F465202
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 283 | 571 | 170 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0192111|Ga0373937_0192111_1080_1691 |
| Length | 203 |
| Sequence | VAVPFPEPTAPASSRTEVFLRYLDFFRSRLTAKLLALPEEEQRRSRLPSGWTPLELVKHLRYVELRWLEWGFEGRDVGDPWGDHQGGPEGRWSVGPEETAATLLNGLHVQAARSRAIISAHTLDEVGELGERWDGADPATLERVLFHLLQEYARHVGHLDVIVELAAGRSGELKAPLSLKTPLSRPCRPRSGSGTRPDPRSRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2880489317 | Micromonospora ureilytica DSM 101692 | Isolate | Unclassified |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 7 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 9 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 40 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 56 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 60 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 61 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 62 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 67 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 78 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 80 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 94 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 95 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 98 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 145 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 146 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 147 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 148 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 149 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 150 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 151 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 152 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 153 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 156 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 157 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 162 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 163 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 169 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 170 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 174 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 175 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 176 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 177 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 178 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 179 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 180 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 182 | 3300036534 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 183 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 185 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 186 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 187 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 188 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 189 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 190 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 191 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 192 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 193 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 243 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 244 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 245 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 246 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 248 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 249 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 250 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 251 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 252 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 253 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 254 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 8001781756 | Catellatospora tritici NEAU-YM18 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.25 |
| Metatranscriptomes | 1.4 |
| Isolates | 0.35 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.17 |
| Nodule | 0 |
| Rhizoplane | 9.95 |
| Rhizosphere | 86.91 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.97 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25404J52841_10029025 | 3300003659 | Bacteria | 1187 |
| 2 | Ga0070658_10141021 | 3300005327 | Bacteria | 2013 |
| 3 | Ga0070683_100014040 | 3300005329 | Bacteria | 6995 |
| 4 | Ga0070683_100360737 | 3300005329 | Bacteria | 1384 |
| 5 | Ga0070680_100015620 | 3300005336 | Bacteria | 5956 |
| 6 | Ga0068868_100393585 | 3300005338 | Bacteria | 1194 |
| 7 | Ga0070660_100199279 | 3300005339 | Bacteria | 1624 |
| 8 | Ga0070691_10268898 | 3300005341 | Bacteria | 920 |
| 9 | Ga0070687_100147428 | 3300005343 | Bacteria | 1377 |
| 10 | Ga0070661_100848816 | 3300005344 | Bacteria | 751 |
| 11 | Ga0070661_100868193 | 3300005344 | Bacteria | 743 |
| 12 | Ga0070692_10190736 | 3300005345 | Bacteria | 1194 |
| 13 | Ga0070668_100233078 | 3300005347 | Bacteria | 1523 |
| 14 | Ga0070671_100137337 | 3300005355 | Bacteria | 2061 |
| 15 | Ga0070671_100815066 | 3300005355 | Bacteria | 813 |
| 16 | Ga0070671_101067202 | 3300005355 | Bacteria | 709 |
| 17 | Ga0070674_101039394 | 3300005356 | Bacteria | 721 |
| 18 | Ga0070659_100029115 | 3300005366 | Bacteria | 4267 |
| 19 | Ga0070667_100877264 | 3300005367 | Bacteria | 835 |
| 20 | Ga0070667_101112811 | 3300005367 | Bacteria | 738 |
| 21 | Ga0070709_10064337 | 3300005434 | Bacteria | 2345 |
| 22 | Ga0070709_10064802 | 3300005434 | Bacteria | 2337 |
| 23 | Ga0070714_100048325 | 3300005435 | Bacteria | 3618 |
| 24 | Ga0070714_100219311 | 3300005435 | Bacteria | 1747 |
| 25 | Ga0070714_100613556 | 3300005435 | Bacteria | 1045 |
| 26 | Ga0070714_100945510 | 3300005435 | Bacteria | 837 |
| 27 | Ga0070713_100134735 | 3300005436 | Bacteria | 2182 |
| 28 | Ga0070713_100332697 | 3300005436 | Bacteria | 1405 |
| 29 | Ga0070713_100363345 | 3300005436 | Bacteria | 1345 |
| 30 | Ga0070713_100448460 | 3300005436 | Bacteria | 1211 |
| 31 | Ga0070713_100573424 | 3300005436 | Bacteria | 1070 |
| 32 | Ga0070713_100574162 | 3300005436 | Bacteria | 1069 |
| 33 | Ga0070710_10155331 | 3300005437 | Bacteria | 1414 |
| 34 | Ga0070710_10176595 | 3300005437 | Bacteria | 1334 |
| 35 | Ga0070710_10192509 | 3300005437 | Bacteria | 1283 |
| 36 | Ga0070710_10230833 | 3300005437 | Bacteria | 1181 |
| 37 | Ga0070711_100067353 | 3300005439 | Bacteria | 2512 |
| 38 | Ga0070711_100211157 | 3300005439 | Bacteria | 1503 |
| 39 | Ga0070711_100475244 | 3300005439 | Bacteria | 1026 |
| 40 | Ga0070711_100827660 | 3300005439 | Bacteria | 786 |
| 41 | Ga0070694_100269354 | 3300005444 | Bacteria | 1295 |
| 42 | Ga0070708_100032331 | 3300005445 | Bacteria | 4537 |
| 43 | Ga0070708_100033055 | 3300005445 | Bacteria | 4493 |
| 44 | Ga0070708_100085548 | 3300005445 | Bacteria | 2862 |
| 45 | Ga0070708_100137595 | 3300005445 | Bacteria | 2263 |
| 46 | Ga0070663_100014876 | 3300005455 | Bacteria | 5004 |
| 47 | Ga0070681_10339299 | 3300005458 | Bacteria | 1412 |
| 48 | Ga0070681_10466905 | 3300005458 | Bacteria | 1175 |
| 49 | Ga0070685_10128377 | 3300005466 | Bacteria | 1583 |
| 50 | Ga0070706_100043355 | 3300005467 | Bacteria | 4157 |
| 51 | Ga0070706_100048227 | 3300005467 | Bacteria | 3931 |
| 52 | Ga0070706_100050251 | 3300005467 | Bacteria | 3848 |
| 53 | Ga0070706_100065671 | 3300005467 | Bacteria | 3356 |
| 54 | Ga0070706_100069289 | 3300005467 | Bacteria | 3263 |
| 55 | Ga0070707_100169391 | 3300005468 | Bacteria | 2128 |
| 56 | Ga0070707_100404443 | 3300005468 | Bacteria | 1325 |
| 57 | Ga0070707_100507796 | 3300005468 | Bacteria | 1167 |
| 58 | Ga0070707_101442947 | 3300005468 | Bacteria | 655 |
| 59 | Ga0070698_100003440 | 3300005471 | Bacteria | 17405 |
| 60 | Ga0070698_100004116 | 3300005471 | Bacteria | 15988 |
| 61 | Ga0070698_100135372 | 3300005471 | Bacteria | 2418 |
| 62 | Ga0070698_100794875 | 3300005471 | Unclassified | 890 |
| 63 | Ga0070699_100003864 | 3300005518 | Bacteria | 13243 |
| 64 | Ga0070699_100243621 | 3300005518 | Bacteria | 1605 |
| 65 | Ga0070679_100256115 | 3300005530 | Bacteria | 1705 |
| 66 | Ga0070679_101053203 | 3300005530 | Bacteria | 758 |
| 67 | Ga0070684_100018443 | 3300005535 | Bacteria | 5748 |
| 68 | Ga0070684_100261701 | 3300005535 | Unclassified | 1583 |
| 69 | Ga0070684_100502606 | 3300005535 | Bacteria | 1123 |
| 70 | Ga0070697_100001583 | 3300005536 | Bacteria | 17360 |
| 71 | Ga0068853_100061610 | 3300005539 | Bacteria | 3245 |
| 72 | Ga0070695_100271032 | 3300005545 | Bacteria | 1243 |
| 73 | Ga0070696_100069953 | 3300005546 | Bacteria | 2467 |
| 74 | Ga0070693_100070759 | 3300005547 | Bacteria | 2053 |
| 75 | Ga0070693_100121064 | 3300005547 | Bacteria | 1623 |
| 76 | Ga0070665_100551477 | 3300005548 | Bacteria | 1165 |
| 77 | Ga0068855_101192413 | 3300005563 | Bacteria | 792 |
| 78 | Ga0070664_100036667 | 3300005564 | Bacteria | 4119 |
| 79 | Ga0070664_100238486 | 3300005564 | Bacteria | 1632 |
| 80 | Ga0068857_100306938 | 3300005577 | Bacteria | 1463 |
| 81 | Ga0068856_100031132 | 3300005614 | Bacteria | 5219 |
| 82 | Ga0068856_100304210 | 3300005614 | Bacteria | 1612 |
| 83 | Ga0070702_100004107 | 3300005615 | Bacteria | 6605 |
| 84 | Ga0068852_100017952 | 3300005616 | Bacteria | 5564 |
| 85 | Ga0068852_100213025 | 3300005616 | Bacteria | 1834 |
| 86 | Ga0068852_100295380 | 3300005616 | Bacteria | 1566 |
| 87 | Ga0068859_100037750 | 3300005617 | Bacteria | 4848 |
| 88 | Ga0068864_100428941 | 3300005618 | Bacteria | 1261 |
| 89 | Ga0068864_100520220 | 3300005618 | Bacteria | 1147 |
| 90 | Ga0068866_10054001 | 3300005718 | Bacteria | 2057 |
| 91 | Ga0068861_100734528 | 3300005719 | Bacteria | 921 |
| 92 | Ga0068863_100244492 | 3300005841 | Bacteria | 1732 |
| 93 | Ga0068858_100807146 | 3300005842 | Bacteria | 915 |
| 94 | Ga0068858_101084167 | 3300005842 | Bacteria | 786 |
| 95 | Ga0068860_100758139 | 3300005843 | Bacteria | 982 |
| 96 | Ga0068862_100717693 | 3300005844 | Bacteria | 970 |
| 97 | Ga0081540_1013958 | 3300005983 | Bacteria | 5184 |
| 98 | Ga0070717_10002454 | 3300006028 | Bacteria | 13084 |
| 99 | Ga0070717_10017942 | 3300006028 | Bacteria | 5519 |
| 100 | Ga0070717_10077573 | 3300006028 | Bacteria | 2782 |
| 101 | Ga0070717_10277541 | 3300006028 | Bacteria | 1485 |
| 102 | Ga0070717_10333918 | 3300006028 | Bacteria | 1352 |
| 103 | Ga0075432_10080755 | 3300006058 | Bacteria | 1179 |
| 104 | Ga0070715_10006414 | 3300006163 | Bacteria | 3998 |
| 105 | Ga0070715_10098656 | 3300006163 | Bacteria | 1358 |
| 106 | Ga0070715_10146180 | 3300006163 | Bacteria | 1153 |
| 107 | Ga0070716_100004600 | 3300006173 | Bacteria | 6615 |
| 108 | Ga0070716_100025592 | 3300006173 | Bacteria | 3150 |
| 109 | Ga0070716_100165794 | 3300006173 | Bacteria | 1436 |
| 110 | Ga0070716_100284580 | 3300006173 | Bacteria | 1142 |
| 111 | Ga0070712_100078412 | 3300006175 | Bacteria | 2384 |
| 112 | Ga0070712_100275958 | 3300006175 | Bacteria | 1352 |
| 113 | Ga0070712_100499431 | 3300006175 | Bacteria | 1019 |
| 114 | Ga0070712_100613227 | 3300006175 | Bacteria | 922 |
| 115 | Ga0097621_100033364 | 3300006237 | Bacteria | 4099 |
| 116 | Ga0068871_100095092 | 3300006358 | Bacteria | 2488 |
| 117 | Ga0075431_100672683 | 3300006847 | Bacteria | 1014 |
| 118 | Ga0075434_100168309 | 3300006871 | Bacteria | 2211 |
| 119 | Ga0075434_101147512 | 3300006871 | Bacteria | 790 |
| 120 | Ga0068865_100399390 | 3300006881 | Bacteria | 1125 |
| 121 | Ga0075436_100253587 | 3300006914 | Bacteria | 1253 |
| 122 | Ga0075436_100369745 | 3300006914 | Bacteria | 1035 |
| 123 | Ga0097620_100037749 | 3300006931 | Bacteria | 4848 |
| 124 | Ga0075435_101247758 | 3300007076 | Bacteria | 650 |
| 125 | Ga0105251_10067796 | 3300009011 | Bacteria | 1666 |
| 126 | Ga0105245_10298348 | 3300009098 | Bacteria | 1580 |
| 127 | Ga0105245_10392014 | 3300009098 | Unclassified | 1386 |
| 128 | Ga0105247_10565517 | 3300009101 | Bacteria | 838 |
| 129 | Ga0105247_10648530 | 3300009101 | Unclassified | 788 |
| 130 | Ga0105243_10266900 | 3300009148 | Bacteria | 1535 |
| 131 | Ga0105241_10126691 | 3300009174 | Bacteria | 2063 |
| 132 | Ga0105241_10555710 | 3300009174 | Bacteria | 1031 |
| 133 | Ga0105242_10037586 | 3300009176 | Bacteria | 3889 |
| 134 | Ga0105242_12114280 | 3300009176 | Bacteria | 607 |
| 135 | Ga0105248_10067129 | 3300009177 | Bacteria | 4027 |
| 136 | Ga0105248_11107872 | 3300009177 | Bacteria | 895 |
| 137 | Ga0105248_12023076 | 3300009177 | Bacteria | 655 |
| 138 | Ga0105237_10275373 | 3300009545 | Bacteria | 1686 |
| 139 | Ga0105237_10421629 | 3300009545 | Bacteria | 1340 |
| 140 | Ga0105238_10478866 | 3300009551 | Bacteria | 1244 |
| 141 | Ga0105249_10413527 | 3300009553 | Bacteria | 1381 |
| 142 | Ga0099796_10158825 | 3300010159 | Bacteria | 895 |
| 143 | Ga0105246_12209923 | 3300011119 | Bacteria | 536 |
| 144 | Ga0157339_1019463 | 3300012505 | Bacteria | 708 |
| 145 | Ga0157338_1014245 | 3300012515 | Bacteria | 854 |
| 146 | Ga0157373_10050968 | 3300013100 | Bacteria | 2947 |
| 147 | Ga0157371_10040204 | 3300013102 | Bacteria | 3341 |
| 148 | Ga0157370_10684455 | 3300013104 | Bacteria | 936 |
| 149 | Ga0157370_10787676 | 3300013104 | Bacteria | 865 |
| 150 | Ga0157369_10711836 | 3300013105 | Bacteria | 1034 |
| 151 | Ga0157369_10749161 | 3300013105 | Bacteria | 1005 |
| 152 | Ga0157374_10796910 | 3300013296 | Bacteria | 960 |
| 153 | Ga0157378_10294788 | 3300013297 | Bacteria | 1568 |
| 154 | Ga0163162_10200659 | 3300013306 | Bacteria | 2123 |
| 155 | Ga0157375_10020740 | 3300013308 | Bacteria | 6012 |
| 156 | Ga0157375_10156132 | 3300013308 | Bacteria | 2421 |
| 157 | Ga0163163_10004668 | 3300014325 | Bacteria | 11717 |
| 158 | Ga0163163_10228230 | 3300014325 | Bacteria | 1911 |
| 159 | Ga0163163_10476624 | 3300014325 | Bacteria | 1309 |
| 160 | Ga0163163_10810195 | 3300014325 | Bacteria | 1000 |
| 161 | Ga0157377_10375734 | 3300014745 | Bacteria | 961 |
| 162 | Ga0157377_10444227 | 3300014745 | Bacteria | 894 |
| 163 | Ga0157379_10917237 | 3300014968 | Bacteria | 832 |
| 164 | Ga0197907_11237433 | 3300020069 | Bacteria | 886 |
| 165 | Ga0206355_1042905 | 3300020076 | Bacteria | 822 |
| 166 | Ga0206354_10964236 | 3300020081 | Bacteria | 2219 |
| 167 | Ga0206353_10002787 | 3300020082 | Bacteria | 2499 |
| 168 | Ga0206353_10271275 | 3300020082 | Bacteria | 1418 |
| 169 | Ga0213874_10048771 | 3300021377 | Bacteria | 1293 |
| 170 | Ga0213875_10001784 | 3300021388 | Bacteria | 13446 |
| 171 | Ga0213875_10258731 | 3300021388 | Bacteria | 821 |
| 172 | Ga0207653_10059550 | 3300025885 | Bacteria | 1285 |
| 173 | Ga0207692_10005120 | 3300025898 | Bacteria | 5231 |
| 174 | Ga0207692_10014198 | 3300025898 | Bacteria | 3475 |
| 175 | Ga0207692_10044866 | 3300025898 | Bacteria | 2208 |
| 176 | Ga0207692_10467519 | 3300025898 | Bacteria | 796 |
| 177 | Ga0207642_10021730 | 3300025899 | Bacteria | 2532 |
| 178 | Ga0207710_10289506 | 3300025900 | Bacteria | 825 |
| 179 | Ga0207688_10002720 | 3300025901 | Bacteria | 9572 |
| 180 | Ga0207680_10741171 | 3300025903 | Bacteria | 704 |
| 181 | Ga0207685_10005240 | 3300025905 | Bacteria | 3400 |
| 182 | Ga0207685_10008491 | 3300025905 | Bacteria | 2928 |
| 183 | Ga0207685_10040776 | 3300025905 | Bacteria | 1733 |
| 184 | Ga0207699_10016549 | 3300025906 | Bacteria | 3860 |
| 185 | Ga0207699_10108480 | 3300025906 | Bacteria | 1775 |
| 186 | Ga0207699_10115967 | 3300025906 | Bacteria | 1724 |
| 187 | Ga0207699_10182037 | 3300025906 | Bacteria | 1413 |
| 188 | Ga0207643_10008137 | 3300025908 | Bacteria | 5626 |
| 189 | Ga0207705_10354696 | 3300025909 | Bacteria | 1130 |
| 190 | Ga0207684_10001773 | 3300025910 | Bacteria | 22776 |
| 191 | Ga0207684_10058486 | 3300025910 | Bacteria | 3271 |
| 192 | Ga0207684_10070134 | 3300025910 | Bacteria | 2979 |
| 193 | Ga0207684_10085769 | 3300025910 | Bacteria | 2682 |
| 194 | Ga0207654_10074522 | 3300025911 | Bacteria | 2026 |
| 195 | Ga0207707_10417777 | 3300025912 | Bacteria | 1150 |
| 196 | Ga0207693_10026332 | 3300025915 | Bacteria | 4603 |
| 197 | Ga0207693_10032835 | 3300025915 | Bacteria | 4096 |
| 198 | Ga0207693_10040765 | 3300025915 | Bacteria | 3657 |
| 199 | Ga0207693_10436823 | 3300025915 | Bacteria | 1023 |
| 200 | Ga0207663_10008970 | 3300025916 | Bacteria | 5263 |
| 201 | Ga0207663_10016125 | 3300025916 | Bacteria | 4135 |
| 202 | Ga0207663_10095512 | 3300025916 | Bacteria | 1983 |
| 203 | Ga0207663_10198142 | 3300025916 | Bacteria | 1447 |
| 204 | Ga0207663_10359590 | 3300025916 | Bacteria | 1104 |
| 205 | Ga0207660_10578311 | 3300025917 | Bacteria | 914 |
| 206 | Ga0207662_10005891 | 3300025918 | Bacteria | 6575 |
| 207 | Ga0207657_10070890 | 3300025919 | Bacteria | 2953 |
| 208 | Ga0207649_10190254 | 3300025920 | Bacteria | 1443 |
| 209 | Ga0207646_10045854 | 3300025922 | Bacteria | 3923 |
| 210 | Ga0207646_10114269 | 3300025922 | Bacteria | 2424 |
| 211 | Ga0207659_10105918 | 3300025926 | Bacteria | 2128 |
| 212 | Ga0207700_10005860 | 3300025928 | Bacteria | 7386 |
| 213 | Ga0207700_10012586 | 3300025928 | Bacteria | 5465 |
| 214 | Ga0207700_10024290 | 3300025928 | Bacteria | 4193 |
| 215 | Ga0207700_10108621 | 3300025928 | Bacteria | 2228 |
| 216 | Ga0207700_10374894 | 3300025928 | Bacteria | 1243 |
| 217 | Ga0207700_10627367 | 3300025928 | Bacteria | 958 |
| 218 | Ga0207664_10011699 | 3300025929 | Bacteria | 6253 |
| 219 | Ga0207664_10022469 | 3300025929 | Bacteria | 4710 |
| 220 | Ga0207664_10047453 | 3300025929 | Bacteria | 3374 |
| 221 | Ga0207664_10282248 | 3300025929 | Bacteria | 1457 |
| 222 | Ga0207664_10303435 | 3300025929 | Bacteria | 1405 |
| 223 | Ga0207664_10359748 | 3300025929 | Bacteria | 1289 |
| 224 | Ga0207664_10587846 | 3300025929 | Bacteria | 1000 |
| 225 | Ga0207664_11070873 | 3300025929 | Bacteria | 721 |
| 226 | Ga0207664_11273954 | 3300025929 | Bacteria | 654 |
| 227 | Ga0207644_10285662 | 3300025931 | Bacteria | 1326 |
| 228 | Ga0207690_10328943 | 3300025932 | Bacteria | 1203 |
| 229 | Ga0207706_10168201 | 3300025933 | Bacteria | 1926 |
| 230 | Ga0207709_10084292 | 3300025935 | Bacteria | 2057 |
| 231 | Ga0207709_10192254 | 3300025935 | Bacteria | 1451 |
| 232 | Ga0207665_10006379 | 3300025939 | Bacteria | 7824 |
| 233 | Ga0207665_10010961 | 3300025939 | Bacteria | 5951 |
| 234 | Ga0207665_10013444 | 3300025939 | Bacteria | 5382 |
| 235 | Ga0207665_10145507 | 3300025939 | Bacteria | 1693 |
| 236 | Ga0207689_10025884 | 3300025942 | Bacteria | 4914 |
| 237 | Ga0207661_10172439 | 3300025944 | Bacteria | 1884 |
| 238 | Ga0207661_10240621 | 3300025944 | Bacteria | 1606 |
| 239 | Ga0207712_10326614 | 3300025961 | Bacteria | 1268 |
| 240 | Ga0207640_10037081 | 3300025981 | Bacteria | 3065 |
| 241 | Ga0207640_10087593 | 3300025981 | Bacteria | 2147 |
| 242 | Ga0207639_10091602 | 3300026041 | Bacteria | 2434 |
| 243 | Ga0207678_10004476 | 3300026067 | Bacteria | 12564 |
| 244 | Ga0207678_10021969 | 3300026067 | Bacteria | 5593 |
| 245 | Ga0207708_10128907 | 3300026075 | Bacteria | 1976 |
| 246 | Ga0207702_10023801 | 3300026078 | Bacteria | 5081 |
| 247 | Ga0207702_10081016 | 3300026078 | Bacteria | 2818 |
| 248 | Ga0207702_10090137 | 3300026078 | Bacteria | 2683 |
| 249 | Ga0207641_10922203 | 3300026088 | Bacteria | 868 |
| 250 | Ga0207676_10467363 | 3300026095 | Bacteria | 1192 |
| 251 | Ga0207676_10896175 | 3300026095 | Bacteria | 870 |
| 252 | Ga0207674_10000753 | 3300026116 | Bacteria | 42280 |
| 253 | Ga0207675_100121731 | 3300026118 | Bacteria | 2470 |
| 254 | Ga0207683_10008049 | 3300026121 | Bacteria | 9013 |
| 255 | Ga0207683_10311897 | 3300026121 | Bacteria | 1440 |
| 256 | Ga0207698_10117086 | 3300026142 | Bacteria | 2247 |
| 257 | Ga0207698_10632418 | 3300026142 | Bacteria | 1058 |
| 258 | Ga0268266_10225877 | 3300028379 | Bacteria | 1723 |
| 259 | Ga0268266_10248485 | 3300028379 | Bacteria | 1645 |
| 260 | Ga0268265_11178797 | 3300028380 | Bacteria | 763 |
| 261 | Ga0265336_10001832 | 3300028666 | Bacteria | 9257 |
| 262 | Ga0265338_10002851 | 3300028800 | Bacteria | 25265 |
| 263 | Ga0265770_1010893 | 3300030878 | Unclassified | 1326 |
| 264 | Ga0307513_10001546 | 3300031456 | Bacteria | 32952 |
| 265 | Ga0307513_10420902 | 3300031456 | Bacteria | 1066 |
| 266 | Ga0307413_10337493 | 3300031824 | Bacteria | 1158 |
| 267 | Ga0307409_101417515 | 3300031995 | Bacteria | 721 |
| 268 | Ga0307409_101499527 | 3300031995 | Bacteria | 702 |
| 269 | Ga0307414_10212280 | 3300032004 | Bacteria | 1583 |
| 270 | Ga0316214_1003203 | 3300033545 | Bacteria | 2056 |
| 271 | Ga0373930_0016153 | 3300034816 | Bacteria | 1409 |
| 272 | Ga0373948_0023219 | 3300034817 | Bacteria | 1202 |
| 273 | Ga0373948_0079454 | 3300034817 | Bacteria | 746 |
| 274 | Ga0373950_0110196 | 3300034818 | Bacteria | 601 |
| 275 | Ga0373938_0005876 | 3300034957 | Bacteria | 2102 |
| 276 | Ga0373938_0033167 | 3300034957 | Bacteria | 1116 |
| 277 | Ga0373926_0004437 | 3300035083 | Bacteria | 4602 |
| 278 | Ga0373928_0008051 | 3300035084 | Bacteria | 2041 |
| 279 | Ga0373929_0011720 | 3300035085 | Bacteria | 1656 |
| 280 | Ga0373929_0025076 | 3300035085 | Bacteria | 1236 |
| 281 | Ga0373934_0046027 | 3300035086 | Bacteria | 1725 |
| 282 | Ga0373934_0057669 | 3300035086 | Bacteria | 1545 |
| 283 | Ga0373934_0088587 | 3300035086 | Bacteria | 1246 |
| 284 | Ga0373944_0000683 | 3300035089 | Bacteria | 8152 |
| 285 | Ga0373951_0004816 | 3300035091 | Bacteria | 3178 |
| 286 | Ga0373923_0002696 | 3300035111 | Bacteria | 5530 |
| 287 | Ga0373932_0134907 | 3300035112 | Bacteria | 835 |
| 288 | Ga0373936_0000485 | 3300035113 | Bacteria | 13452 |
| 289 | Ga0373936_0008641 | 3300035113 | Bacteria | 3834 |
| 290 | Ga0373936_0051787 | 3300035113 | Bacteria | 1662 |
| 291 | Ga0373936_0104689 | 3300035113 | Bacteria | 1197 |
| 292 | Ga0373936_0361491 | 3300035113 | Bacteria | 662 |
| 293 | Ga0373939_0026969 | 3300035114 | Bacteria | 1624 |
| 294 | Ga0373941_0020865 | 3300035115 | Bacteria | 1842 |
| 295 | Ga0373941_0090433 | 3300035115 | Bacteria | 1049 |
| 296 | Ga0373945_0001625 | 3300035116 | Bacteria | 6891 |
| 297 | Ga0373945_0021555 | 3300035116 | Bacteria | 2214 |
| 298 | Ga0373953_0032920 | 3300035117 | Bacteria | 2025 |
| 299 | Ga0373953_0044793 | 3300035117 | Bacteria | 1770 |
| 300 | Ga0373953_0081652 | 3300035117 | Bacteria | 1344 |
| 301 | Ga0373954_0047903 | 3300035118 | Bacteria | 2001 |
| 302 | Ga0373956_0033589 | 3300035119 | Bacteria | 2256 |
| 303 | Ga0373956_0102325 | 3300035119 | Bacteria | 1329 |
| 304 | Ga0373957_0015160 | 3300035120 | Bacteria | 2648 |
| 305 | Ga0373957_0287301 | 3300035120 | Bacteria | 696 |
| 306 | Ga0373960_0068368 | 3300035121 | Bacteria | 1093 |
| 307 | Ga0373943_0000727 | 3300035170 | Bacteria | 14433 |
| 308 | Ga0373943_0003240 | 3300035170 | Bacteria | 7383 |
| 309 | Ga0373943_0068541 | 3300035170 | Bacteria | 1791 |
| 310 | Ga0373946_0007407 | 3300035171 | Bacteria | 4011 |
| 311 | Ga0373946_0010589 | 3300035171 | Bacteria | 3417 |
| 312 | Ga0373946_0189440 | 3300035171 | Bacteria | 980 |
| 313 | Ga0373955_0132913 | 3300035172 | Bacteria | 1454 |
| 314 | Ga0373955_0151209 | 3300035172 | Bacteria | 1366 |
| 315 | Ga0373924_0000149 | 3300035410 | Bacteria | 20536 |
| 316 | Ga0373924_0010602 | 3300035410 | Bacteria | 3406 |
| 317 | Ga0373924_0169323 | 3300035410 | Bacteria | 960 |
| 318 | Ga0373924_0217381 | 3300035410 | Bacteria | 844 |
| 319 | Ga0373931_0029916 | 3300035691 | Bacteria | 2800 |
| 320 | Ga0373931_0049099 | 3300035691 | Bacteria | 2239 |
| 321 | Ga0373935_0001103 | 3300035692 | Bacteria | 14736 |
| 322 | Ga0373935_0007573 | 3300035692 | Bacteria | 6502 |
| 323 | Ga0373935_0013185 | 3300035692 | Bacteria | 4983 |
| 324 | Ga0373935_0021296 | 3300035692 | Bacteria | 3968 |
| 325 | Ga0373935_0343110 | 3300035692 | Bacteria | 1063 |
| 326 | Ga0373927_0002623 | 3300035695 | Bacteria | 13111 |
| 327 | Ga0373927_0012837 | 3300035695 | Bacteria | 5571 |
| 328 | Ga0373933_0001747 | 3300035724 | Bacteria | 12607 |
| 329 | Ga0373933_0008088 | 3300035724 | Bacteria | 5739 |
| 330 | Ga0373933_0039696 | 3300035724 | Bacteria | 2770 |
| 331 | Ga0373947_0000003 | 3300035725 | Bacteria | 345338 |
| 332 | Ga0373947_0001226 | 3300035725 | Bacteria | 15805 |
| 333 | Ga0373947_0004858 | 3300035725 | Bacteria | 7855 |
| 334 | Ga0373947_0034461 | 3300035725 | Bacteria | 2994 |
| 335 | Ga0373937_0018561 | 3300036401 | Bacteria | 6213 |
| 336 | Ga0373937_0027904 | 3300036401 | Bacteria | 5107 |
| 337 | Ga0373937_0137202 | 3300036401 | Bacteria | 2287 |
| 338 | Ga0373937_0192111 | 3300036401 | Bacteria | 1918 |
| 339 | Ga0373937_0502716 | 3300036401 | Bacteria | 1152 |
| 340 | Ga0372808_000908 | 3300036459 | Bacteria | 2766 |
| 341 | Ga0310109_018425 | 3300036534 | Unclassified | 943 |
| 342 | Ga0373925_0001846 | 3300037068 | Bacteria | 17627 |
| 343 | Ga0373925_0011932 | 3300037068 | Bacteria | 6288 |
| 344 | Ga0373925_0143964 | 3300037068 | Bacteria | 1867 |
| 345 | Ga0373925_0179371 | 3300037068 | Bacteria | 1675 |
| 346 | Ga0373925_0563150 | 3300037068 | Bacteria | 937 |
| 347 | Ga0436364_0011144 | 3300037853 | Bacteria | 5566 |
| 348 | Ga0436364_0871804 | 3300037853 | Bacteria | 6058 |
| 349 | Ga0436364_1006127 | 3300037853 | Bacteria | 3102 |
| 350 | Ga0436363_0776709 | 3300039450 | Bacteria | 743 |
| 351 | Ga0436363_1357121 | 3300039450 | Bacteria | 4488 |
| 352 | Ga0436362_0845838 | 3300039453 | Bacteria | 545 |
| 353 | Ga0451849_0604238 | 3300041505 | Bacteria | 696 |
| 354 | Ga0466963_0147263 | 3300044694 | Bacteria | 1634 |
| 355 | Ga0466964_0028775 | 3300044706 | Bacteria | 2191 |
| 356 | Ga0466959_0099868 | 3300045049 | Bacteria | 2078 |
| 357 | Ga0466959_0690299 | 3300045049 | Bacteria | 684 |
| 358 | Ga0466958_0220794 | 3300045836 | Bacteria | 1209 |
| 359 | Ga0466967_0039255 | 3300045976 | Bacteria | 4068 |
| 360 | Ga0466967_0078465 | 3300045976 | Bacteria | 2975 |
| 361 | Ga0495592_0067251 | 3300046454 | Bacteria | 2619 |
| 362 | Ga0495592_0207212 | 3300046454 | Bacteria | 1319 |
| 363 | Ga0495603_0001384 | 3300046455 | Bacteria | 14074 |
| 364 | Ga0495629_0060604 | 3300046459 | Bacteria | 2644 |
| 365 | Ga0495629_0313156 | 3300046459 | Bacteria | 1074 |
| 366 | Ga0495651_0006624 | 3300046462 | Bacteria | 8846 |
| 367 | Ga0495651_0008458 | 3300046462 | Bacteria | 7886 |
| 368 | Ga0495651_0053856 | 3300046462 | Bacteria | 3096 |
| 369 | Ga0495653_0000860 | 3300046463 | Bacteria | 23415 |
| 370 | Ga0495653_0001704 | 3300046463 | Bacteria | 17301 |
| 371 | Ga0495653_0009010 | 3300046463 | Bacteria | 8161 |
| 372 | Ga0495653_0019571 | 3300046463 | Bacteria | 5489 |
| 373 | Ga0495580_0044897 | 3300046472 | Bacteria | 3141 |
| 374 | Ga0495580_0778062 | 3300046472 | Bacteria | 622 |
| 375 | Ga0495582_0000407 | 3300046473 | Bacteria | 23526 |
| 376 | Ga0495582_0034197 | 3300046473 | Bacteria | 2794 |
| 377 | Ga0495639_0000391 | 3300046475 | Bacteria | 20675 |
| 378 | Ga0495639_0033585 | 3300046475 | Bacteria | 2291 |
| 379 | Ga0495662_0000493 | 3300046476 | Bacteria | 17984 |
| 380 | Ga0495662_0005884 | 3300046476 | Bacteria | 6133 |
| 381 | Ga0495664_0002387 | 3300046477 | Bacteria | 10069 |
| 382 | Ga0495664_0010848 | 3300046477 | Bacteria | 5122 |
| 383 | Ga0495664_0213228 | 3300046477 | Bacteria | 1169 |
| 384 | Ga0495594_0020198 | 3300046499 | Bacteria | 3547 |
| 385 | Ga0495608_0016466 | 3300046511 | Bacteria | 5115 |
| 386 | Ga0495618_0010578 | 3300046514 | Bacteria | 5583 |
| 387 | Ga0495618_0016668 | 3300046514 | Bacteria | 4499 |
| 388 | Ga0495618_0045350 | 3300046514 | Bacteria | 2773 |
| 389 | Ga0495618_0250874 | 3300046514 | Bacteria | 1110 |
| 390 | Ga0495628_0011251 | 3300046516 | Bacteria | 7572 |
| 391 | Ga0495628_0045480 | 3300046516 | Bacteria | 3490 |
| 392 | Ga0495628_0194297 | 3300046516 | Bacteria | 1531 |
| 393 | Ga0495628_0210601 | 3300046516 | Bacteria | 1462 |
| 394 | Ga0495630_0024109 | 3300046517 | Bacteria | 4499 |
| 395 | Ga0495630_0154400 | 3300046517 | Bacteria | 1747 |
| 396 | Ga0495666_0002579 | 3300046526 | Bacteria | 9013 |
| 397 | Ga0495652_0002162 | 3300046529 | Bacteria | 20674 |
| 398 | Ga0495652_0004111 | 3300046529 | Bacteria | 14043 |
| 399 | Ga0495652_0089883 | 3300046529 | Bacteria | 2513 |
| 400 | Ga0495652_0231837 | 3300046529 | Bacteria | 1380 |
| 401 | Ga0495665_0000203 | 3300046531 | Bacteria | 30479 |
| 402 | Ga0495665_0017134 | 3300046531 | Bacteria | 3897 |
| 403 | Ga0495665_0227435 | 3300046531 | Bacteria | 964 |
| 404 | Ga0495640_0000775 | 3300046533 | Bacteria | 24102 |
| 405 | Ga0495640_0035189 | 3300046533 | Bacteria | 3545 |
| 406 | Ga0495640_0060128 | 3300046533 | Bacteria | 2585 |
| 407 | Ga0495586_0003951 | 3300046535 | Bacteria | 7958 |
| 408 | Ga0495586_0343761 | 3300046535 | Bacteria | 856 |
| 409 | Ga0495587_0024731 | 3300046536 | Bacteria | 3677 |
| 410 | Ga0495587_0025861 | 3300046536 | Bacteria | 3583 |
| 411 | Ga0495587_0083353 | 3300046536 | Bacteria | 1852 |
| 412 | Ga0495587_0145785 | 3300046536 | Bacteria | 1350 |
| 413 | Ga0495645_0002225 | 3300046543 | Bacteria | 13197 |
| 414 | Ga0495645_0033031 | 3300046543 | Bacteria | 3775 |
| 415 | Ga0495645_0227106 | 3300046543 | Bacteria | 1252 |
| 416 | Ga0495645_0594651 | 3300046543 | Bacteria | 681 |
| 417 | Ga0495622_0108705 | 3300046557 | Bacteria | 1270 |
| 418 | Ga0495667_0000438 | 3300046559 | Bacteria | 26630 |
| 419 | Ga0495667_0003068 | 3300046559 | Bacteria | 11207 |
| 420 | Ga0495667_0013204 | 3300046559 | Bacteria | 5593 |
| 421 | Ga0495634_0021968 | 3300046642 | Bacteria | 4500 |
| 422 | Ga0495634_0174095 | 3300046642 | Bacteria | 1351 |
| 423 | Ga0495635_0001463 | 3300046663 | Bacteria | 15789 |
| 424 | Ga0495635_0012246 | 3300046663 | Bacteria | 6009 |
| 425 | Ga0495588_0026823 | 3300046674 | Bacteria | 2877 |
| 426 | Ga0495657_0001503 | 3300046675 | Bacteria | 20091 |
| 427 | Ga0495657_0012738 | 3300046675 | Bacteria | 6236 |
| 428 | Ga0495657_0014590 | 3300046675 | Bacteria | 5766 |
| 429 | Ga0495657_0031213 | 3300046675 | Bacteria | 3725 |
| 430 | Ga0495599_0012859 | 3300046678 | Bacteria | 5165 |
| 431 | Ga0495599_0084989 | 3300046678 | Bacteria | 1976 |
| 432 | Ga0495599_0134135 | 3300046678 | Bacteria | 1537 |
| 433 | Ga0495599_0191664 | 3300046678 | Bacteria | 1257 |
| 434 | Ga0495623_0021062 | 3300046679 | Bacteria | 4212 |
| 435 | Ga0495623_0133953 | 3300046679 | Bacteria | 1480 |
| 436 | Ga0495623_0142783 | 3300046679 | Bacteria | 1422 |
| 437 | Ga0495646_0002110 | 3300046680 | Bacteria | 12063 |
| 438 | Ga0495646_0015564 | 3300046680 | Bacteria | 4826 |
| 439 | Ga0495646_0292504 | 3300046680 | Bacteria | 863 |
| 440 | Ga0495658_0014557 | 3300046683 | Bacteria | 4022 |
| 441 | Ga0495658_0238010 | 3300046683 | Bacteria | 1143 |
| 442 | Ga0495613_0003348 | 3300046689 | Bacteria | 11979 |
| 443 | Ga0495613_0557966 | 3300046689 | Bacteria | 766 |
| 444 | Ga0495624_0013486 | 3300046690 | Bacteria | 5571 |
| 445 | Ga0495624_0015402 | 3300046690 | Bacteria | 5163 |
| 446 | Ga0495624_0601487 | 3300046690 | Bacteria | 655 |
| 447 | Ga0495600_0024821 | 3300046809 | Bacteria | 3859 |
| 448 | Ga0495600_0741528 | 3300046809 | Bacteria | 588 |
| 449 | Ga0495581_0000558 | 3300047315 | Bacteria | 19300 |
| 450 | Ga0495581_0083744 | 3300047315 | Bacteria | 1848 |
| 451 | Ga0495604_0053376 | 3300047317 | Bacteria | 3124 |
| 452 | Ga0495604_0093443 | 3300047317 | Bacteria | 2225 |
| 453 | Ga0495674_0000802 | 3300047319 | Bacteria | 29886 |
| 454 | Ga0495674_0011335 | 3300047319 | Bacteria | 8415 |
| 455 | Ga0495674_0019380 | 3300047319 | Bacteria | 6314 |
| 456 | Ga0495674_0025644 | 3300047319 | Bacteria | 5401 |
| 457 | Ga0495674_0426360 | 3300047319 | Bacteria | 1068 |
| 458 | Ga0495676_0021052 | 3300047321 | Bacteria | 5707 |
| 459 | Ga0495676_0044476 | 3300047321 | Bacteria | 3624 |
| 460 | Ga0495680_0004275 | 3300047322 | Bacteria | 13699 |
| 461 | Ga0495680_0007158 | 3300047322 | Bacteria | 10278 |
| 462 | Ga0495680_0018970 | 3300047322 | Bacteria | 5824 |
| 463 | Ga0495675_0011986 | 3300047444 | Bacteria | 5450 |
| 464 | Ga0495675_0022936 | 3300047444 | Bacteria | 3978 |
| 465 | Ga0495675_0083184 | 3300047444 | Bacteria | 2015 |
| 466 | Ga0495675_0448575 | 3300047444 | Bacteria | 746 |
| 467 | Ga0495684_0002672 | 3300047471 | Bacteria | 14126 |
| 468 | Ga0495684_0015029 | 3300047471 | Bacteria | 5961 |
| 469 | Ga0495684_0027388 | 3300047471 | Bacteria | 4376 |
| 470 | Ga0495593_0002039 | 3300047673 | Bacteria | 12048 |
| 471 | Ga0495593_0015945 | 3300047673 | Bacteria | 4244 |
| 472 | Ga0495602_0015587 | 3300048088 | Bacteria | 7665 |
| 473 | Ga0495602_0021484 | 3300048088 | Bacteria | 6351 |
| 474 | Ga0495602_0033234 | 3300048088 | Bacteria | 4842 |
| 475 | Ga0495602_0567336 | 3300048088 | Bacteria | 784 |
| 476 | Ga0495602_0691413 | 3300048088 | Bacteria | 693 |
| 477 | Ga0495614_0004672 | 3300048089 | Bacteria | 6171 |
| 478 | Ga0496100_0269563 | 3300048903 | Bacteria | 1265 |
| 479 | Ga0496100_0464663 | 3300048903 | Bacteria | 971 |
| 480 | Ga0496101_0206076 | 3300048904 | Bacteria | 1522 |
| 481 | Ga0496101_0301856 | 3300048904 | Bacteria | 1254 |
| 482 | Ga0496101_0322407 | 3300048904 | Bacteria | 1212 |
| 483 | Ga0496102_0038007 | 3300048905 | Bacteria | 4342 |
| 484 | Ga0496102_0149392 | 3300048905 | Bacteria | 2195 |
| 485 | Ga0496104_0005096 | 3300048907 | Bacteria | 11465 |
| 486 | Ga0496104_0051267 | 3300048907 | Bacteria | 3895 |
| 487 | Ga0496104_0090332 | 3300048907 | Bacteria | 2926 |
| 488 | Ga0496104_0121879 | 3300048907 | Bacteria | 2503 |
| 489 | Ga0496104_0316545 | 3300048907 | Bacteria | 1473 |
| 490 | Ga0496104_0389303 | 3300048907 | Bacteria | 1306 |
| 491 | Ga0496104_0532498 | 3300048907 | Bacteria | 1086 |
| 492 | Ga0496105_0020894 | 3300048908 | Bacteria | 5294 |
| 493 | Ga0496105_0035872 | 3300048908 | Bacteria | 4084 |
| 494 | Ga0496105_0267089 | 3300048908 | Bacteria | 1382 |
| 495 | Ga0496105_0360126 | 3300048908 | Bacteria | 1160 |
| 496 | Ga0496105_0399877 | 3300048908 | Bacteria | 1090 |
| 497 | Ga0496105_0525905 | 3300048908 | Bacteria | 926 |
| 498 | Ga0496106_0049792 | 3300048909 | Bacteria | 3157 |
| 499 | Ga0496107_0134612 | 3300048910 | Bacteria | 1826 |
| 500 | Ga0496107_0449392 | 3300048910 | Bacteria | 957 |
| 501 | Ga0496108_0083473 | 3300048911 | Bacteria | 2710 |
| 502 | Ga0496108_0105849 | 3300048911 | Bacteria | 2402 |
| 503 | Ga0496108_0116442 | 3300048911 | Bacteria | 2289 |
| 504 | Ga0496108_0132480 | 3300048911 | Bacteria | 2142 |
| 505 | Ga0496109_0064709 | 3300048912 | Bacteria | 3346 |
| 506 | Ga0496109_0126985 | 3300048912 | Bacteria | 2378 |
| 507 | Ga0496109_0296510 | 3300048912 | Bacteria | 1524 |
| 508 | Ga0496109_0440299 | 3300048912 | Unclassified | 1231 |
| 509 | Ga0496109_1199885 | 3300048912 | Bacteria | 695 |
| 510 | Ga0496110_0139997 | 3300048913 | Bacteria | 2187 |
| 511 | Ga0496110_0206902 | 3300048913 | Bacteria | 1783 |
| 512 | Ga0496110_0414277 | 3300048913 | Bacteria | 1228 |
| 513 | Ga0496110_0493055 | 3300048913 | Bacteria | 1116 |
| 514 | Ga0496110_0915181 | 3300048913 | Bacteria | 783 |
| 515 | Ga0496111_0355233 | 3300048914 | Bacteria | 1085 |
| 516 | Ga0496111_0575614 | 3300048914 | Bacteria | 825 |
| 517 | Ga0496112_0037816 | 3300048915 | Bacteria | 4712 |
| 518 | Ga0496112_0179302 | 3300048915 | Bacteria | 2082 |
| 519 | Ga0496112_0397218 | 3300048915 | Bacteria | 1318 |
| 520 | Ga0496112_0663093 | 3300048915 | Bacteria | 972 |
| 521 | Ga0496112_0850049 | 3300048915 | Bacteria | 836 |
| 522 | Ga0496112_1435255 | 3300048915 | Bacteria | 604 |
| 523 | Ga0496113_0093470 | 3300048916 | Bacteria | 2321 |
| 524 | Ga0496113_0363895 | 3300048916 | Bacteria | 1160 |
| 525 | Ga0496114_0007721 | 3300048917 | Bacteria | 8509 |
| 526 | Ga0496114_0114375 | 3300048917 | Bacteria | 2314 |
| 527 | Ga0496114_0239038 | 3300048917 | Bacteria | 1597 |
| 528 | Ga0496114_0416722 | 3300048917 | Bacteria | 1189 |
| 529 | Ga0496114_0710817 | 3300048917 | Bacteria | 881 |
| 530 | Ga0496115_0034348 | 3300048918 | Bacteria | 4008 |
| 531 | Ga0496115_0067897 | 3300048918 | Bacteria | 2885 |
| 532 | Ga0496115_0163963 | 3300048918 | Bacteria | 1838 |
| 533 | Ga0496115_0254671 | 3300048918 | Bacteria | 1444 |
| 534 | Ga0496115_0332316 | 3300048918 | Bacteria | 1241 |
| 535 | Ga0496119_0038268 | 3300048922 | Bacteria | 3103 |
| 536 | Ga0496126_0637055 | 3300048929 | Bacteria | 836 |
| 537 | Ga0501036_0012559 | 3300049572 | Bacteria | 7025 |
| 538 | Ga0501038_0919970 | 3300049574 | Bacteria | 645 |
| 539 | Ga0501039_0013828 | 3300049575 | Bacteria | 6176 |
| 540 | Ga0501040_0317184 | 3300049576 | Bacteria | 1115 |
| 541 | Ga0501041_0032760 | 3300049577 | Bacteria | 3141 |
| 542 | Ga0501048_0042854 | 3300049582 | Bacteria | 3240 |
| 543 | Ga0501048_0852785 | 3300049582 | Bacteria | 655 |
| 544 | Ga0501071_0357447 | 3300049587 | Bacteria | 1112 |
| 545 | Ga0501072_0033213 | 3300049588 | Bacteria | 4043 |
| 546 | Ga0501072_0531112 | 3300049588 | Bacteria | 930 |
| 547 | Ga0501074_0185713 | 3300049590 | Bacteria | 1482 |
| 548 | Ga0501075_0187548 | 3300049591 | Bacteria | 1577 |
| 549 | Ga0501076_0021383 | 3300049592 | Bacteria | 4962 |
| 550 | Ga0501077_0073512 | 3300049593 | Bacteria | 2166 |
| 551 | Ga0501079_0037041 | 3300049741 | Bacteria | 3758 |
| 552 | Ga0501083_0083673 | 3300049744 | Bacteria | 2114 |
| 553 | Ga0501035_0349071 | 3300049822 | Bacteria | 1238 |
| 554 | Ga0501045_0019154 | 3300049824 | Bacteria | 4875 |
| 555 | nmdc:mga05p37_52911_c1 | 3300050507 | Bacteria | 4994 |
| 556 | nmdc:mga09592_76809_c1 | 3300050508 | Bacteria | 2841 |
| 557 | nmdc:mga0qj67_263500_c1 | 3300050509 | Bacteria | 1398 |
| 558 | nmdc:mga06r32_422800_c1 | 3300050510 | Bacteria | 1314 |
| 559 | nmdc:mga0n895_85576_c1 | 3300050512 | Bacteria | 3148 |
| 560 | nmdc:mga08x19_101779_c1 | 3300050514 | Bacteria | 1907 |
| 561 | nmdc:mga08x19_454042_c1 | 3300050514 | Bacteria | 902 |
| 562 | Ga0495601_0024576 | 3300053077 | Bacteria | 3711 |
| 563 | Ga0495601_0163482 | 3300053077 | Bacteria | 1455 |
| 564 | Ga0495601_0504979 | 3300053077 | Bacteria | 780 |
| 565 | Ga0495612_0061681 | 3300053078 | Bacteria | 1553 |
| 566 | Ga0495612_0084120 | 3300053078 | Bacteria | 1340 |
| 567 | Ga0495595_0017261 | 3300053084 | Bacteria | 3105 |
| 568 | Ga0500616_0000144 | 3300053153 | Bacteria | 121889 |
| 569 | Ga0501084_0187740 | 3300054114 | Bacteria | 1744 |
| 570 | Ga0501082_0123193 | 3300060353 | Bacteria | 2248 |
| 571 | Ga0501082_0360661 | 3300060353 | Bacteria | 1268 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300021377 | Ga0213874_10048771 | Ga0213874_100487712 | 140 |
| 2 | 3300039450 | Ga0436363_1357121 | Ga0436363_1357121_919_1440 | 140 |
| 3 | 3300037853 | Ga0436364_0011144 | Ga0436364_0011144_4383_4841 | 149 |
| 4 | 3300039453 | Ga0436362_0845838 | Ga0436362_0845838_21_479 | 149 |
| 5 | 3300045049 | Ga0466959_0690299 | Ga0466959_0690299_155_613 | 152 |
| 6 | 3300049587 | Ga0501071_0357447 | Ga0501071_0357447_15_473 | 152 |
| 7 | 3300005435 | Ga0070714_100048325 | Ga0070714_1000483253 | 161 |
| 8 | 3300005467 | Ga0070706_100043355 | Ga0070706_1000433552 | 163 |
| 9 | 3300005536 | Ga0070697_100001583 | Ga0070697_1000015836 | 163 |
| 10 | 3300025910 | Ga0207684_10085769 | Ga0207684_100857694 | 163 |
| 11 | 3300035410 | Ga0373924_0169323 | Ga0373924_0169323_127_636 | 163 |
| 12 | 3300050507 | nmdc:mga05p37_52911_c1 | nmdc:mga05p37_52911_c1_2989_3480 | 163 |
| 13 | 3300050508 | nmdc:mga09592_76809_c1 | nmdc:mga09592_76809_c1_225_716 | 163 |
| 14 | 3300050510 | nmdc:mga06r32_422800_c1 | nmdc:mga06r32_422800_c1_522_1013 | 163 |
| 15 | iso_pu_bacteria | 2880489317 | 2880491246 | 164 |
| 16 | iso_pu_bacteria | 8001781756 | 8001790339 | 165 |
| 17 | 3300020069 | Ga0197907_11237433 | Ga0197907_112374331 | 166 |
| 18 | 3300020076 | Ga0206355_1042905 | Ga0206355_10429051 | 166 |
| 19 | 3300021388 | Ga0213875_10001784 | Ga0213875_100017846 | 166 |
| 20 | 3300021388 | Ga0213875_10258731 | Ga0213875_102587312 | 166 |
| 21 | 3300037853 | Ga0436364_0871804 | Ga0436364_0871804_1869_2408 | 166 |
| 22 | 3300037853 | Ga0436364_1006127 | Ga0436364_1006127_2499_3032 | 166 |
| 23 | 3300005436 | Ga0070713_100573424 | Ga0070713_1005734242 | 167 |
| 24 | 3300006175 | Ga0070712_100613227 | Ga0070712_1006132271 | 167 |
| 25 | 3300006847 | Ga0075431_100672683 | Ga0075431_1006726831 | 167 |
| 26 | 3300009545 | Ga0105237_10275373 | Ga0105237_102753732 | 167 |
| 27 | 3300025928 | Ga0207700_10627367 | Ga0207700_106273672 | 167 |
| 28 | 3300030878 | Ga0265770_1010893 | Ga0265770_10108932 | 167 |
| 29 | 3300035113 | Ga0373936_0104689 | Ga0373936_0104689_127_630 | 167 |
| 30 | 3300035410 | Ga0373924_0217381 | Ga0373924_0217381_42_545 | 167 |
| 31 | 3300035692 | Ga0373935_0021296 | Ga0373935_0021296_3015_3518 | 167 |
| 32 | 3300037068 | Ga0373925_0143964 | Ga0373925_0143964_166_669 | 167 |
| 33 | 3300046477 | Ga0495664_0010848 | Ga0495664_0010848_3426_3929 | 167 |
| 34 | 3300046514 | Ga0495618_0045350 | Ga0495618_0045350_333_836 | 167 |
| 35 | 3300046516 | Ga0495628_0194297 | Ga0495628_0194297_617_1120 | 167 |
| 36 | 3300046531 | Ga0495665_0227435 | Ga0495665_0227435_246_749 | 167 |
| 37 | 3300046533 | Ga0495640_0060128 | Ga0495640_0060128_1224_1727 | 167 |
| 38 | 3300046535 | Ga0495586_0343761 | Ga0495586_0343761_96_599 | 167 |
| 39 | 3300046543 | Ga0495645_0227106 | Ga0495645_0227106_538_1041 | 167 |
| 40 | 3300046642 | Ga0495634_0174095 | Ga0495634_0174095_107_610 | 167 |
| 41 | 3300046678 | Ga0495599_0084989 | Ga0495599_0084989_906_1409 | 167 |
| 42 | 3300046680 | Ga0495646_0292504 | Ga0495646_0292504_100_603 | 167 |
| 43 | 3300047319 | Ga0495674_0025644 | Ga0495674_0025644_1242_1745 | 167 |
| 44 | 3300048088 | Ga0495602_0691413 | Ga0495602_0691413_145_648 | 167 |
| 45 | 3300048905 | Ga0496102_0038007 | Ga0496102_0038007_2717_3220 | 167 |
| 46 | 3300049572 | Ga0501036_0012559 | Ga0501036_0012559_2113_2616 | 167 |
| 47 | 3300049575 | Ga0501039_0013828 | Ga0501039_0013828_2112_2615 | 167 |
| 48 | 3300049577 | Ga0501041_0032760 | Ga0501041_0032760_697_1200 | 167 |
| 49 | 3300049582 | Ga0501048_0042854 | Ga0501048_0042854_2220_2723 | 167 |
| 50 | 3300049588 | Ga0501072_0033213 | Ga0501072_0033213_2425_2928 | 167 |
| 51 | 3300049590 | Ga0501074_0185713 | Ga0501074_0185713_661_1164 | 167 |
| 52 | 3300049591 | Ga0501075_0187548 | Ga0501075_0187548_470_973 | 167 |
| 53 | 3300049592 | Ga0501076_0021383 | Ga0501076_0021383_2812_3315 | 167 |
| 54 | 3300049593 | Ga0501077_0073512 | Ga0501077_0073512_1638_2141 | 167 |
| 55 | 3300049741 | Ga0501079_0037041 | Ga0501079_0037041_2805_3308 | 167 |
| 56 | 3300049744 | Ga0501083_0083673 | Ga0501083_0083673_866_1369 | 167 |
| 57 | 3300049822 | Ga0501035_0349071 | Ga0501035_0349071_384_887 | 167 |
| 58 | 3300049824 | Ga0501045_0019154 | Ga0501045_0019154_3901_4404 | 167 |
| 59 | 3300054114 | Ga0501084_0187740 | Ga0501084_0187740_781_1284 | 167 |
| 60 | 3300060353 | Ga0501082_0123193 | Ga0501082_0123193_595_1098 | 167 |
| 61 | 3300005458 | Ga0070681_10466905 | Ga0070681_104669052 | 168 |
| 62 | 3300031824 | Ga0307413_10337493 | Ga0307413_103374932 | 168 |
| 63 | 3300031995 | Ga0307409_101499527 | Ga0307409_1014995271 | 168 |
| 64 | 3300049574 | Ga0501038_0919970 | Ga0501038_0919970_71_583 | 168 |
| 65 | 3300049576 | Ga0501040_0317184 | Ga0501040_0317184_442_954 | 168 |
| 66 | 3300003659 | JGI25404J52841_10029025 | JGI25404J52841_100290251 | 169 |
| 67 | 3300005327 | Ga0070658_10141021 | Ga0070658_101410212 | 169 |
| 68 | 3300005329 | Ga0070683_100014040 | Ga0070683_1000140404 | 169 |
| 69 | 3300005329 | Ga0070683_100360737 | Ga0070683_1003607371 | 169 |
| 70 | 3300005336 | Ga0070680_100015620 | Ga0070680_1000156203 | 169 |
| 71 | 3300005338 | Ga0068868_100393585 | Ga0068868_1003935851 | 169 |
| 72 | 3300005339 | Ga0070660_100199279 | Ga0070660_1001992792 | 169 |
| 73 | 3300005341 | Ga0070691_10268898 | Ga0070691_102688982 | 169 |
| 74 | 3300005343 | Ga0070687_100147428 | Ga0070687_1001474282 | 169 |
| 75 | 3300005344 | Ga0070661_100848816 | Ga0070661_1008488161 | 169 |
| 76 | 3300005344 | Ga0070661_100868193 | Ga0070661_1008681932 | 169 |
| 77 | 3300005345 | Ga0070692_10190736 | Ga0070692_101907361 | 169 |
| 78 | 3300005347 | Ga0070668_100233078 | Ga0070668_1002330782 | 169 |
| 79 | 3300005355 | Ga0070671_100137337 | Ga0070671_1001373371 | 169 |
| 80 | 3300005355 | Ga0070671_100815066 | Ga0070671_1008150661 | 169 |
| 81 | 3300005355 | Ga0070671_101067202 | Ga0070671_1010672021 | 169 |
| 82 | 3300005356 | Ga0070674_101039394 | Ga0070674_1010393941 | 169 |
| 83 | 3300005366 | Ga0070659_100029115 | Ga0070659_1000291153 | 169 |
| 84 | 3300005367 | Ga0070667_100877264 | Ga0070667_1008772641 | 169 |
| 85 | 3300005367 | Ga0070667_101112811 | Ga0070667_1011128111 | 169 |
| 86 | 3300005434 | Ga0070709_10064337 | Ga0070709_100643372 | 169 |
| 87 | 3300005434 | Ga0070709_10064802 | Ga0070709_100648023 | 169 |
| 88 | 3300005435 | Ga0070714_100219311 | Ga0070714_1002193112 | 169 |
| 89 | 3300005435 | Ga0070714_100613556 | Ga0070714_1006135562 | 169 |
| 90 | 3300005435 | Ga0070714_100945510 | Ga0070714_1009455101 | 169 |
| 91 | 3300005436 | Ga0070713_100134735 | Ga0070713_1001347352 | 169 |
| 92 | 3300005436 | Ga0070713_100332697 | Ga0070713_1003326972 | 169 |
| 93 | 3300005436 | Ga0070713_100363345 | Ga0070713_1003633452 | 169 |
| 94 | 3300005436 | Ga0070713_100448460 | Ga0070713_1004484602 | 169 |
| 95 | 3300005436 | Ga0070713_100574162 | Ga0070713_1005741621 | 169 |
| 96 | 3300005437 | Ga0070710_10155331 | Ga0070710_101553312 | 169 |
| 97 | 3300005437 | Ga0070710_10176595 | Ga0070710_101765952 | 169 |
| 98 | 3300005437 | Ga0070710_10192509 | Ga0070710_101925092 | 169 |
| 99 | 3300005437 | Ga0070710_10230833 | Ga0070710_102308332 | 169 |
| 100 | 3300005439 | Ga0070711_100067353 | Ga0070711_1000673532 | 169 |
| 101 | 3300005439 | Ga0070711_100211157 | Ga0070711_1002111571 | 169 |
| 102 | 3300005439 | Ga0070711_100475244 | Ga0070711_1004752442 | 169 |
| 103 | 3300005439 | Ga0070711_100827660 | Ga0070711_1008276602 | 169 |
| 104 | 3300005444 | Ga0070694_100269354 | Ga0070694_1002693542 | 169 |
| 105 | 3300005445 | Ga0070708_100032331 | Ga0070708_1000323315 | 169 |
| 106 | 3300005445 | Ga0070708_100033055 | Ga0070708_1000330553 | 169 |
| 107 | 3300005445 | Ga0070708_100085548 | Ga0070708_1000855483 | 169 |
| 108 | 3300005445 | Ga0070708_100137595 | Ga0070708_1001375952 | 169 |
| 109 | 3300005455 | Ga0070663_100014876 | Ga0070663_1000148765 | 169 |
| 110 | 3300005458 | Ga0070681_10339299 | Ga0070681_103392991 | 169 |
| 111 | 3300005466 | Ga0070685_10128377 | Ga0070685_101283772 | 169 |
| 112 | 3300005467 | Ga0070706_100048227 | Ga0070706_1000482273 | 169 |
| 113 | 3300005467 | Ga0070706_100050251 | Ga0070706_1000502512 | 169 |
| 114 | 3300005467 | Ga0070706_100065671 | Ga0070706_1000656714 | 169 |
| 115 | 3300005467 | Ga0070706_100069289 | Ga0070706_1000692892 | 169 |
| 116 | 3300005468 | Ga0070707_100169391 | Ga0070707_1001693912 | 169 |
| 117 | 3300005468 | Ga0070707_100404443 | Ga0070707_1004044432 | 169 |
| 118 | 3300005468 | Ga0070707_100507796 | Ga0070707_1005077962 | 169 |
| 119 | 3300005468 | Ga0070707_101442947 | Ga0070707_1014429471 | 169 |
| 120 | 3300005471 | Ga0070698_100003440 | Ga0070698_10000344010 | 169 |
| 121 | 3300005471 | Ga0070698_100004116 | Ga0070698_10000411610 | 169 |
| 122 | 3300005471 | Ga0070698_100135372 | Ga0070698_1001353723 | 169 |
| 123 | 3300005471 | Ga0070698_100794875 | Ga0070698_1007948752 | 169 |
| 124 | 3300005518 | Ga0070699_100003864 | Ga0070699_1000038643 | 169 |
| 125 | 3300005518 | Ga0070699_100243621 | Ga0070699_1002436213 | 169 |
| 126 | 3300005530 | Ga0070679_100256115 | Ga0070679_1002561152 | 169 |
| 127 | 3300005530 | Ga0070679_101053203 | Ga0070679_1010532031 | 169 |
| 128 | 3300005535 | Ga0070684_100018443 | Ga0070684_1000184435 | 169 |
| 129 | 3300005535 | Ga0070684_100261701 | Ga0070684_1002617012 | 169 |
| 130 | 3300005535 | Ga0070684_100502606 | Ga0070684_1005026062 | 169 |
| 131 | 3300005539 | Ga0068853_100061610 | Ga0068853_1000616104 | 169 |
| 132 | 3300005545 | Ga0070695_100271032 | Ga0070695_1002710322 | 169 |
| 133 | 3300005546 | Ga0070696_100069953 | Ga0070696_1000699533 | 169 |
| 134 | 3300005547 | Ga0070693_100070759 | Ga0070693_1000707593 | 169 |
| 135 | 3300005547 | Ga0070693_100121064 | Ga0070693_1001210643 | 169 |
| 136 | 3300005548 | Ga0070665_100551477 | Ga0070665_1005514772 | 169 |
| 137 | 3300005563 | Ga0068855_101192413 | Ga0068855_1011924131 | 169 |
| 138 | 3300005564 | Ga0070664_100036667 | Ga0070664_1000366674 | 169 |
| 139 | 3300005564 | Ga0070664_100238486 | Ga0070664_1002384862 | 169 |
| 140 | 3300005577 | Ga0068857_100306938 | Ga0068857_1003069381 | 169 |
| 141 | 3300005614 | Ga0068856_100031132 | Ga0068856_1000311326 | 169 |
| 142 | 3300005614 | Ga0068856_100304210 | Ga0068856_1003042102 | 169 |
| 143 | 3300005615 | Ga0070702_100004107 | Ga0070702_1000041074 | 169 |
| 144 | 3300005616 | Ga0068852_100017952 | Ga0068852_1000179525 | 169 |
| 145 | 3300005616 | Ga0068852_100213025 | Ga0068852_1002130252 | 169 |
| 146 | 3300005616 | Ga0068852_100295380 | Ga0068852_1002953802 | 169 |
| 147 | 3300005617 | Ga0068859_100037750 | Ga0068859_1000377503 | 169 |
| 148 | 3300005618 | Ga0068864_100428941 | Ga0068864_1004289412 | 169 |
| 149 | 3300005618 | Ga0068864_100520220 | Ga0068864_1005202202 | 169 |
| 150 | 3300005718 | Ga0068866_10054001 | Ga0068866_100540013 | 169 |
| 151 | 3300005719 | Ga0068861_100734528 | Ga0068861_1007345281 | 169 |
| 152 | 3300005841 | Ga0068863_100244492 | Ga0068863_1002444922 | 169 |
| 153 | 3300005842 | Ga0068858_100807146 | Ga0068858_1008071462 | 169 |
| 154 | 3300005842 | Ga0068858_101084167 | Ga0068858_1010841672 | 169 |
| 155 | 3300005843 | Ga0068860_100758139 | Ga0068860_1007581392 | 169 |
| 156 | 3300005844 | Ga0068862_100717693 | Ga0068862_1007176932 | 169 |
| 157 | 3300005983 | Ga0081540_1013958 | Ga0081540_10139584 | 169 |
| 158 | 3300006028 | Ga0070717_10002454 | Ga0070717_100024546 | 169 |
| 159 | 3300006028 | Ga0070717_10017942 | Ga0070717_100179423 | 169 |
| 160 | 3300006028 | Ga0070717_10077573 | Ga0070717_100775733 | 169 |
| 161 | 3300006028 | Ga0070717_10277541 | Ga0070717_102775412 | 169 |
| 162 | 3300006028 | Ga0070717_10333918 | Ga0070717_103339182 | 169 |
| 163 | 3300006058 | Ga0075432_10080755 | Ga0075432_100807552 | 169 |
| 164 | 3300006163 | Ga0070715_10006414 | Ga0070715_100064143 | 169 |
| 165 | 3300006163 | Ga0070715_10098656 | Ga0070715_100986562 | 169 |
| 166 | 3300006163 | Ga0070715_10146180 | Ga0070715_101461802 | 169 |
| 167 | 3300006173 | Ga0070716_100004600 | Ga0070716_1000046005 | 169 |
| 168 | 3300006173 | Ga0070716_100025592 | Ga0070716_1000255922 | 169 |
| 169 | 3300006173 | Ga0070716_100165794 | Ga0070716_1001657942 | 169 |
| 170 | 3300006173 | Ga0070716_100284580 | Ga0070716_1002845802 | 169 |
| 171 | 3300006175 | Ga0070712_100078412 | Ga0070712_1000784121 | 169 |
| 172 | 3300006175 | Ga0070712_100275958 | Ga0070712_1002759582 | 169 |
| 173 | 3300006175 | Ga0070712_100499431 | Ga0070712_1004994311 | 169 |
| 174 | 3300006237 | Ga0097621_100033364 | Ga0097621_1000333642 | 169 |
| 175 | 3300006358 | Ga0068871_100095092 | Ga0068871_1000950922 | 169 |
| 176 | 3300006871 | Ga0075434_100168309 | Ga0075434_1001683092 | 169 |
| 177 | 3300006871 | Ga0075434_101147512 | Ga0075434_1011475122 | 169 |
| 178 | 3300006881 | Ga0068865_100399390 | Ga0068865_1003993902 | 169 |
| 179 | 3300006914 | Ga0075436_100253587 | Ga0075436_1002535872 | 169 |
| 180 | 3300006914 | Ga0075436_100369745 | Ga0075436_1003697452 | 169 |
| 181 | 3300006931 | Ga0097620_100037749 | Ga0097620_1000377493 | 169 |
| 182 | 3300007076 | Ga0075435_101247758 | Ga0075435_1012477582 | 169 |
| 183 | 3300009011 | Ga0105251_10067796 | Ga0105251_100677962 | 169 |
| 184 | 3300009098 | Ga0105245_10298348 | Ga0105245_102983482 | 169 |
| 185 | 3300009098 | Ga0105245_10392014 | Ga0105245_103920142 | 169 |
| 186 | 3300009101 | Ga0105247_10565517 | Ga0105247_105655172 | 169 |
| 187 | 3300009101 | Ga0105247_10648530 | Ga0105247_106485302 | 169 |
| 188 | 3300009148 | Ga0105243_10266900 | Ga0105243_102669002 | 169 |
| 189 | 3300009174 | Ga0105241_10126691 | Ga0105241_101266912 | 169 |
| 190 | 3300009174 | Ga0105241_10555710 | Ga0105241_105557101 | 169 |
| 191 | 3300009176 | Ga0105242_10037586 | Ga0105242_100375862 | 169 |
| 192 | 3300009176 | Ga0105242_12114280 | Ga0105242_121142801 | 169 |
| 193 | 3300009177 | Ga0105248_10067129 | Ga0105248_100671295 | 169 |
| 194 | 3300009177 | Ga0105248_11107872 | Ga0105248_111078722 | 169 |
| 195 | 3300009177 | Ga0105248_12023076 | Ga0105248_120230762 | 169 |
| 196 | 3300009545 | Ga0105237_10421629 | Ga0105237_104216291 | 169 |
| 197 | 3300009551 | Ga0105238_10478866 | Ga0105238_104788662 | 169 |
| 198 | 3300009553 | Ga0105249_10413527 | Ga0105249_104135272 | 169 |
| 199 | 3300010159 | Ga0099796_10158825 | Ga0099796_101588252 | 169 |
| 200 | 3300011119 | Ga0105246_12209923 | Ga0105246_122099231 | 169 |
| 201 | 3300012505 | Ga0157339_1019463 | Ga0157339_10194632 | 169 |
| 202 | 3300012515 | Ga0157338_1014245 | Ga0157338_10142451 | 169 |
| 203 | 3300013100 | Ga0157373_10050968 | Ga0157373_100509683 | 169 |
| 204 | 3300013102 | Ga0157371_10040204 | Ga0157371_100402042 | 169 |
| 205 | 3300013104 | Ga0157370_10684455 | Ga0157370_106844552 | 169 |
| 206 | 3300013104 | Ga0157370_10787676 | Ga0157370_107876762 | 169 |
| 207 | 3300013105 | Ga0157369_10711836 | Ga0157369_107118362 | 169 |
| 208 | 3300013105 | Ga0157369_10749161 | Ga0157369_107491612 | 169 |
| 209 | 3300013296 | Ga0157374_10796910 | Ga0157374_107969102 | 169 |
| 210 | 3300013297 | Ga0157378_10294788 | Ga0157378_102947882 | 169 |
| 211 | 3300013306 | Ga0163162_10200659 | Ga0163162_102006592 | 169 |
| 212 | 3300013308 | Ga0157375_10020740 | Ga0157375_100207402 | 169 |
| 213 | 3300013308 | Ga0157375_10156132 | Ga0157375_101561323 | 169 |
| 214 | 3300014325 | Ga0163163_10004668 | Ga0163163_1000466813 | 169 |
| 215 | 3300014325 | Ga0163163_10228230 | Ga0163163_102282302 | 169 |
| 216 | 3300014325 | Ga0163163_10476624 | Ga0163163_104766242 | 169 |
| 217 | 3300014325 | Ga0163163_10810195 | Ga0163163_108101952 | 169 |
| 218 | 3300014745 | Ga0157377_10375734 | Ga0157377_103757341 | 169 |
| 219 | 3300014745 | Ga0157377_10444227 | Ga0157377_104442271 | 169 |
| 220 | 3300014968 | Ga0157379_10917237 | Ga0157379_109172371 | 169 |
| 221 | 3300020081 | Ga0206354_10964236 | Ga0206354_109642363 | 169 |
| 222 | 3300020082 | Ga0206353_10002787 | Ga0206353_100027872 | 169 |
| 223 | 3300020082 | Ga0206353_10271275 | Ga0206353_102712752 | 169 |
| 224 | 3300025885 | Ga0207653_10059550 | Ga0207653_100595502 | 169 |
| 225 | 3300025898 | Ga0207692_10005120 | Ga0207692_100051205 | 169 |
| 226 | 3300025898 | Ga0207692_10014198 | Ga0207692_100141984 | 169 |
| 227 | 3300025898 | Ga0207692_10044866 | Ga0207692_100448662 | 169 |
| 228 | 3300025898 | Ga0207692_10467519 | Ga0207692_104675192 | 169 |
| 229 | 3300025899 | Ga0207642_10021730 | Ga0207642_100217303 | 169 |
| 230 | 3300025900 | Ga0207710_10289506 | Ga0207710_102895061 | 169 |
| 231 | 3300025901 | Ga0207688_10002720 | Ga0207688_100027203 | 169 |
| 232 | 3300025903 | Ga0207680_10741171 | Ga0207680_107411711 | 169 |
| 233 | 3300025905 | Ga0207685_10005240 | Ga0207685_100052403 | 169 |
| 234 | 3300025905 | Ga0207685_10008491 | Ga0207685_100084914 | 169 |
| 235 | 3300025905 | Ga0207685_10040776 | Ga0207685_100407762 | 169 |
| 236 | 3300025906 | Ga0207699_10016549 | Ga0207699_100165492 | 169 |
| 237 | 3300025906 | Ga0207699_10108480 | Ga0207699_101084802 | 169 |
| 238 | 3300025906 | Ga0207699_10115967 | Ga0207699_101159672 | 169 |
| 239 | 3300025906 | Ga0207699_10182037 | Ga0207699_101820372 | 169 |
| 240 | 3300025908 | Ga0207643_10008137 | Ga0207643_100081375 | 169 |
| 241 | 3300025909 | Ga0207705_10354696 | Ga0207705_103546962 | 169 |
| 242 | 3300025910 | Ga0207684_10001773 | Ga0207684_1000177310 | 169 |
| 243 | 3300025910 | Ga0207684_10058486 | Ga0207684_100584863 | 169 |
| 244 | 3300025910 | Ga0207684_10070134 | Ga0207684_100701343 | 169 |
| 245 | 3300025911 | Ga0207654_10074522 | Ga0207654_100745222 | 169 |
| 246 | 3300025912 | Ga0207707_10417777 | Ga0207707_104177771 | 169 |
| 247 | 3300025915 | Ga0207693_10026332 | Ga0207693_100263325 | 169 |
| 248 | 3300025915 | Ga0207693_10032835 | Ga0207693_100328353 | 169 |
| 249 | 3300025915 | Ga0207693_10040765 | Ga0207693_100407654 | 169 |
| 250 | 3300025915 | Ga0207693_10436823 | Ga0207693_104368232 | 169 |
| 251 | 3300025916 | Ga0207663_10008970 | Ga0207663_100089702 | 169 |
| 252 | 3300025916 | Ga0207663_10016125 | Ga0207663_100161254 | 169 |
| 253 | 3300025916 | Ga0207663_10095512 | Ga0207663_100955122 | 169 |
| 254 | 3300025916 | Ga0207663_10198142 | Ga0207663_101981422 | 169 |
| 255 | 3300025916 | Ga0207663_10359590 | Ga0207663_103595902 | 169 |
| 256 | 3300025917 | Ga0207660_10578311 | Ga0207660_105783112 | 169 |
| 257 | 3300025918 | Ga0207662_10005891 | Ga0207662_100058918 | 169 |
| 258 | 3300025919 | Ga0207657_10070890 | Ga0207657_100708902 | 169 |
| 259 | 3300025920 | Ga0207649_10190254 | Ga0207649_101902541 | 169 |
| 260 | 3300025922 | Ga0207646_10045854 | Ga0207646_100458545 | 169 |
| 261 | 3300025922 | Ga0207646_10114269 | Ga0207646_101142693 | 169 |
| 262 | 3300025926 | Ga0207659_10105918 | Ga0207659_101059182 | 169 |
| 263 | 3300025928 | Ga0207700_10005860 | Ga0207700_100058608 | 169 |
| 264 | 3300025928 | Ga0207700_10012586 | Ga0207700_100125866 | 169 |
| 265 | 3300025928 | Ga0207700_10024290 | Ga0207700_100242902 | 169 |
| 266 | 3300025928 | Ga0207700_10108621 | Ga0207700_101086213 | 169 |
| 267 | 3300025928 | Ga0207700_10374894 | Ga0207700_103748942 | 169 |
| 268 | 3300025929 | Ga0207664_10011699 | Ga0207664_100116993 | 169 |
| 269 | 3300025929 | Ga0207664_10022469 | Ga0207664_100224695 | 169 |
| 270 | 3300025929 | Ga0207664_10047453 | Ga0207664_100474534 | 169 |
| 271 | 3300025929 | Ga0207664_10282248 | Ga0207664_102822482 | 169 |
| 272 | 3300025929 | Ga0207664_10303435 | Ga0207664_103034352 | 169 |
| 273 | 3300025929 | Ga0207664_10359748 | Ga0207664_103597482 | 169 |
| 274 | 3300025929 | Ga0207664_10587846 | Ga0207664_105878462 | 169 |
| 275 | 3300025929 | Ga0207664_11070873 | Ga0207664_110708732 | 169 |
| 276 | 3300025929 | Ga0207664_11273954 | Ga0207664_112739541 | 169 |
| 277 | 3300025931 | Ga0207644_10285662 | Ga0207644_102856622 | 169 |
| 278 | 3300025932 | Ga0207690_10328943 | Ga0207690_103289432 | 169 |
| 279 | 3300025933 | Ga0207706_10168201 | Ga0207706_101682011 | 169 |
| 280 | 3300025935 | Ga0207709_10084292 | Ga0207709_100842922 | 169 |
| 281 | 3300025935 | Ga0207709_10192254 | Ga0207709_101922542 | 169 |
| 282 | 3300025939 | Ga0207665_10006379 | Ga0207665_100063797 | 169 |
| 283 | 3300025939 | Ga0207665_10010961 | Ga0207665_100109617 | 169 |
| 284 | 3300025939 | Ga0207665_10013444 | Ga0207665_100134444 | 169 |
| 285 | 3300025939 | Ga0207665_10145507 | Ga0207665_101455072 | 169 |
| 286 | 3300025942 | Ga0207689_10025884 | Ga0207689_100258845 | 169 |
| 287 | 3300025944 | Ga0207661_10172439 | Ga0207661_101724392 | 169 |
| 288 | 3300025944 | Ga0207661_10240621 | Ga0207661_102406212 | 169 |
| 289 | 3300025961 | Ga0207712_10326614 | Ga0207712_103266143 | 169 |
| 290 | 3300025981 | Ga0207640_10037081 | Ga0207640_100370814 | 169 |
| 291 | 3300025981 | Ga0207640_10087593 | Ga0207640_100875931 | 169 |
| 292 | 3300026041 | Ga0207639_10091602 | Ga0207639_100916021 | 169 |
| 293 | 3300026067 | Ga0207678_10004476 | Ga0207678_100044768 | 169 |
| 294 | 3300026067 | Ga0207678_10021969 | Ga0207678_100219694 | 169 |
| 295 | 3300026075 | Ga0207708_10128907 | Ga0207708_101289071 | 169 |
| 296 | 3300026078 | Ga0207702_10023801 | Ga0207702_100238015 | 169 |
| 297 | 3300026078 | Ga0207702_10081016 | Ga0207702_100810161 | 169 |
| 298 | 3300026078 | Ga0207702_10090137 | Ga0207702_100901374 | 169 |
| 299 | 3300026088 | Ga0207641_10922203 | Ga0207641_109222031 | 169 |
| 300 | 3300026095 | Ga0207676_10467363 | Ga0207676_104673632 | 169 |
| 301 | 3300026095 | Ga0207676_10896175 | Ga0207676_108961752 | 169 |
| 302 | 3300026116 | Ga0207674_10000753 | Ga0207674_1000075313 | 169 |
| 303 | 3300026118 | Ga0207675_100121731 | Ga0207675_1001217314 | 169 |
| 304 | 3300026121 | Ga0207683_10008049 | Ga0207683_100080495 | 169 |
| 305 | 3300026121 | Ga0207683_10311897 | Ga0207683_103118972 | 169 |
| 306 | 3300026142 | Ga0207698_10117086 | Ga0207698_101170862 | 169 |
| 307 | 3300026142 | Ga0207698_10632418 | Ga0207698_106324182 | 169 |
| 308 | 3300028379 | Ga0268266_10225877 | Ga0268266_102258773 | 169 |
| 309 | 3300028379 | Ga0268266_10248485 | Ga0268266_102484853 | 169 |
| 310 | 3300028380 | Ga0268265_11178797 | Ga0268265_111787972 | 169 |
| 311 | 3300028666 | Ga0265336_10001832 | Ga0265336_100018322 | 169 |
| 312 | 3300028800 | Ga0265338_10002851 | Ga0265338_1000285133 | 169 |
| 313 | 3300031456 | Ga0307513_10001546 | Ga0307513_1000154635 | 169 |
| 314 | 3300031456 | Ga0307513_10420902 | Ga0307513_104209022 | 169 |
| 315 | 3300031995 | Ga0307409_101417515 | Ga0307409_1014175152 | 169 |
| 316 | 3300032004 | Ga0307414_10212280 | Ga0307414_102122801 | 169 |
| 317 | 3300033545 | Ga0316214_1003203 | Ga0316214_10032032 | 169 |
| 318 | 3300034816 | Ga0373930_0016153 | Ga0373930_0016153_251_769 | 169 |
| 319 | 3300034817 | Ga0373948_0023219 | Ga0373948_0023219_325_843 | 169 |
| 320 | 3300034817 | Ga0373948_0079454 | Ga0373948_0079454_42_551 | 169 |
| 321 | 3300034818 | Ga0373950_0110196 | Ga0373950_0110196_47_556 | 169 |
| 322 | 3300034957 | Ga0373938_0005876 | Ga0373938_0005876_1093_1602 | 169 |
| 323 | 3300034957 | Ga0373938_0033167 | Ga0373938_0033167_392_910 | 169 |
| 324 | 3300035083 | Ga0373926_0004437 | Ga0373926_0004437_1657_2175 | 169 |
| 325 | 3300035084 | Ga0373928_0008051 | Ga0373928_0008051_718_1227 | 169 |
| 326 | 3300035085 | Ga0373929_0011720 | Ga0373929_0011720_673_1182 | 169 |
| 327 | 3300035085 | Ga0373929_0025076 | Ga0373929_0025076_431_949 | 169 |
| 328 | 3300035086 | Ga0373934_0046027 | Ga0373934_0046027_904_1422 | 169 |
| 329 | 3300035086 | Ga0373934_0057669 | Ga0373934_0057669_88_597 | 169 |
| 330 | 3300035086 | Ga0373934_0088587 | Ga0373934_0088587_159_668 | 169 |
| 331 | 3300035089 | Ga0373944_0000683 | Ga0373944_0000683_2949_3467 | 169 |
| 332 | 3300035091 | Ga0373951_0004816 | Ga0373951_0004816_2198_2716 | 169 |
| 333 | 3300035111 | Ga0373923_0002696 | Ga0373923_0002696_2003_2521 | 169 |
| 334 | 3300035112 | Ga0373932_0134907 | Ga0373932_0134907_65_583 | 169 |
| 335 | 3300035113 | Ga0373936_0000485 | Ga0373936_0000485_11087_11605 | 169 |
| 336 | 3300035113 | Ga0373936_0008641 | Ga0373936_0008641_2054_2572 | 169 |
| 337 | 3300035113 | Ga0373936_0051787 | Ga0373936_0051787_254_772 | 169 |
| 338 | 3300035113 | Ga0373936_0361491 | Ga0373936_0361491_105_623 | 169 |
| 339 | 3300035114 | Ga0373939_0026969 | Ga0373939_0026969_493_1011 | 169 |
| 340 | 3300035115 | Ga0373941_0020865 | Ga0373941_0020865_43_552 | 169 |
| 341 | 3300035115 | Ga0373941_0090433 | Ga0373941_0090433_398_916 | 169 |
| 342 | 3300035116 | Ga0373945_0001625 | Ga0373945_0001625_2579_3097 | 169 |
| 343 | 3300035116 | Ga0373945_0021555 | Ga0373945_0021555_1018_1536 | 169 |
| 344 | 3300035117 | Ga0373953_0032920 | Ga0373953_0032920_60_569 | 169 |
| 345 | 3300035117 | Ga0373953_0044793 | Ga0373953_0044793_214_732 | 169 |
| 346 | 3300035117 | Ga0373953_0081652 | Ga0373953_0081652_721_1230 | 169 |
| 347 | 3300035118 | Ga0373954_0047903 | Ga0373954_0047903_513_1031 | 169 |
| 348 | 3300035119 | Ga0373956_0033589 | Ga0373956_0033589_151_660 | 169 |
| 349 | 3300035119 | Ga0373956_0102325 | Ga0373956_0102325_622_1140 | 169 |
| 350 | 3300035120 | Ga0373957_0015160 | Ga0373957_0015160_930_1448 | 169 |
| 351 | 3300035120 | Ga0373957_0287301 | Ga0373957_0287301_35_544 | 169 |
| 352 | 3300035121 | Ga0373960_0068368 | Ga0373960_0068368_542_1051 | 169 |
| 353 | 3300035170 | Ga0373943_0000727 | Ga0373943_0000727_11456_11974 | 169 |
| 354 | 3300035170 | Ga0373943_0003240 | Ga0373943_0003240_570_1088 | 169 |
| 355 | 3300035170 | Ga0373943_0068541 | Ga0373943_0068541_765_1283 | 169 |
| 356 | 3300035171 | Ga0373946_0007407 | Ga0373946_0007407_159_677 | 169 |
| 357 | 3300035171 | Ga0373946_0010589 | Ga0373946_0010589_1859_2377 | 169 |
| 358 | 3300035171 | Ga0373946_0189440 | Ga0373946_0189440_141_659 | 169 |
| 359 | 3300035172 | Ga0373955_0132913 | Ga0373955_0132913_192_701 | 169 |
| 360 | 3300035172 | Ga0373955_0151209 | Ga0373955_0151209_184_693 | 169 |
| 361 | 3300035410 | Ga0373924_0000149 | Ga0373924_0000149_10459_10977 | 169 |
| 362 | 3300035410 | Ga0373924_0010602 | Ga0373924_0010602_2192_2710 | 169 |
| 363 | 3300035691 | Ga0373931_0029916 | Ga0373931_0029916_1122_1631 | 169 |
| 364 | 3300035691 | Ga0373931_0049099 | Ga0373931_0049099_80_598 | 169 |
| 365 | 3300035692 | Ga0373935_0001103 | Ga0373935_0001103_317_835 | 169 |
| 366 | 3300035692 | Ga0373935_0007573 | Ga0373935_0007573_5248_5757 | 169 |
| 367 | 3300035692 | Ga0373935_0013185 | Ga0373935_0013185_1886_2404 | 169 |
| 368 | 3300035692 | Ga0373935_0343110 | Ga0373935_0343110_277_795 | 169 |
| 369 | 3300035695 | Ga0373927_0002623 | Ga0373927_0002623_6959_7477 | 169 |
| 370 | 3300035695 | Ga0373927_0012837 | Ga0373927_0012837_3881_4399 | 169 |
| 371 | 3300035724 | Ga0373933_0001747 | Ga0373933_0001747_1236_1745 | 169 |
| 372 | 3300035724 | Ga0373933_0008088 | Ga0373933_0008088_2003_2521 | 169 |
| 373 | 3300035724 | Ga0373933_0039696 | Ga0373933_0039696_1151_1660 | 169 |
| 374 | 3300035725 | Ga0373947_0000003 | Ga0373947_0000003_144847_145356 | 169 |
| 375 | 3300035725 | Ga0373947_0001226 | Ga0373947_0001226_1386_1904 | 169 |
| 376 | 3300035725 | Ga0373947_0004858 | Ga0373947_0004858_5507_6025 | 169 |
| 377 | 3300035725 | Ga0373947_0034461 | Ga0373947_0034461_783_1301 | 169 |
| 378 | 3300036401 | Ga0373937_0018561 | Ga0373937_0018561_3074_3583 | 169 |
| 379 | 3300036401 | Ga0373937_0027904 | Ga0373937_0027904_849_1358 | 169 |
| 380 | 3300036401 | Ga0373937_0137202 | Ga0373937_0137202_598_1116 | 169 |
| 381 | 3300036401 | Ga0373937_0192111 | Ga0373937_0192111_1080_1691 | 169 |
| 382 | 3300036401 | Ga0373937_0502716 | Ga0373937_0502716_50_571 | 169 |
| 383 | 3300036459 | Ga0372808_000908 | Ga0372808_000908_302_811 | 169 |
| 384 | 3300036534 | Ga0310109_018425 | Ga0310109_018425_278_787 | 169 |
| 385 | 3300037068 | Ga0373925_0001846 | Ga0373925_0001846_2107_2625 | 169 |
| 386 | 3300037068 | Ga0373925_0011932 | Ga0373925_0011932_1167_1685 | 169 |
| 387 | 3300037068 | Ga0373925_0179371 | Ga0373925_0179371_973_1482 | 169 |
| 388 | 3300037068 | Ga0373925_0563150 | Ga0373925_0563150_213_731 | 169 |
| 389 | 3300039450 | Ga0436363_0776709 | Ga0436363_0776709_131_649 | 169 |
| 390 | 3300041505 | Ga0451849_0604238 | Ga0451849_0604238_91_600 | 169 |
| 391 | 3300044694 | Ga0466963_0147263 | Ga0466963_0147263_675_1193 | 169 |
| 392 | 3300044706 | Ga0466964_0028775 | Ga0466964_0028775_1291_1809 | 169 |
| 393 | 3300045049 | Ga0466959_0099868 | Ga0466959_0099868_399_938 | 169 |
| 394 | 3300045836 | Ga0466958_0220794 | Ga0466958_0220794_62_601 | 169 |
| 395 | 3300045976 | Ga0466967_0039255 | Ga0466967_0039255_2277_2795 | 169 |
| 396 | 3300045976 | Ga0466967_0078465 | Ga0466967_0078465_1997_2506 | 169 |
| 397 | 3300046454 | Ga0495592_0067251 | Ga0495592_0067251_247_756 | 169 |
| 398 | 3300046454 | Ga0495592_0207212 | Ga0495592_0207212_622_1140 | 169 |
| 399 | 3300046455 | Ga0495603_0001384 | Ga0495603_0001384_1105_1623 | 169 |
| 400 | 3300046459 | Ga0495629_0060604 | Ga0495629_0060604_826_1344 | 169 |
| 401 | 3300046459 | Ga0495629_0313156 | Ga0495629_0313156_372_890 | 169 |
| 402 | 3300046462 | Ga0495651_0006624 | Ga0495651_0006624_2689_3198 | 169 |
| 403 | 3300046462 | Ga0495651_0008458 | Ga0495651_0008458_273_782 | 169 |
| 404 | 3300046462 | Ga0495651_0053856 | Ga0495651_0053856_2074_2592 | 169 |
| 405 | 3300046463 | Ga0495653_0000860 | Ga0495653_0000860_5539_6048 | 169 |
| 406 | 3300046463 | Ga0495653_0001704 | Ga0495653_0001704_13902_14420 | 169 |
| 407 | 3300046463 | Ga0495653_0009010 | Ga0495653_0009010_5776_6294 | 169 |
| 408 | 3300046463 | Ga0495653_0019571 | Ga0495653_0019571_484_993 | 169 |
| 409 | 3300046472 | Ga0495580_0044897 | Ga0495580_0044897_475_993 | 169 |
| 410 | 3300046472 | Ga0495580_0778062 | Ga0495580_0778062_18_536 | 169 |
| 411 | 3300046473 | Ga0495582_0000407 | Ga0495582_0000407_3524_4042 | 169 |
| 412 | 3300046473 | Ga0495582_0034197 | Ga0495582_0034197_2128_2646 | 169 |
| 413 | 3300046475 | Ga0495639_0000391 | Ga0495639_0000391_16867_17385 | 169 |
| 414 | 3300046475 | Ga0495639_0033585 | Ga0495639_0033585_1572_2090 | 169 |
| 415 | 3300046476 | Ga0495662_0000493 | Ga0495662_0000493_17308_17826 | 169 |
| 416 | 3300046476 | Ga0495662_0005884 | Ga0495662_0005884_4727_5245 | 169 |
| 417 | 3300046477 | Ga0495664_0002387 | Ga0495664_0002387_505_1023 | 169 |
| 418 | 3300046477 | Ga0495664_0213228 | Ga0495664_0213228_221_730 | 169 |
| 419 | 3300046499 | Ga0495594_0020198 | Ga0495594_0020198_268_786 | 169 |
| 420 | 3300046511 | Ga0495608_0016466 | Ga0495608_0016466_2711_3220 | 169 |
| 421 | 3300046514 | Ga0495618_0010578 | Ga0495618_0010578_2869_3387 | 169 |
| 422 | 3300046514 | Ga0495618_0016668 | Ga0495618_0016668_2003_2521 | 169 |
| 423 | 3300046514 | Ga0495618_0250874 | Ga0495618_0250874_440_949 | 169 |
| 424 | 3300046516 | Ga0495628_0011251 | Ga0495628_0011251_3654_4172 | 169 |
| 425 | 3300046516 | Ga0495628_0045480 | Ga0495628_0045480_1705_2214 | 169 |
| 426 | 3300046516 | Ga0495628_0210601 | Ga0495628_0210601_842_1351 | 169 |
| 427 | 3300046517 | Ga0495630_0024109 | Ga0495630_0024109_2003_2521 | 169 |
| 428 | 3300046517 | Ga0495630_0154400 | Ga0495630_0154400_881_1399 | 169 |
| 429 | 3300046526 | Ga0495666_0002579 | Ga0495666_0002579_7325_7843 | 169 |
| 430 | 3300046529 | Ga0495652_0002162 | Ga0495652_0002162_15123_15632 | 169 |
| 431 | 3300046529 | Ga0495652_0004111 | Ga0495652_0004111_3136_3645 | 169 |
| 432 | 3300046529 | Ga0495652_0089883 | Ga0495652_0089883_929_1447 | 169 |
| 433 | 3300046529 | Ga0495652_0231837 | Ga0495652_0231837_211_729 | 169 |
| 434 | 3300046531 | Ga0495665_0000203 | Ga0495665_0000203_26060_26578 | 169 |
| 435 | 3300046531 | Ga0495665_0017134 | Ga0495665_0017134_2590_3108 | 169 |
| 436 | 3300046533 | Ga0495640_0000775 | Ga0495640_0000775_2571_3089 | 169 |
| 437 | 3300046533 | Ga0495640_0035189 | Ga0495640_0035189_1221_1730 | 169 |
| 438 | 3300046535 | Ga0495586_0003951 | Ga0495586_0003951_7398_7916 | 169 |
| 439 | 3300046536 | Ga0495587_0024731 | Ga0495587_0024731_1232_1750 | 169 |
| 440 | 3300046536 | Ga0495587_0025861 | Ga0495587_0025861_1303_1812 | 169 |
| 441 | 3300046536 | Ga0495587_0083353 | Ga0495587_0083353_1129_1647 | 169 |
| 442 | 3300046536 | Ga0495587_0145785 | Ga0495587_0145785_116_625 | 169 |
| 443 | 3300046543 | Ga0495645_0002225 | Ga0495645_0002225_10296_10814 | 169 |
| 444 | 3300046543 | Ga0495645_0033031 | Ga0495645_0033031_154_672 | 169 |
| 445 | 3300046543 | Ga0495645_0594651 | Ga0495645_0594651_135_644 | 169 |
| 446 | 3300046557 | Ga0495622_0108705 | Ga0495622_0108705_150_668 | 169 |
| 447 | 3300046559 | Ga0495667_0000438 | Ga0495667_0000438_13439_13948 | 169 |
| 448 | 3300046559 | Ga0495667_0003068 | Ga0495667_0003068_3441_3959 | 169 |
| 449 | 3300046559 | Ga0495667_0013204 | Ga0495667_0013204_1902_2420 | 169 |
| 450 | 3300046642 | Ga0495634_0021968 | Ga0495634_0021968_2720_3238 | 169 |
| 451 | 3300046663 | Ga0495635_0001463 | Ga0495635_0001463_11871_12389 | 169 |
| 452 | 3300046663 | Ga0495635_0012246 | Ga0495635_0012246_902_1420 | 169 |
| 453 | 3300046674 | Ga0495588_0026823 | Ga0495588_0026823_2182_2700 | 169 |
| 454 | 3300046675 | Ga0495657_0001503 | Ga0495657_0001503_16881_17390 | 169 |
| 455 | 3300046675 | Ga0495657_0012738 | Ga0495657_0012738_1754_2272 | 169 |
| 456 | 3300046675 | Ga0495657_0014590 | Ga0495657_0014590_4712_5230 | 169 |
| 457 | 3300046675 | Ga0495657_0031213 | Ga0495657_0031213_1004_1513 | 169 |
| 458 | 3300046678 | Ga0495599_0012859 | Ga0495599_0012859_151_669 | 169 |
| 459 | 3300046678 | Ga0495599_0134135 | Ga0495599_0134135_864_1373 | 169 |
| 460 | 3300046678 | Ga0495599_0191664 | Ga0495599_0191664_187_705 | 169 |
| 461 | 3300046679 | Ga0495623_0021062 | Ga0495623_0021062_3231_3740 | 169 |
| 462 | 3300046679 | Ga0495623_0133953 | Ga0495623_0133953_673_1191 | 169 |
| 463 | 3300046679 | Ga0495623_0142783 | Ga0495623_0142783_725_1234 | 169 |
| 464 | 3300046680 | Ga0495646_0002110 | Ga0495646_0002110_9273_9791 | 169 |
| 465 | 3300046680 | Ga0495646_0015564 | Ga0495646_0015564_2600_3109 | 169 |
| 466 | 3300046683 | Ga0495658_0014557 | Ga0495658_0014557_109_627 | 169 |
| 467 | 3300046683 | Ga0495658_0238010 | Ga0495658_0238010_534_1052 | 169 |
| 468 | 3300046689 | Ga0495613_0003348 | Ga0495613_0003348_3374_3892 | 169 |
| 469 | 3300046689 | Ga0495613_0557966 | Ga0495613_0557966_53_562 | 169 |
| 470 | 3300046690 | Ga0495624_0013486 | Ga0495624_0013486_4733_5251 | 169 |
| 471 | 3300046690 | Ga0495624_0015402 | Ga0495624_0015402_2686_3204 | 169 |
| 472 | 3300046690 | Ga0495624_0601487 | Ga0495624_0601487_87_596 | 169 |
| 473 | 3300046809 | Ga0495600_0024821 | Ga0495600_0024821_781_1290 | 169 |
| 474 | 3300046809 | Ga0495600_0741528 | Ga0495600_0741528_50_568 | 169 |
| 475 | 3300047315 | Ga0495581_0000558 | Ga0495581_0000558_16804_17322 | 169 |
| 476 | 3300047315 | Ga0495581_0083744 | Ga0495581_0083744_837_1355 | 169 |
| 477 | 3300047317 | Ga0495604_0053376 | Ga0495604_0053376_1806_2333 | 169 |
| 478 | 3300047317 | Ga0495604_0093443 | Ga0495604_0093443_147_665 | 169 |
| 479 | 3300047319 | Ga0495674_0000802 | Ga0495674_0000802_12421_12939 | 169 |
| 480 | 3300047319 | Ga0495674_0011335 | Ga0495674_0011335_4497_5015 | 169 |
| 481 | 3300047319 | Ga0495674_0019380 | Ga0495674_0019380_1816_2325 | 169 |
| 482 | 3300047319 | Ga0495674_0426360 | Ga0495674_0426360_399_908 | 169 |
| 483 | 3300047321 | Ga0495676_0021052 | Ga0495676_0021052_1263_1781 | 169 |
| 484 | 3300047321 | Ga0495676_0044476 | Ga0495676_0044476_1569_2087 | 169 |
| 485 | 3300047322 | Ga0495680_0004275 | Ga0495680_0004275_12589_13098 | 169 |
| 486 | 3300047322 | Ga0495680_0007158 | Ga0495680_0007158_3654_4172 | 169 |
| 487 | 3300047322 | Ga0495680_0018970 | Ga0495680_0018970_5163_5681 | 169 |
| 488 | 3300047444 | Ga0495675_0011986 | Ga0495675_0011986_4761_5270 | 169 |
| 489 | 3300047444 | Ga0495675_0022936 | Ga0495675_0022936_2719_3237 | 169 |
| 490 | 3300047444 | Ga0495675_0083184 | Ga0495675_0083184_725_1234 | 169 |
| 491 | 3300047444 | Ga0495675_0448575 | Ga0495675_0448575_14_532 | 169 |
| 492 | 3300047471 | Ga0495684_0002672 | Ga0495684_0002672_4749_5267 | 169 |
| 493 | 3300047471 | Ga0495684_0015029 | Ga0495684_0015029_2003_2521 | 169 |
| 494 | 3300047471 | Ga0495684_0027388 | Ga0495684_0027388_347_856 | 169 |
| 495 | 3300047673 | Ga0495593_0002039 | Ga0495593_0002039_10448_10966 | 169 |
| 496 | 3300047673 | Ga0495593_0015945 | Ga0495593_0015945_1859_2377 | 169 |
| 497 | 3300048088 | Ga0495602_0015587 | Ga0495602_0015587_2723_3232 | 169 |
| 498 | 3300048088 | Ga0495602_0021484 | Ga0495602_0021484_2819_3328 | 169 |
| 499 | 3300048088 | Ga0495602_0033234 | Ga0495602_0033234_1754_2272 | 169 |
| 500 | 3300048088 | Ga0495602_0567336 | Ga0495602_0567336_143_661 | 169 |
| 501 | 3300048089 | Ga0495614_0004672 | Ga0495614_0004672_3548_4066 | 169 |
| 502 | 3300048903 | Ga0496100_0269563 | Ga0496100_0269563_52_561 | 169 |
| 503 | 3300048903 | Ga0496100_0464663 | Ga0496100_0464663_216_725 | 169 |
| 504 | 3300048904 | Ga0496101_0206076 | Ga0496101_0206076_916_1428 | 169 |
| 505 | 3300048904 | Ga0496101_0301856 | Ga0496101_0301856_366_875 | 169 |
| 506 | 3300048904 | Ga0496101_0322407 | Ga0496101_0322407_367_876 | 169 |
| 507 | 3300048905 | Ga0496102_0149392 | Ga0496102_0149392_826_1338 | 169 |
| 508 | 3300048907 | Ga0496104_0005096 | Ga0496104_0005096_5785_6294 | 169 |
| 509 | 3300048907 | Ga0496104_0051267 | Ga0496104_0051267_1484_1993 | 169 |
| 510 | 3300048907 | Ga0496104_0090332 | Ga0496104_0090332_1256_1774 | 169 |
| 511 | 3300048907 | Ga0496104_0121879 | Ga0496104_0121879_566_1075 | 169 |
| 512 | 3300048907 | Ga0496104_0316545 | Ga0496104_0316545_430_939 | 169 |
| 513 | 3300048907 | Ga0496104_0389303 | Ga0496104_0389303_473_985 | 169 |
| 514 | 3300048907 | Ga0496104_0532498 | Ga0496104_0532498_415_933 | 169 |
| 515 | 3300048908 | Ga0496105_0020894 | Ga0496105_0020894_4152_4664 | 169 |
| 516 | 3300048908 | Ga0496105_0035872 | Ga0496105_0035872_1122_1631 | 169 |
| 517 | 3300048908 | Ga0496105_0267089 | Ga0496105_0267089_356_865 | 169 |
| 518 | 3300048908 | Ga0496105_0360126 | Ga0496105_0360126_389_898 | 169 |
| 519 | 3300048908 | Ga0496105_0399877 | Ga0496105_0399877_185_694 | 169 |
| 520 | 3300048908 | Ga0496105_0525905 | Ga0496105_0525905_83_601 | 169 |
| 521 | 3300048909 | Ga0496106_0049792 | Ga0496106_0049792_2116_2625 | 169 |
| 522 | 3300048910 | Ga0496107_0134612 | Ga0496107_0134612_116_625 | 169 |
| 523 | 3300048910 | Ga0496107_0449392 | Ga0496107_0449392_113_622 | 169 |
| 524 | 3300048911 | Ga0496108_0083473 | Ga0496108_0083473_1773_2282 | 169 |
| 525 | 3300048911 | Ga0496108_0105849 | Ga0496108_0105849_1200_1718 | 169 |
| 526 | 3300048911 | Ga0496108_0116442 | Ga0496108_0116442_1341_1850 | 169 |
| 527 | 3300048911 | Ga0496108_0132480 | Ga0496108_0132480_119_631 | 169 |
| 528 | 3300048912 | Ga0496109_0064709 | Ga0496109_0064709_219_737 | 169 |
| 529 | 3300048912 | Ga0496109_0126985 | Ga0496109_0126985_887_1396 | 169 |
| 530 | 3300048912 | Ga0496109_0296510 | Ga0496109_0296510_656_1165 | 169 |
| 531 | 3300048912 | Ga0496109_0440299 | Ga0496109_0440299_613_1122 | 169 |
| 532 | 3300048912 | Ga0496109_1199885 | Ga0496109_1199885_134_646 | 169 |
| 533 | 3300048913 | Ga0496110_0139997 | Ga0496110_0139997_1399_1911 | 169 |
| 534 | 3300048913 | Ga0496110_0206902 | Ga0496110_0206902_1112_1630 | 169 |
| 535 | 3300048913 | Ga0496110_0414277 | Ga0496110_0414277_668_1177 | 169 |
| 536 | 3300048913 | Ga0496110_0493055 | Ga0496110_0493055_245_754 | 169 |
| 537 | 3300048913 | Ga0496110_0915181 | Ga0496110_0915181_95_604 | 169 |
| 538 | 3300048914 | Ga0496111_0355233 | Ga0496111_0355233_98_607 | 169 |
| 539 | 3300048914 | Ga0496111_0575614 | Ga0496111_0575614_240_752 | 169 |
| 540 | 3300048915 | Ga0496112_0037816 | Ga0496112_0037816_359_868 | 169 |
| 541 | 3300048915 | Ga0496112_0179302 | Ga0496112_0179302_132_641 | 169 |
| 542 | 3300048915 | Ga0496112_0397218 | Ga0496112_0397218_443_961 | 169 |
| 543 | 3300048915 | Ga0496112_0663093 | Ga0496112_0663093_352_861 | 169 |
| 544 | 3300048915 | Ga0496112_0850049 | Ga0496112_0850049_90_608 | 169 |
| 545 | 3300048915 | Ga0496112_1435255 | Ga0496112_1435255_32_550 | 169 |
| 546 | 3300048916 | Ga0496113_0093470 | Ga0496113_0093470_1176_1685 | 169 |
| 547 | 3300048916 | Ga0496113_0363895 | Ga0496113_0363895_153_671 | 169 |
| 548 | 3300048917 | Ga0496114_0007721 | Ga0496114_0007721_2081_2593 | 169 |
| 549 | 3300048917 | Ga0496114_0114375 | Ga0496114_0114375_1138_1647 | 169 |
| 550 | 3300048917 | Ga0496114_0239038 | Ga0496114_0239038_706_1215 | 169 |
| 551 | 3300048917 | Ga0496114_0416722 | Ga0496114_0416722_587_1096 | 169 |
| 552 | 3300048917 | Ga0496114_0710817 | Ga0496114_0710817_306_824 | 169 |
| 553 | 3300048918 | Ga0496115_0034348 | Ga0496115_0034348_3413_3922 | 169 |
| 554 | 3300048918 | Ga0496115_0067897 | Ga0496115_0067897_991_1500 | 169 |
| 555 | 3300048918 | Ga0496115_0163963 | Ga0496115_0163963_514_1032 | 169 |
| 556 | 3300048918 | Ga0496115_0254671 | Ga0496115_0254671_516_1025 | 169 |
| 557 | 3300048918 | Ga0496115_0332316 | Ga0496115_0332316_394_903 | 169 |
| 558 | 3300048922 | Ga0496119_0038268 | Ga0496119_0038268_2460_2969 | 169 |
| 559 | 3300048929 | Ga0496126_0637055 | Ga0496126_0637055_277_795 | 169 |
| 560 | 3300049582 | Ga0501048_0852785 | Ga0501048_0852785_88_597 | 169 |
| 561 | 3300049588 | Ga0501072_0531112 | Ga0501072_0531112_22_531 | 169 |
| 562 | 3300050509 | nmdc:mga0qj67_263500_c1 | nmdc:mga0qj67_263500_c1_14_523 | 169 |
| 563 | 3300050512 | nmdc:mga0n895_85576_c1 | nmdc:mga0n895_85576_c1_1100_1618 | 169 |
| 564 | 3300050514 | nmdc:mga08x19_101779_c1 | nmdc:mga08x19_101779_c1_1134_1652 | 169 |
| 565 | 3300050514 | nmdc:mga08x19_454042_c1 | nmdc:mga08x19_454042_c1_292_810 | 169 |
| 566 | 3300053077 | Ga0495601_0024576 | Ga0495601_0024576_1191_1709 | 169 |
| 567 | 3300053077 | Ga0495601_0163482 | Ga0495601_0163482_577_1086 | 169 |
| 568 | 3300053077 | Ga0495601_0504979 | Ga0495601_0504979_133_651 | 169 |
| 569 | 3300053078 | Ga0495612_0061681 | Ga0495612_0061681_484_1002 | 169 |
| 570 | 3300053078 | Ga0495612_0084120 | Ga0495612_0084120_188_715 | 169 |
| 571 | 3300053084 | Ga0495595_0017261 | Ga0495595_0017261_386_913 | 169 |
| 572 | 3300053153 | Ga0500616_0000144 | Ga0500616_0000144_76680_77195 | 169 |
| 573 | 3300060353 | Ga0501082_0360661 | Ga0501082_0360661_473_982 | 169 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2p1a-assembly1.cif.gz_B | crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution | 0.776 | 16 | 169 |
| 6iz2-assembly1.cif.gz_A | crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 | 0.7729 | 10 | 169 |
| 2p1a-assembly1.cif.gz_B | crystal structure of a putative metal-binding protein (bce_2162) from bacillus cereus atcc 10987 at 2.10 a resolution | 0.7582 | 16 | 169 |
| 2qe9-assembly1.cif.gz_B | crystal structure of a putative metal-dependent hydrolase (yiza, bsu10800) from bacillus subtilis at 1.90 a resolution | 0.7553 | 10 | 158 |
| 6iz2-assembly1.cif.gz_A | crystal structure of dinb/yfit protein dr0053 from d. radiodurans r1 | 0.7543 | 10 | 169 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qe9B01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7911 | 19 | 158 | 1.20.120.450 |
| 2hkvA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7846 | 11 | 162 | 1.20.120.450 |
| 2hkvA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7646 | 11 | 162 | 1.20.120.450 |
| 3dkaA01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7342 | 18 | 162 | 1.20.120.450 |
| af_P71985_5_134_1.20.120.450 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7327 | 19 | 160 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A542F4Q5-F1-model_v4 | deleted | 0.9735 | 3 | 169 |
|
| AF-A0A4V2YNK7-F1-model_v4 | DUF664 domain-containing protein | 0.9726 | 5 | 169 |
|
| AF-A0A543L3Z0-F1-model_v4 | deleted | 0.9715 | 4 | 169 |
|
| AF-A0A1I1E275-F1-model_v4 | deleted | 0.9698 | 4 | 169 |
|
| AF-A0A6N3K1K1-F1-model_v4 | DinB family protein | 0.9652 | 1 | 169 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar