_4712_5230 169
457 3300046675 Ga0495657_0031213 Ga0495657_0031213_1004_1513 169
458 3300046678 Ga0495599_0012859 Ga0495599_0012859_151_669 169
459 3300046678 Ga0495599_0134135 Ga0495599_0134135_864_1373 169
460 3300046678 Ga0495599_0191664 Ga0495599_0191664_187_705 169
461 3300046679 Ga0495623_0021062 Ga0495623_0021062_3231_3740 169
462 3300046679 Ga0495623_0133953 Ga0495623_0133953_673_1191 169
463 3300046679 Ga0495623_0142783 Ga0495623_0142783_725_1234 169
464 3300046680 Ga0495646_0002110 Ga0495646_0002110_9273_9791 169
465 3300046680 Ga0495646_0015564 Ga0495646_0015564_2600_3109 169
466 3300046683 Ga0495658_0014557 Ga0495658_0014557_109_627 169
467 3300046683 Ga0495658_0238010 Ga0495658_0238010_534_1052 169
468 3300046689 Ga0495613_0003348 Ga0495613_0003348_3374_3892 169
469 3300046689 Ga0495613_0557966 Ga0495613_0557966_53_562 169
470 3300046690 Ga0495624_0013486 Ga0495624_0013486_4733_5251 169
471 3300046690 Ga0495624_0015402 Ga0495624_0015402_2686_3204 169
472 3300046690 Ga0495624_0601487 Ga0495624_0601487_87_596 169
473 3300046809 Ga0495600_0024821 Ga0495600_0024821_781_1290 169
474 3300046809 Ga0495600_0741528 Ga0495600_0741528_50_568 169
475 3300047315 Ga0495581_0000558 Ga0495581_0000558_16804_17322 169
476 3300047315 Ga0495581_0083744 Ga0495581_0083744_837_1355 169
477 3300047317 Ga0495604_0053376 Ga0495604_0053376_1806_2333 169
478 3300047317 Ga0495604_0093443 Ga0495604_0093443_147_665 169
479 3300047319 Ga0495674_0000802 Ga0495674_0000802_12421_12939 169
480 3300047319 Ga0495674_0011335 Ga0495674_0011335_4497_5015 169
481 3300047319 Ga0495674_0019380 Ga0495674_0019380_1816_2325 169
482 3300047319 Ga0495674_0426360 Ga0495674_0426360_399_908 169
483 3300047321 Ga0495676_0021052 Ga0495676_0021052_1263_1781 169
484 3300047321 Ga0495676_0044476 Ga0495676_0044476_1569_2087 169
485 3300047322 Ga0495680_0004275 Ga0495680_0004275_12589_13098 169
486 3300047322 Ga0495680_0007158 Ga0495680_0007158_3654_4172 169
487 3300047322 Ga0495680_0018970 Ga0495680_0018970_5163_5681 169
488 3300047444 Ga0495675_0011986 Ga0495675_0011986_4761_5270 169
489 3300047444 Ga0495675_0022936 Ga0495675_0022936_2719_3237 169
490 3300047444 Ga0495675_0083184 Ga0495675_0083184_725_1234 169
491 3300047444 Ga0495675_0448575 Ga0495675_0448575_14_532 169
492 3300047471 Ga0495684_0002672 Ga0495684_0002672_4749_5267 169
493 3300047471 Ga0495684_0015029 Ga0495684_0015029_2003_2521 169
494 3300047471 Ga0495684_0027388 Ga0495684_0027388_347_856 169
495 3300047673 Ga0495593_0002039 Ga0495593_0002039_10448_10966 169
496 3300047673 Ga0495593_0015945 Ga0495593_0015945_1859_2377 169
497 3300048088 Ga0495602_0015587 Ga0495602_0015587_2723_3232 169
498 3300048088 Ga0495602_0021484 Ga0495602_0021484_2819_3328 169
499 3300048088 Ga0495602_0033234 Ga0495602_0033234_1754_2272 169
500 3300048088 Ga0495602_0567336 Ga0495602_0567336_143_661 169
501 3300048089 Ga0495614_0004672 Ga0495614_0004672_3548_4066 169
502 3300048903 Ga0496100_0269563 Ga0496100_0269563_52_561 169
503 3300048903 Ga0496100_0464663 Ga0496100_0464663_216_725 169
504 3300048904 Ga0496101_0206076 Ga0496101_0206076_916_1428 169
505 3300048904 Ga0496101_0301856 Ga0496101_0301856_366_875 169
506 3300048904 Ga0496101_0322407 Ga0496101_0322407_367_876 169
507 3300048905 Ga0496102_0149392 Ga0496102_0149392_826_1338 169
508 3300048907 Ga0496104_0005096 Ga0496104_0005096_5785_6294 169
509 3300048907 Ga0496104_0051267 Ga0496104_0051267_1484_1993 169
510 3300048907 Ga0496104_0090332 Ga0496104_0090332_1256_1774 169
511 3300048907 Ga0496104_0121879 Ga0496104_0121879_566_1075 169
512 3300048907 Ga0496104_0316545 Ga0496104_0316545_430_939 169
513 3300048907 Ga0496104_0389303 Ga0496104_0389303_473_985 169
514 3300048907 Ga0496104_0532498 Ga0496104_0532498_415_933 169
515 3300048908 Ga0496105_0020894 Ga0496105_0020894_4152_4664 169
516 3300048908 Ga0496105_0035872 Ga0496105_0035872_1122_1631 169
517 3300048908 Ga0496105_0267089 Ga0496105_0267089_356_865 169
518 3300048908 Ga0496105_0360126 Ga0496105_0360126_389_898 169
519 3300048908 Ga0496105_0399877 Ga0496105_0399877_185_694 169
520 3300048908 Ga0496105_0525905 Ga0496105_0525905_83_601 169
521 3300048909 Ga0496106_0049792 Ga0496106_0049792_2116_2625 169
522 3300048910 Ga0496107_0134612 Ga0496107_0134612_116_625 169
523 3300048910 Ga0496107_0449392 Ga0496107_0449392_113_622 169
524 3300048911 Ga0496108_0083473 Ga0496108_0083473_1773_2282 169
525 3300048911 Ga0496108_0105849 Ga0496108_0105849_1200_1718 169
526 3300048911 Ga0496108_0116442 Ga0496108_0116442_1341_1850 169
527 3300048911 Ga0496108_0132480 Ga0496108_0132480_119_631 169
528 3300048912 Ga0496109_0064709 Ga0496109_0064709_219_737 169
529 3300048912 Ga0496109_0126985 Ga0496109_0126985_887_1396 169
530 3300048912 Ga0496109_0296510 Ga0496109_0296510_656_1165 169
531 3300048912 Ga0496109_0440299 Ga0496109_0440299_613_1122 169
532 3300048912 Ga0496109_1199885 Ga0496109_1199885_134_646 169
533 3300048913 Ga0496110_0139997 Ga0496110_0139997_1399_1911 169
534 3300048913 Ga0496110_0206902 Ga0496110_0206902_1112_1630 169
535 3300048913 Ga0496110_0414277 Ga0496110_0414277_668_1177 169
536 3300048913 Ga0496110_0493055 Ga0496110_0493055_245_754 169
537 3300048913 Ga0496110_0915181 Ga0496110_0915181_95_604 169
538 3300048914 Ga0496111_0355233 Ga0496111_0355233_98_607 169
539 3300048914 Ga0496111_0575614 Ga0496111_0575614_240_752 169
540 3300048915 Ga0496112_0037816 Ga0496112_0037816_359_868 169
541 3300048915 Ga0496112_0179302 Ga0496112_0179302_132_641 169
542 3300048915 Ga0496112_0397218 Ga0496112_0397218_443_961 169
543 3300048915 Ga0496112_0663093 Ga0496112_0663093_352_861 169
544 3300048915 Ga0496112_0850049 Ga0496112_0850049_90_608 169
545 3300048915 Ga0496112_1435255 Ga0496112_1435255_32_550 169
546 3300048916 Ga0496113_0093470 Ga0496113_0093470_1176_1685 169
547 3300048916 Ga0496113_0363895 Ga0496113_0363895_153_671 169
548 3300048917 Ga0496114_0007721 Ga0496114_0007721_2081_2593 169
549 3300048917 Ga0496114_0114375 Ga0496114_0114375_1138_1647 169
550 3300048917 Ga0496114_0239038 Ga0496114_0239038_706_1215 169
551 3300048917 Ga0496114_0416722 Ga0496114_0416722_587_1096 169
552 3300048917 Ga0496114_0710817 Ga0496114_0710817_306_824 169
553 3300048918 Ga0496115_0034348 Ga0496115_0034348_3413_3922 169
554 3300048918 Ga0496115_0067897 Ga0496115_0067897_991_1500 169
555 3300048918 Ga0496115_0163963 Ga0496115_0163963_514_1032 169
556 3300048918 Ga0496115_0254671 Ga0496115_0254671_516_1025 169
557 3300048918 Ga0496115_0332316 Ga0496115_0332316_394_903 169
558 3300048922 Ga0496119_0038268 Ga0496119_0038268_2460_2969 169
559 3300048929 Ga0496126_0637055 Ga0496126_0637055_277_795 169
560 3300049582 Ga0501048_0852785 Ga0501048_0852785_88_597 169
561 3300049588 Ga0501072_0531112 Ga0501072_0531112_22_531 169
562 3300050509 nmdc:mga0qj67_263500_c1 nmdc:mga0qj67_263500_c1_14_523 169
563 3300050512 nmdc:mga0n895_85576_c1 nmdc:mga0n895_85576_c1_1100_1618 169
564 3300050514 nmdc:mga08x19_101779_c1 nmdc:mga08x19_101779_c1_1134_1652 169
565 3300050514 nmdc:mga08x19_454042_c1 nmdc:mga08x19_454042_c1_292_810 169
566 3300053077 Ga0495601_0024576 Ga0495601_0024576_1191_1709 169
567 3300053077 Ga0495601_0163482 Ga0495601_0163482_577_1086 169
568 3300053077 Ga0495601_0504979 Ga0495601_0504979_133_651 169
569 3300053078 Ga0495612_0061681 Ga0495612_0061681_484_1002 169
570 3300053078 Ga0495612_0084120 Ga0495612_0084120_188_715 169
571 3300053084 Ga0495595_0017261 Ga0495595_0017261_386_913 169
572 3300053153 Ga0500616_0000144 Ga0500616_0000144_76680_77195 169
573 3300060353 Ga0501082_0360661 Ga0501082_0360661_473_982 169

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04978

DUF664

Protein of unknown function (DUF664)

18

168

0.92

PF12867

DinB_2

DinB superfamily

22

159

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.776 16 169
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7729 10 169
2p1a-assembly1.cif.gz_B crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution 0.7582 16 169
2qe9-assembly1.cif.gz_B crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution 0.7553 10 158
6iz2-assembly1.cif.gz_A crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 0.7543 10 169
ID Description Score Start End Superfamily
2qe9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7911 19 158 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7846 11 162 1.20.120.450
2hkvA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7646 11 162 1.20.120.450
3dkaA01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7342 18 162 1.20.120.450
af_P71985_5_134_1.20.120.450 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7327 19 160 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A542F4Q5-F1-model_v4 deleted 0.9735 3 169
AF-A0A4V2YNK7-F1-model_v4 DUF664 domain-containing protein 0.9726 5 169
AF-A0A543L3Z0-F1-model_v4 deleted 0.9715 4 169
AF-A0A1I1E275-F1-model_v4 deleted 0.9698 4 169
AF-A0A6N3K1K1-F1-model_v4 DinB family protein 0.9652 1 169

Feature Viewer

pLDDT pTM Quality
93.81 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map