F465192
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 573 | 320 | 563 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300026118|Ga0207675_100279112|Ga0207675_1002791123 |
| Length | 84 |
| Sequence | VARRKTQPIISPDEVETLIRKGIPDAVVEITDLAGDGDHYAARVIAESFRGQTRLERQRRVYDALGGRMGGELHALQLSTAVPD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2775507255 | Sphingobium indicum B90A | Isolate | Rhizosphere |
| 3 | 2808606401 | Sphingobium sp. AEW010 | Isolate | Rhizosphere |
| 4 | 2808606404 | Sphingobium sp. AEW013 | Isolate | Rhizosphere |
| 5 | 2808606405 | Sphingobium sp. AEW001 | Isolate | Rhizosphere |
| 6 | 2880518877 | Sphingobium sp. JAI105 | Isolate | Rhizosphere |
| 7 | 2919709256 | Sphingobium xenophagum 4256 | Isolate | Unclassified |
| 8 | 2928027323 | Sphingomonas sp. 1185 | Isolate | Unclassified |
| 9 | 2984555340 | Sphingomonas sp. SORGH_AS789 | Isolate | Aerial Root |
| 10 | 2984564862 | Sphingomonas sp. SORGH_AS870 | Isolate | Aerial Root |
| 11 | 2993356040 | Sphingomonas sp. SORGH_AS742 | Isolate | Aerial Root |
| 12 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 13 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 14 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 15 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 19 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 20 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 21 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 22 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 23 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 24 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 25 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 26 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 27 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 28 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 29 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 30 | 3300004785 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 31 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 32 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 33 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 37 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 40 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 44 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 83 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 87 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 88 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009978 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG | Metagenome | Rhizosphere |
| 105 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 119 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 120 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 121 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 123 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 124 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 125 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 164 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 167 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 168 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 169 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 170 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 173 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 174 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 175 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 176 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 179 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 180 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 183 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 184 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 187 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 188 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 192 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 193 | 3300041462 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG | Metagenome | Rhizoplane |
| 194 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 195 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 197 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 198 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 199 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 200 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 201 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 202 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 203 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 204 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 205 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 206 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 207 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 208 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 209 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 210 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 211 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 212 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 213 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 214 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 215 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 216 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 217 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 218 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 219 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 220 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 221 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 242 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 245 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 246 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 247 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 250 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 251 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 252 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 253 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 254 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 255 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 256 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 257 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 263 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 264 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 265 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049552 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 274 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 277 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 278 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 281 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 283 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 284 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 285 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 286 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 287 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 288 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049850 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 295 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 296 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 298 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 299 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 301 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 302 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 304 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 306 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 307 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 308 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 309 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 310 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 311 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 312 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 313 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 314 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 316 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 317 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 318 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 320 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.81 |
| Metatranscriptomes | 2.44 |
| Isolates | 1.75 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.52 |
| Bulb | 0 |
| Endosphere | 10.99 |
| Nodule | 0.7 |
| Rhizoplane | 2.79 |
| Rhizosphere | 76.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.03 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1292634 | 2162886007 | Bacteria | 2441 |
| 2 | SwRhRL2b_contig_453878 | 2162886007 | Bacteria | 5693 |
| 3 | JGI24736J21556_1000032 | 3300001904 | Bacteria | 24066 |
| 4 | JGI24741J21665_1012703 | 3300001915 | Bacteria | 1441 |
| 5 | JGI24752J21851_1000082 | 3300001976 | Bacteria | 12689 |
| 6 | JGI24740J21852_10005188 | 3300001979 | Bacteria | 5530 |
| 7 | JGI24740J21852_10042720 | 3300001979 | Bacteria | 1357 |
| 8 | JGI24739J22299_10000162 | 3300001989 | Bacteria | 21912 |
| 9 | JGI24739J22299_10007626 | 3300001989 | Bacteria | 4050 |
| 10 | JGI24739J22299_10025324 | 3300001989 | Bacteria | 2087 |
| 11 | JGI24737J22298_10030621 | 3300001990 | Bacteria | 1683 |
| 12 | JGI24737J22298_10144534 | 3300001990 | Bacteria | 702 |
| 13 | JGI24735J21928_10043770 | 3300002067 | Bacteria | 1301 |
| 14 | JGI24750J21931_1000116 | 3300002070 | Bacteria | 12611 |
| 15 | JGI24748J21848_1000036 | 3300002074 | Bacteria | 72512 |
| 16 | JGI24738J21930_10061342 | 3300002075 | Bacteria | 772 |
| 17 | JGI24034J26672_10000008 | 3300002239 | Bacteria | 200986 |
| 18 | JGI24034J26672_10000038 | 3300002239 | Bacteria | 75372 |
| 19 | JGI24742J22300_10005496 | 3300002244 | Bacteria | 2085 |
| 20 | JGI24751J29686_10006267 | 3300002459 | Bacteria | 2424 |
| 21 | JGI25153J46596_10058825 | 3300003215 | Bacteria | 1055 |
| 22 | rootH1_10052320 | 3300003316 | Bacteria | 2199 |
| 23 | rootL2_10067350 | 3300003322 | Bacteria | 1217 |
| 24 | Ga0055530_10000085 | 3300003791 | Bacteria | 80382 |
| 25 | Ga0055531_10004719 | 3300003794 | Bacteria | 8152 |
| 26 | Ga0058858_1328787 | 3300004785 | Bacteria | 504 |
| 27 | Ga0058861_11824849 | 3300004800 | Bacteria | 836 |
| 28 | Ga0065704_10001612 | 3300005289 | Bacteria | 10250 |
| 29 | Ga0065704_10336440 | 3300005289 | Bacteria | 830 |
| 30 | Ga0065707_10098261 | 3300005295 | Bacteria | 3099 |
| 31 | Ga0070658_10000479 | 3300005327 | Bacteria | 34657 |
| 32 | Ga0070658_10040826 | 3300005327 | Bacteria | 3744 |
| 33 | Ga0070658_10527204 | 3300005327 | Bacteria | 1021 |
| 34 | Ga0070683_101174001 | 3300005329 | Bacteria | 737 |
| 35 | Ga0070690_100000021 | 3300005330 | Bacteria | 74350 |
| 36 | Ga0070670_100426848 | 3300005331 | Bacteria | 1172 |
| 37 | Ga0070670_100470703 | 3300005331 | Bacteria | 1115 |
| 38 | Ga0070670_101291983 | 3300005331 | Bacteria | 668 |
| 39 | Ga0070677_10547462 | 3300005333 | Bacteria | 634 |
| 40 | Ga0068869_100085290 | 3300005334 | Bacteria | 2365 |
| 41 | Ga0070666_10000004 | 3300005335 | Bacteria | 372098 |
| 42 | Ga0070666_10489205 | 3300005335 | Bacteria | 891 |
| 43 | Ga0070666_11000847 | 3300005335 | Bacteria | 620 |
| 44 | Ga0070680_100037964 | 3300005336 | Bacteria | 3894 |
| 45 | Ga0070682_100178661 | 3300005337 | Bacteria | 1481 |
| 46 | Ga0068868_100531566 | 3300005338 | Bacteria | 1034 |
| 47 | Ga0068868_102076391 | 3300005338 | Bacteria | 540 |
| 48 | Ga0070660_100003716 | 3300005339 | Bacteria | 10542 |
| 49 | Ga0070660_100004174 | 3300005339 | Bacteria | 9975 |
| 50 | Ga0070660_100075067 | 3300005339 | Bacteria | 2646 |
| 51 | Ga0070660_100299308 | 3300005339 | Bacteria | 1319 |
| 52 | Ga0070661_100000006 | 3300005344 | Bacteria | 216544 |
| 53 | Ga0070668_100041820 | 3300005347 | Bacteria | 3511 |
| 54 | Ga0070668_100063512 | 3300005347 | Bacteria | 2862 |
| 55 | Ga0070668_100288829 | 3300005347 | Bacteria | 1372 |
| 56 | Ga0070668_100518306 | 3300005347 | Bacteria | 1034 |
| 57 | Ga0070669_100000457 | 3300005353 | Bacteria | 31025 |
| 58 | Ga0070669_100123994 | 3300005353 | Bacteria | 1975 |
| 59 | Ga0070669_100124866 | 3300005353 | Bacteria | 1968 |
| 60 | Ga0070669_100380358 | 3300005353 | Bacteria | 1151 |
| 61 | Ga0070669_100849183 | 3300005353 | Bacteria | 778 |
| 62 | Ga0070675_100660928 | 3300005354 | Bacteria | 950 |
| 63 | Ga0070675_101271671 | 3300005354 | Bacteria | 678 |
| 64 | Ga0070675_101723332 | 3300005354 | Bacteria | 578 |
| 65 | Ga0070671_100017053 | 3300005355 | Bacteria | 5875 |
| 66 | Ga0070671_100060705 | 3300005355 | Bacteria | 3148 |
| 67 | Ga0070674_100041961 | 3300005356 | Bacteria | 3105 |
| 68 | Ga0070659_100035203 | 3300005366 | Bacteria | 3899 |
| 69 | Ga0070667_100000089 | 3300005367 | Bacteria | 113661 |
| 70 | Ga0070667_100010059 | 3300005367 | Bacteria | 7835 |
| 71 | Ga0070663_100129274 | 3300005455 | Bacteria | 1916 |
| 72 | Ga0070663_101778169 | 3300005455 | Bacteria | 552 |
| 73 | Ga0070678_101949883 | 3300005456 | Bacteria | 555 |
| 74 | Ga0070662_100112452 | 3300005457 | Bacteria | 2076 |
| 75 | Ga0070662_100152711 | 3300005457 | Bacteria | 1799 |
| 76 | Ga0070662_100223039 | 3300005457 | Bacteria | 1505 |
| 77 | Ga0070662_100350139 | 3300005457 | Bacteria | 1210 |
| 78 | Ga0070681_10379155 | 3300005458 | Bacteria | 1325 |
| 79 | Ga0070681_10552789 | 3300005458 | Bacteria | 1065 |
| 80 | Ga0070685_10000724 | 3300005466 | Bacteria | 17961 |
| 81 | Ga0070707_102122948 | 3300005468 | Bacteria | 529 |
| 82 | Ga0070698_100589375 | 3300005471 | Bacteria | 1052 |
| 83 | Ga0070679_100000001 | 3300005530 | Bacteria | 764811 |
| 84 | Ga0070679_101893626 | 3300005530 | Bacteria | 545 |
| 85 | Ga0068853_100000825 | 3300005539 | Bacteria | 21651 |
| 86 | Ga0068853_100773978 | 3300005539 | Bacteria | 918 |
| 87 | Ga0068853_101516668 | 3300005539 | Bacteria | 649 |
| 88 | Ga0068853_101579703 | 3300005539 | Bacteria | 635 |
| 89 | Ga0068853_101628703 | 3300005539 | Bacteria | 625 |
| 90 | Ga0070686_100000012 | 3300005544 | Bacteria | 176038 |
| 91 | Ga0070686_101490742 | 3300005544 | Bacteria | 570 |
| 92 | Ga0070696_100537433 | 3300005546 | Bacteria | 935 |
| 93 | Ga0070693_101029673 | 3300005547 | Bacteria | 624 |
| 94 | Ga0070665_100000004 | 3300005548 | Bacteria | 785500 |
| 95 | Ga0070665_100455638 | 3300005548 | Bacteria | 1289 |
| 96 | Ga0070665_101748961 | 3300005548 | Bacteria | 629 |
| 97 | Ga0068855_100000023 | 3300005563 | Bacteria | 190440 |
| 98 | Ga0068855_100233728 | 3300005563 | Bacteria | 2057 |
| 99 | Ga0068855_100395754 | 3300005563 | Bacteria | 1515 |
| 100 | Ga0070664_100964425 | 3300005564 | Bacteria | 801 |
| 101 | Ga0068857_100034254 | 3300005577 | Bacteria | 4491 |
| 102 | Ga0068857_100089221 | 3300005577 | Bacteria | 2758 |
| 103 | Ga0068857_100202528 | 3300005577 | Bacteria | 1809 |
| 104 | Ga0068857_100322020 | 3300005577 | Bacteria | 1428 |
| 105 | Ga0068857_100977674 | 3300005577 | Bacteria | 814 |
| 106 | Ga0068857_100987882 | 3300005577 | Bacteria | 810 |
| 107 | Ga0068854_100013420 | 3300005578 | Bacteria | 5377 |
| 108 | Ga0068854_100075543 | 3300005578 | Bacteria | 2474 |
| 109 | Ga0068854_100095718 | 3300005578 | Bacteria | 2217 |
| 110 | Ga0068854_100178512 | 3300005578 | Bacteria | 1657 |
| 111 | Ga0068854_101280455 | 3300005578 | Bacteria | 659 |
| 112 | Ga0068856_100404112 | 3300005614 | Bacteria | 1385 |
| 113 | Ga0070702_101132897 | 3300005615 | Bacteria | 627 |
| 114 | Ga0068852_100003329 | 3300005616 | Bacteria | 11220 |
| 115 | Ga0068852_100055224 | 3300005616 | Bacteria | 3427 |
| 116 | Ga0068852_100086148 | 3300005616 | Bacteria | 2800 |
| 117 | Ga0068852_100447063 | 3300005616 | Bacteria | 1279 |
| 118 | Ga0068852_100748638 | 3300005616 | Bacteria | 989 |
| 119 | Ga0068852_102813159 | 3300005616 | Bacteria | 505 |
| 120 | Ga0068859_100028374 | 3300005617 | Bacteria | 5611 |
| 121 | Ga0068859_100206389 | 3300005617 | Bacteria | 2050 |
| 122 | Ga0068859_101398327 | 3300005617 | Bacteria | 772 |
| 123 | Ga0068864_100005620 | 3300005618 | Bacteria | 10277 |
| 124 | Ga0068864_100007081 | 3300005618 | Bacteria | 9208 |
| 125 | Ga0068864_101499993 | 3300005618 | Bacteria | 677 |
| 126 | Ga0068861_100020681 | 3300005719 | Bacteria | 4718 |
| 127 | Ga0068861_100285888 | 3300005719 | Bacteria | 1422 |
| 128 | Ga0068851_10062982 | 3300005834 | Bacteria | 1904 |
| 129 | Ga0068851_10064379 | 3300005834 | Bacteria | 1884 |
| 130 | Ga0068863_100000013 | 3300005841 | Bacteria | 220357 |
| 131 | Ga0068863_100002259 | 3300005841 | Bacteria | 19135 |
| 132 | Ga0068863_100238697 | 3300005841 | Bacteria | 1754 |
| 133 | Ga0068858_100053891 | 3300005842 | Bacteria | 3719 |
| 134 | Ga0068858_100337482 | 3300005842 | Bacteria | 1442 |
| 135 | Ga0068860_100000009 | 3300005843 | Bacteria | 372089 |
| 136 | Ga0068860_100000148 | 3300005843 | Bacteria | 113661 |
| 137 | Ga0068860_100257834 | 3300005843 | Bacteria | 1699 |
| 138 | Ga0068860_102150248 | 3300005843 | Bacteria | 579 |
| 139 | Ga0068862_100000209 | 3300005844 | Bacteria | 65440 |
| 140 | Ga0068862_100481286 | 3300005844 | Bacteria | 1175 |
| 141 | Ga0068862_100869340 | 3300005844 | Bacteria | 885 |
| 142 | Ga0081539_10009010 | 3300005985 | Bacteria | 8478 |
| 143 | Ga0075365_10513913 | 3300006038 | Bacteria | 847 |
| 144 | Ga0075368_10000385 | 3300006042 | Bacteria | 12968 |
| 145 | Ga0075363_100005439 | 3300006048 | Bacteria | 5665 |
| 146 | Ga0075363_100332179 | 3300006048 | Bacteria | 885 |
| 147 | Ga0075362_10390886 | 3300006177 | Bacteria | 700 |
| 148 | Ga0075367_10000692 | 3300006178 | Bacteria | 12968 |
| 149 | Ga0075369_10587601 | 3300006186 | Bacteria | 533 |
| 150 | Ga0075370_10010420 | 3300006353 | Bacteria | 4861 |
| 151 | Ga0075370_10063950 | 3300006353 | Bacteria | 2098 |
| 152 | Ga0075370_10126540 | 3300006353 | Bacteria | 1489 |
| 153 | Ga0068871_102205143 | 3300006358 | Bacteria | 525 |
| 154 | Ga0075430_100084382 | 3300006846 | Bacteria | 2660 |
| 155 | Ga0097620_100028372 | 3300006931 | Bacteria | 5611 |
| 156 | Ga0097620_100206405 | 3300006931 | Bacteria | 2050 |
| 157 | Ga0097620_101397994 | 3300006931 | Bacteria | 772 |
| 158 | Ga0079104_1052219 | 3300006946 | Bacteria | 906 |
| 159 | Ga0079104_1054222 | 3300006946 | Bacteria | 883 |
| 160 | Ga0105251_10016214 | 3300009011 | Bacteria | 4036 |
| 161 | Ga0105250_10040167 | 3300009092 | Bacteria | 1876 |
| 162 | Ga0105240_11380751 | 3300009093 | Bacteria | 741 |
| 163 | Ga0105240_11857066 | 3300009093 | Bacteria | 627 |
| 164 | Ga0105240_12340423 | 3300009093 | Bacteria | 553 |
| 165 | Ga0111539_11288518 | 3300009094 | Bacteria | 848 |
| 166 | Ga0105247_10144469 | 3300009101 | Bacteria | 1562 |
| 167 | Ga0105243_10767589 | 3300009148 | Bacteria | 947 |
| 168 | Ga0105241_10631007 | 3300009174 | Bacteria | 971 |
| 169 | Ga0105241_11641341 | 3300009174 | Bacteria | 623 |
| 170 | Ga0105241_12495943 | 3300009174 | Bacteria | 517 |
| 171 | Ga0105248_10059949 | 3300009177 | Bacteria | 4274 |
| 172 | Ga0105248_10501134 | 3300009177 | Bacteria | 1369 |
| 173 | Ga0105248_11064157 | 3300009177 | Bacteria | 914 |
| 174 | Ga0105237_10048537 | 3300009545 | Bacteria | 4268 |
| 175 | Ga0105237_10059304 | 3300009545 | Bacteria | 3829 |
| 176 | Ga0105237_10091535 | 3300009545 | Bacteria | 3031 |
| 177 | Ga0105237_12287021 | 3300009545 | Bacteria | 550 |
| 178 | Ga0105238_10102613 | 3300009551 | Bacteria | 2842 |
| 179 | Ga0105238_10455402 | 3300009551 | Bacteria | 1277 |
| 180 | Ga0105238_10668100 | 3300009551 | Bacteria | 1050 |
| 181 | Ga0105238_10763869 | 3300009551 | Bacteria | 981 |
| 182 | Ga0105249_10000006 | 3300009553 | Bacteria | 354449 |
| 183 | Ga0105249_10291555 | 3300009553 | Bacteria | 1633 |
| 184 | Ga0105249_11366562 | 3300009553 | Bacteria | 780 |
| 185 | Ga0105148_100540 | 3300009978 | Bacteria | 3258 |
| 186 | Ga0105239_10570804 | 3300010375 | Bacteria | 1289 |
| 187 | Ga0105239_10620545 | 3300010375 | Bacteria | 1234 |
| 188 | Ga0105239_12198078 | 3300010375 | Bacteria | 642 |
| 189 | Ga0105246_10477789 | 3300011119 | Bacteria | 1054 |
| 190 | Ga0157373_10087299 | 3300013100 | Bacteria | 2198 |
| 191 | Ga0157373_10152393 | 3300013100 | Bacteria | 1626 |
| 192 | Ga0157373_10342280 | 3300013100 | Bacteria | 1066 |
| 193 | Ga0157373_10615179 | 3300013100 | Bacteria | 791 |
| 194 | Ga0157370_11983841 | 3300013104 | Bacteria | 522 |
| 195 | Ga0157369_10000713 | 3300013105 | Bacteria | 42758 |
| 196 | Ga0157369_10335132 | 3300013105 | Bacteria | 1572 |
| 197 | Ga0157369_10445942 | 3300013105 | Bacteria | 1340 |
| 198 | Ga0157369_10666774 | 3300013105 | Bacteria | 1072 |
| 199 | Ga0157369_11745265 | 3300013105 | Bacteria | 632 |
| 200 | Ga0157378_10501215 | 3300013297 | Bacteria | 1213 |
| 201 | Ga0163162_10008623 | 3300013306 | Bacteria | 9934 |
| 202 | Ga0157372_10032771 | 3300013307 | Bacteria | 5701 |
| 203 | Ga0157372_10059842 | 3300013307 | Bacteria | 4262 |
| 204 | Ga0157372_10354637 | 3300013307 | Bacteria | 1709 |
| 205 | Ga0157372_10901142 | 3300013307 | Bacteria | 1026 |
| 206 | Ga0157372_11525579 | 3300013307 | Bacteria | 770 |
| 207 | Ga0157372_12055020 | 3300013307 | Bacteria | 657 |
| 208 | Ga0157372_12223916 | 3300013307 | Unclassified | 630 |
| 209 | Ga0157375_12028727 | 3300013308 | Bacteria | 684 |
| 210 | Ga0163163_10071955 | 3300014325 | Bacteria | 3446 |
| 211 | Ga0157380_10000182 | 3300014326 | Bacteria | 36263 |
| 212 | Ga0157380_10058444 | 3300014326 | Bacteria | 3074 |
| 213 | Ga0157379_10049804 | 3300014968 | Bacteria | 3740 |
| 214 | Ga0163161_12080327 | 3300017792 | Bacteria | 505 |
| 215 | Ga0206354_11591560 | 3300020081 | Bacteria | 1669 |
| 216 | Ga0213876_10001077 | 3300021384 | Bacteria | 17543 |
| 217 | Ga0213876_10022787 | 3300021384 | Bacteria | 3309 |
| 218 | Ga0209026_1001465 | 3300025250 | Bacteria | 10416 |
| 219 | Ga0209148_1028522 | 3300025254 | Bacteria | 849 |
| 220 | Ga0209758_1000555 | 3300025297 | Bacteria | 59166 |
| 221 | Ga0209050_1000034 | 3300025298 | Bacteria | 433906 |
| 222 | Ga0209257_1000052 | 3300025304 | Bacteria | 430947 |
| 223 | Ga0209257_1000100 | 3300025304 | Bacteria | 253399 |
| 224 | Ga0209257_1014543 | 3300025304 | Bacteria | 3372 |
| 225 | Ga0207656_10246283 | 3300025321 | Bacteria | 875 |
| 226 | Ga0207688_10591391 | 3300025901 | Bacteria | 699 |
| 227 | Ga0207680_10400053 | 3300025903 | Bacteria | 970 |
| 228 | Ga0207680_10806718 | 3300025903 | Bacteria | 673 |
| 229 | Ga0207680_11279796 | 3300025903 | Bacteria | 522 |
| 230 | Ga0207647_10007503 | 3300025904 | Bacteria | 7877 |
| 231 | Ga0207705_10385123 | 3300025909 | Bacteria | 1083 |
| 232 | Ga0207705_10925174 | 3300025909 | Bacteria | 675 |
| 233 | Ga0207654_10187655 | 3300025911 | Bacteria | 1353 |
| 234 | Ga0207695_11450916 | 3300025913 | Bacteria | 566 |
| 235 | Ga0207671_10229002 | 3300025914 | Bacteria | 1458 |
| 236 | Ga0207660_10211066 | 3300025917 | Bacteria | 1520 |
| 237 | Ga0207660_10365805 | 3300025917 | Bacteria | 1157 |
| 238 | Ga0207662_10472288 | 3300025918 | Bacteria | 860 |
| 239 | Ga0207657_10052419 | 3300025919 | Bacteria | 3540 |
| 240 | Ga0207649_10000043 | 3300025920 | Bacteria | 115777 |
| 241 | Ga0207681_10361412 | 3300025923 | Bacteria | 1164 |
| 242 | Ga0207681_10595161 | 3300025923 | Bacteria | 913 |
| 243 | Ga0207681_11816477 | 3300025923 | Bacteria | 508 |
| 244 | Ga0207681_11871021 | 3300025923 | Bacteria | 500 |
| 245 | Ga0207694_10035042 | 3300025924 | Bacteria | 3849 |
| 246 | Ga0207694_10322619 | 3300025924 | Bacteria | 1275 |
| 247 | Ga0207694_10359393 | 3300025924 | Bacteria | 1206 |
| 248 | Ga0207694_10585392 | 3300025924 | Bacteria | 938 |
| 249 | Ga0207650_10176847 | 3300025925 | Bacteria | 1699 |
| 250 | Ga0207650_10874867 | 3300025925 | Bacteria | 763 |
| 251 | Ga0207659_11720034 | 3300025926 | Bacteria | 534 |
| 252 | Ga0207644_10022986 | 3300025931 | Bacteria | 4265 |
| 253 | Ga0207644_11532315 | 3300025931 | Bacteria | 559 |
| 254 | Ga0207690_10052761 | 3300025932 | Bacteria | 2725 |
| 255 | Ga0207690_10355127 | 3300025932 | Bacteria | 1160 |
| 256 | Ga0207706_10015340 | 3300025933 | Bacteria | 6923 |
| 257 | Ga0207706_10026490 | 3300025933 | Bacteria | 5189 |
| 258 | Ga0207706_10211000 | 3300025933 | Bacteria | 1702 |
| 259 | Ga0207709_10413443 | 3300025935 | Bacteria | 1034 |
| 260 | Ga0207709_10779588 | 3300025935 | Bacteria | 770 |
| 261 | Ga0207669_10156416 | 3300025937 | Bacteria | 1604 |
| 262 | Ga0207711_10033334 | 3300025941 | Bacteria | 4357 |
| 263 | Ga0207711_10663848 | 3300025941 | Bacteria | 973 |
| 264 | Ga0207689_10391024 | 3300025942 | Bacteria | 1159 |
| 265 | Ga0207689_10587898 | 3300025942 | Bacteria | 936 |
| 266 | Ga0207661_11905538 | 3300025944 | Bacteria | 540 |
| 267 | Ga0207667_11327157 | 3300025949 | Bacteria | 695 |
| 268 | Ga0207668_10012421 | 3300025972 | Bacteria | 5214 |
| 269 | Ga0207668_10034185 | 3300025972 | Bacteria | 3374 |
| 270 | Ga0207668_11605880 | 3300025972 | Bacteria | 587 |
| 271 | Ga0207640_10020993 | 3300025981 | Bacteria | 3884 |
| 272 | Ga0207640_10080263 | 3300025981 | Bacteria | 2226 |
| 273 | Ga0207640_10380129 | 3300025981 | Bacteria | 1144 |
| 274 | Ga0207640_10726370 | 3300025981 | Bacteria | 854 |
| 275 | Ga0207658_10000069 | 3300025986 | Bacteria | 113687 |
| 276 | Ga0207677_10733962 | 3300026023 | Bacteria | 879 |
| 277 | Ga0207639_10000771 | 3300026041 | Bacteria | 21846 |
| 278 | Ga0207639_10160773 | 3300026041 | Bacteria | 1892 |
| 279 | Ga0207639_10187001 | 3300026041 | Bacteria | 1766 |
| 280 | Ga0207639_10730579 | 3300026041 | Bacteria | 920 |
| 281 | Ga0207639_11486247 | 3300026041 | Bacteria | 636 |
| 282 | Ga0207678_10889898 | 3300026067 | Bacteria | 787 |
| 283 | Ga0207702_10291064 | 3300026078 | Bacteria | 1547 |
| 284 | Ga0207702_10800264 | 3300026078 | Bacteria | 932 |
| 285 | Ga0207641_10003319 | 3300026088 | Bacteria | 14317 |
| 286 | Ga0207641_10004490 | 3300026088 | Bacteria | 12070 |
| 287 | Ga0207676_10041840 | 3300026095 | Bacteria | 3520 |
| 288 | Ga0207674_10008322 | 3300026116 | Bacteria | 12002 |
| 289 | Ga0207674_10016903 | 3300026116 | Bacteria | 7971 |
| 290 | Ga0207674_10088087 | 3300026116 | Bacteria | 3098 |
| 291 | Ga0207674_10239259 | 3300026116 | Bacteria | 1762 |
| 292 | Ga0207674_10895518 | 3300026116 | Bacteria | 855 |
| 293 | Ga0207674_10959275 | 3300026116 | Bacteria | 824 |
| 294 | Ga0207675_100001918 | 3300026118 | Bacteria | 20742 |
| 295 | Ga0207675_100231134 | 3300026118 | Bacteria | 1784 |
| 296 | Ga0207675_100279112 | 3300026118 | Bacteria | 1623 |
| 297 | Ga0207683_10820574 | 3300026121 | Bacteria | 863 |
| 298 | Ga0207683_11590295 | 3300026121 | Bacteria | 603 |
| 299 | Ga0207698_10000130 | 3300026142 | Bacteria | 47043 |
| 300 | Ga0207698_10102005 | 3300026142 | Bacteria | 2381 |
| 301 | Ga0207698_10109159 | 3300026142 | Bacteria | 2314 |
| 302 | Ga0207698_10407978 | 3300026142 | Bacteria | 1300 |
| 303 | Ga0207698_10602564 | 3300026142 | Bacteria | 1083 |
| 304 | Ga0207698_10675077 | 3300026142 | Bacteria | 1026 |
| 305 | Ga0207698_11276964 | 3300026142 | Bacteria | 749 |
| 306 | Ga0209281_1021396 | 3300027111 | Bacteria | 1251 |
| 307 | Ga0209281_1042409 | 3300027111 | Bacteria | 759 |
| 308 | Ga0268265_10648415 | 3300028380 | Bacteria | 1015 |
| 309 | Ga0268264_10000217 | 3300028381 | Bacteria | 113674 |
| 310 | Ga0268264_10157361 | 3300028381 | Bacteria | 2043 |
| 311 | Ga0268264_11740826 | 3300028381 | Bacteria | 634 |
| 312 | Ga0307517_10039268 | 3300028786 | Bacteria | 5205 |
| 313 | Ga0307511_10082979 | 3300030521 | Bacteria | 2236 |
| 314 | Ga0307408_100388134 | 3300031548 | Bacteria | 1195 |
| 315 | Ga0307408_100545382 | 3300031548 | Bacteria | 1022 |
| 316 | Ga0307408_101275253 | 3300031548 | Bacteria | 688 |
| 317 | Ga0307408_101927041 | 3300031548 | Bacteria | 567 |
| 318 | Ga0307405_10015706 | 3300031731 | Bacteria | 4108 |
| 319 | Ga0307405_10233043 | 3300031731 | Bacteria | 1358 |
| 320 | Ga0307405_10422638 | 3300031731 | Bacteria | 1049 |
| 321 | Ga0307405_10442013 | 3300031731 | Bacteria | 1029 |
| 322 | Ga0307405_10830145 | 3300031731 | Bacteria | 776 |
| 323 | Ga0307413_10375086 | 3300031824 | Bacteria | 1106 |
| 324 | Ga0307413_11004602 | 3300031824 | Bacteria | 715 |
| 325 | Ga0307413_11966890 | 3300031824 | Bacteria | 526 |
| 326 | Ga0307410_10572941 | 3300031852 | Bacteria | 938 |
| 327 | Ga0307406_10071868 | 3300031901 | Bacteria | 2269 |
| 328 | Ga0307406_10151212 | 3300031901 | Bacteria | 1656 |
| 329 | Ga0307406_10312328 | 3300031901 | Bacteria | 1212 |
| 330 | Ga0307406_10350397 | 3300031901 | Bacteria | 1153 |
| 331 | Ga0307407_10227621 | 3300031903 | Bacteria | 1264 |
| 332 | Ga0307412_10075035 | 3300031911 | Bacteria | 2318 |
| 333 | Ga0307412_10135773 | 3300031911 | Bacteria | 1794 |
| 334 | Ga0307412_10379010 | 3300031911 | Bacteria | 1145 |
| 335 | Ga0307412_11378238 | 3300031911 | Bacteria | 637 |
| 336 | Ga0307412_11460401 | 3300031911 | Bacteria | 620 |
| 337 | Ga0307409_100244787 | 3300031995 | Bacteria | 1635 |
| 338 | Ga0307409_100365136 | 3300031995 | Bacteria | 1367 |
| 339 | Ga0307409_100485830 | 3300031995 | Bacteria | 1199 |
| 340 | Ga0307416_100491586 | 3300032002 | Bacteria | 1289 |
| 341 | Ga0307416_102537652 | 3300032002 | Bacteria | 611 |
| 342 | Ga0307414_10001522 | 3300032004 | Bacteria | 12055 |
| 343 | Ga0307414_10085486 | 3300032004 | Bacteria | 2324 |
| 344 | Ga0307414_10202434 | 3300032004 | Bacteria | 1616 |
| 345 | Ga0307411_10459087 | 3300032005 | Bacteria | 1067 |
| 346 | Ga0307411_11195573 | 3300032005 | Bacteria | 689 |
| 347 | Ga0307411_12179013 | 3300032005 | Bacteria | 519 |
| 348 | Ga0307415_100060290 | 3300032126 | Bacteria | 2621 |
| 349 | Ga0307415_100197799 | 3300032126 | Bacteria | 1592 |
| 350 | Ga0307415_100740511 | 3300032126 | Bacteria | 891 |
| 351 | Ga0307510_10308054 | 3300033180 | Bacteria | 1044 |
| 352 | Ga0373937_0267550 | 3300036401 | Bacteria | 1613 |
| 353 | Ga0395905_0356568 | 3300037471 | Bacteria | 1355 |
| 354 | Ga0395905_0364976 | 3300037471 | Bacteria | 1337 |
| 355 | Ga0395905_0487066 | 3300037471 | Bacteria | 1133 |
| 356 | Ga0395905_1046289 | 3300037471 | Bacteria | 719 |
| 357 | Ga0436365_0378480 | 3300039437 | Bacteria | 4964 |
| 358 | Ga0436365_0600332 | 3300039437 | Bacteria | 1176 |
| 359 | Ga0436365_0770163 | 3300039437 | Bacteria | 534 |
| 360 | Ga0436365_1117045 | 3300039437 | Bacteria | 20483 |
| 361 | Ga0436363_1615302 | 3300039450 | Bacteria | 931 |
| 362 | Ga0436362_0438371 | 3300039453 | Bacteria | 969 |
| 363 | Ga0439436_0045695 | 3300041404 | Bacteria | 1245 |
| 364 | Ga0439461_0046235 | 3300041410 | Bacteria | 954 |
| 365 | Ga0451789_0051834 | 3300041443 | Bacteria | 702 |
| 366 | Ga0451791_1915041 | 3300041451 | Bacteria | 976 |
| 367 | Ga0451793_0662985 | 3300041452 | Bacteria | 1593 |
| 368 | Ga0451800_0020009 | 3300041459 | Bacteria | 1613 |
| 369 | Ga0451802_0252467 | 3300041460 | Bacteria | 607 |
| 370 | Ga0451802_0704079 | 3300041460 | Bacteria | 918 |
| 371 | Ga0451806_402659 | 3300041462 | Bacteria | 6155 |
| 372 | Ga0451804_0351077 | 3300041463 | Bacteria | 1017 |
| 373 | Ga0451807_0382179 | 3300041486 | Bacteria | 6263 |
| 374 | Ga0451807_1450983 | 3300041486 | Bacteria | 631 |
| 375 | Ga0451839_1164718 | 3300041496 | Bacteria | 639 |
| 376 | Ga0451845_0234870 | 3300041501 | Bacteria | 503 |
| 377 | Ga0451849_0396199 | 3300041505 | Bacteria | 733 |
| 378 | Ga0451843_0433053 | 3300041509 | Bacteria | 572 |
| 379 | Ga0451843_1746187 | 3300041509 | Bacteria | 535 |
| 380 | Ga0451853_0669204 | 3300041512 | Bacteria | 556 |
| 381 | Ga0439431_0000140 | 3300041997 | Bacteria | 13006 |
| 382 | Ga0439442_013335 | 3300042002 | Bacteria | 1685 |
| 383 | Ga0439448_0001939 | 3300042005 | Bacteria | 5514 |
| 384 | Ga0439448_0009693 | 3300042005 | Bacteria | 2843 |
| 385 | Ga0439449_0289840 | 3300042007 | Bacteria | 617 |
| 386 | Ga0439450_045931 | 3300042008 | Bacteria | 1026 |
| 387 | Ga0439455_0001428 | 3300042012 | Bacteria | 3992 |
| 388 | Ga0439455_0003870 | 3300042012 | Bacteria | 2911 |
| 389 | Ga0439455_0014742 | 3300042012 | Bacteria | 1788 |
| 390 | Ga0439434_0006562 | 3300042435 | Bacteria | 3398 |
| 391 | Ga0439464_0131240 | 3300042439 | Bacteria | 776 |
| 392 | Ga0466972_0000826 | 3300044658 | Bacteria | 14820 |
| 393 | Ga0466966_0217347 | 3300044684 | Bacteria | 1154 |
| 394 | Ga0466961_0036040 | 3300044693 | Bacteria | 3176 |
| 395 | Ga0466961_0070130 | 3300044693 | Bacteria | 2224 |
| 396 | Ga0466961_0307740 | 3300044693 | Bacteria | 967 |
| 397 | Ga0466963_0005815 | 3300044694 | Bacteria | 7256 |
| 398 | Ga0466964_0000258 | 3300044706 | Bacteria | 15333 |
| 399 | Ga0466964_0142197 | 3300044706 | Bacteria | 1104 |
| 400 | Ga0466971_0005805 | 3300044719 | Bacteria | 5372 |
| 401 | Ga0466968_0038917 | 3300044735 | Bacteria | 1999 |
| 402 | Ga0466968_0236455 | 3300044735 | Bacteria | 864 |
| 403 | Ga0466970_0638277 | 3300044765 | Bacteria | 619 |
| 404 | Ga0466957_0042426 | 3300044842 | Bacteria | 2752 |
| 405 | Ga0466960_0004100 | 3300044901 | Bacteria | 5665 |
| 406 | Ga0466959_0561217 | 3300045049 | Bacteria | 769 |
| 407 | Ga0466958_0017628 | 3300045836 | Bacteria | 4132 |
| 408 | Ga0466967_0053000 | 3300045976 | Bacteria | 3564 |
| 409 | Ga0466967_2154385 | 3300045976 | Bacteria | 554 |
| 410 | Ga0495638_0006069 | 3300046460 | Bacteria | 8842 |
| 411 | Ga0495638_0019313 | 3300046460 | Bacteria | 4509 |
| 412 | Ga0495638_0102689 | 3300046460 | Bacteria | 1708 |
| 413 | Ga0495650_0027516 | 3300046471 | Bacteria | 2625 |
| 414 | Ga0495583_0000218 | 3300046506 | Bacteria | 96349 |
| 415 | Ga0495632_0317276 | 3300046519 | Bacteria | 689 |
| 416 | Ga0495663_0003548 | 3300046525 | Bacteria | 4489 |
| 417 | Ga0495654_0001073 | 3300046530 | Bacteria | 19918 |
| 418 | Ga0495598_0004672 | 3300046537 | Bacteria | 2982 |
| 419 | Ga0495621_0003301 | 3300046539 | Bacteria | 4442 |
| 420 | Ga0495621_0179383 | 3300046539 | Bacteria | 845 |
| 421 | Ga0495597_0090244 | 3300046542 | Bacteria | 1302 |
| 422 | Ga0495622_0478758 | 3300046557 | Bacteria | 533 |
| 423 | Ga0495668_0006416 | 3300046616 | Bacteria | 7706 |
| 424 | Ga0495668_0011998 | 3300046616 | Bacteria | 5159 |
| 425 | Ga0495668_0091593 | 3300046616 | Bacteria | 1666 |
| 426 | Ga0495668_0133256 | 3300046616 | Bacteria | 1360 |
| 427 | Ga0495668_0181938 | 3300046616 | Bacteria | 1151 |
| 428 | Ga0495668_0307692 | 3300046616 | Bacteria | 869 |
| 429 | Ga0495625_0045065 | 3300046660 | Bacteria | 3190 |
| 430 | Ga0495625_0287690 | 3300046660 | Bacteria | 1055 |
| 431 | Ga0495670_0010027 | 3300046691 | Bacteria | 4659 |
| 432 | Ga0495589_0067756 | 3300046794 | Bacteria | 1747 |
| 433 | Ga0495660_0102720 | 3300046810 | Bacteria | 1469 |
| 434 | Ga0495673_0011196 | 3300047469 | Bacteria | 4841 |
| 435 | Ga0495686_0001246 | 3300047472 | Bacteria | 29040 |
| 436 | Ga0495686_0048131 | 3300047472 | Bacteria | 2689 |
| 437 | Ga0495686_0684368 | 3300047472 | Bacteria | 524 |
| 438 | Ga0495626_0421678 | 3300048091 | Bacteria | 514 |
| 439 | Ga0496102_0087675 | 3300048905 | Bacteria | 2876 |
| 440 | Ga0496102_1416872 | 3300048905 | Bacteria | 614 |
| 441 | Ga0496104_1390858 | 3300048907 | Bacteria | 605 |
| 442 | Ga0496108_0000682 | 3300048911 | Bacteria | 26248 |
| 443 | Ga0496110_0419373 | 3300048913 | Bacteria | 1220 |
| 444 | Ga0496113_0519615 | 3300048916 | Bacteria | 956 |
| 445 | Ga0496116_0021417 | 3300048919 | Bacteria | 4878 |
| 446 | Ga0496117_0354351 | 3300048920 | Bacteria | 756 |
| 447 | Ga0496118_0109131 | 3300048921 | Bacteria | 1843 |
| 448 | Ga0496121_0000296 | 3300048924 | Bacteria | 103215 |
| 449 | Ga0496121_0003051 | 3300048924 | Bacteria | 24286 |
| 450 | Ga0496122_0039577 | 3300048925 | Bacteria | 3758 |
| 451 | Ga0496122_0192299 | 3300048925 | Bacteria | 1203 |
| 452 | Ga0496122_0313438 | 3300048925 | Bacteria | 838 |
| 453 | Ga0496123_0116075 | 3300048926 | Bacteria | 1517 |
| 454 | Ga0496123_0156766 | 3300048926 | Bacteria | 1219 |
| 455 | Ga0496124_0005852 | 3300048927 | Bacteria | 13640 |
| 456 | Ga0496124_0033927 | 3300048927 | Bacteria | 4485 |
| 457 | Ga0496124_0048088 | 3300048927 | Bacteria | 3647 |
| 458 | Ga0496124_0265665 | 3300048927 | Bacteria | 1260 |
| 459 | Ga0496124_0290403 | 3300048927 | Bacteria | 1187 |
| 460 | Ga0496124_0363072 | 3300048927 | Bacteria | 1019 |
| 461 | Ga0496124_0750333 | 3300048927 | Bacteria | 611 |
| 462 | Ga0496125_0049187 | 3300048928 | Bacteria | 3506 |
| 463 | Ga0496125_0072386 | 3300048928 | Bacteria | 2685 |
| 464 | Ga0496125_0091131 | 3300048928 | Bacteria | 2285 |
| 465 | Ga0496125_0286884 | 3300048928 | Bacteria | 1016 |
| 466 | Ga0496125_0308228 | 3300048928 | Bacteria | 966 |
| 467 | Ga0496125_0394973 | 3300048928 | Bacteria | 810 |
| 468 | Ga0496126_0004477 | 3300048929 | Bacteria | 16680 |
| 469 | Ga0501306_009105 | 3300049127 | Bacteria | 1225 |
| 470 | Ga0501305_021695 | 3300049161 | Bacteria | 951 |
| 471 | Ga0501307_005380 | 3300049162 | Bacteria | 1348 |
| 472 | Ga0495678_137000 | 3300049459 | Bacteria | 805 |
| 473 | Ga0495682_0053138 | 3300049460 | Bacteria | 1471 |
| 474 | Ga0501311_027272 | 3300049527 | Bacteria | 810 |
| 475 | Ga0501312_025302 | 3300049528 | Bacteria | 904 |
| 476 | Ga0501313_020213 | 3300049529 | Bacteria | 819 |
| 477 | Ga0501314_017825 | 3300049530 | Bacteria | 718 |
| 478 | Ga0501315_046231 | 3300049531 | Bacteria | 672 |
| 479 | Ga0501320_006506 | 3300049536 | Bacteria | 1097 |
| 480 | Ga0501321_056218 | 3300049537 | Bacteria | 585 |
| 481 | Ga0501336_018821 | 3300049552 | Bacteria | 615 |
| 482 | Ga0501033_0205815 | 3300049570 | Bacteria | 1404 |
| 483 | Ga0501033_0214787 | 3300049570 | Bacteria | 1371 |
| 484 | Ga0501034_1557758 | 3300049571 | Bacteria | 534 |
| 485 | Ga0501036_1078947 | 3300049572 | Bacteria | 656 |
| 486 | Ga0501038_0059946 | 3300049574 | Bacteria | 3258 |
| 487 | Ga0501038_0905183 | 3300049574 | Bacteria | 651 |
| 488 | Ga0501039_0229604 | 3300049575 | Bacteria | 1459 |
| 489 | Ga0501042_0229792 | 3300049578 | Bacteria | 1338 |
| 490 | Ga0501043_0049166 | 3300049579 | Bacteria | 3315 |
| 491 | Ga0501046_0476873 | 3300049580 | Bacteria | 895 |
| 492 | Ga0501047_0104148 | 3300049581 | Bacteria | 2718 |
| 493 | Ga0501047_0130480 | 3300049581 | Bacteria | 2394 |
| 494 | Ga0501047_0673401 | 3300049581 | Bacteria | 853 |
| 495 | Ga0501047_0885518 | 3300049581 | Bacteria | 706 |
| 496 | Ga0501073_0480905 | 3300049589 | Bacteria | 859 |
| 497 | Ga0501074_0436178 | 3300049590 | Bacteria | 929 |
| 498 | Ga0501076_0137133 | 3300049592 | Bacteria | 1987 |
| 499 | Ga0501198_007724 | 3300049649 | Bacteria | 1551 |
| 500 | Ga0501202_214062 | 3300049652 | Bacteria | 531 |
| 501 | Ga0501223_000039 | 3300049663 | Bacteria | 45537 |
| 502 | Ga0501246_001398 | 3300049676 | Bacteria | 1843 |
| 503 | Ga0501249_000213 | 3300049679 | Bacteria | 17777 |
| 504 | Ga0501257_000049 | 3300049686 | Bacteria | 33138 |
| 505 | Ga0501225_0000010 | 3300049705 | Bacteria | 82395 |
| 506 | Ga0501241_014967 | 3300049758 | Bacteria | 1410 |
| 507 | Ga0501241_024823 | 3300049758 | Bacteria | 1114 |
| 508 | Ga0501267_002297 | 3300049764 | Bacteria | 1703 |
| 509 | Ga0501269_003897 | 3300049766 | Bacteria | 1795 |
| 510 | Ga0501035_0350527 | 3300049822 | Bacteria | 1235 |
| 511 | Ga0501035_0526827 | 3300049822 | Bacteria | 970 |
| 512 | Ga0501035_1366166 | 3300049822 | Bacteria | 544 |
| 513 | Ga0501044_0074300 | 3300049823 | Bacteria | 3454 |
| 514 | Ga0501045_0146480 | 3300049824 | Bacteria | 1757 |
| 515 | Ga0501204_000430 | 3300049850 | Bacteria | 3639 |
| 516 | nmdc:mga03683_252847_c1 | 3300050489 | Bacteria | 819 |
| 517 | nmdc:mga0k408_150993_c1 | 3300050493 | Bacteria | 1383 |
| 518 | nmdc:mga0k408_9833_c1 | 3300050493 | Bacteria | 5164 |
| 519 | nmdc:mga07m45_144097_c1 | 3300050496 | Bacteria | 1380 |
| 520 | nmdc:mga07m45_65525_c1 | 3300050496 | Bacteria | 2063 |
| 521 | nmdc:mga0qj67_77287_c1 | 3300050509 | Bacteria | 2663 |
| 522 | Ga0500643_000135 | 3300053087 | Bacteria | 74911 |
| 523 | Ga0500643_000195 | 3300053087 | Bacteria | 57960 |
| 524 | Ga0500643_000783 | 3300053087 | Bacteria | 20603 |
| 525 | Ga0500643_003224 | 3300053087 | Bacteria | 7943 |
| 526 | Ga0500643_018446 | 3300053087 | Bacteria | 2314 |
| 527 | Ga0500643_020706 | 3300053087 | Bacteria | 2143 |
| 528 | Ga0500643_025387 | 3300053087 | Bacteria | 1869 |
| 529 | Ga0500643_097989 | 3300053087 | Bacteria | 796 |
| 530 | Ga0500643_193444 | 3300053087 | Bacteria | 545 |
| 531 | Ga0500555_000575 | 3300053103 | Bacteria | 14512 |
| 532 | Ga0500555_142520 | 3300053103 | Bacteria | 590 |
| 533 | Ga0500556_0000222 | 3300053104 | Bacteria | 45971 |
| 534 | Ga0500557_124997 | 3300053105 | Bacteria | 853 |
| 535 | Ga0500562_012822 | 3300053108 | Bacteria | 2134 |
| 536 | Ga0500562_049382 | 3300053108 | Bacteria | 1124 |
| 537 | Ga0500572_271158 | 3300053111 | Bacteria | 550 |
| 538 | Ga0500592_002248 | 3300053116 | Bacteria | 3112 |
| 539 | Ga0500595_012152 | 3300053119 | Bacteria | 3338 |
| 540 | Ga0500607_000844 | 3300053121 | Bacteria | 29501 |
| 541 | Ga0500608_007769 | 3300053122 | Bacteria | 4458 |
| 542 | Ga0500642_0000011 | 3300053130 | Bacteria | 215963 |
| 543 | Ga0500642_0121939 | 3300053130 | Bacteria | 1220 |
| 544 | Ga0500559_0003805 | 3300053136 | Bacteria | 7307 |
| 545 | Ga0500559_0008073 | 3300053136 | Bacteria | 4632 |
| 546 | Ga0500559_0166247 | 3300053136 | Bacteria | 1037 |
| 547 | Ga0500559_0304718 | 3300053136 | Bacteria | 748 |
| 548 | Ga0500568_0260875 | 3300053139 | Bacteria | 630 |
| 549 | Ga0500573_0000114 | 3300053140 | Bacteria | 32888 |
| 550 | Ga0500590_065735 | 3300053148 | Bacteria | 1812 |
| 551 | Ga0500604_0039631 | 3300053151 | Bacteria | 1417 |
| 552 | Ga0500624_000106 | 3300053157 | Bacteria | 40037 |
| 553 | Ga0500627_0000570 | 3300053158 | Bacteria | 9930 |
| 554 | Ga0500627_0279338 | 3300053158 | Bacteria | 733 |
| 555 | Ga0500627_0358637 | 3300053158 | Bacteria | 628 |
| 556 | Ga0500636_0005955 | 3300053177 | Bacteria | 6988 |
| 557 | Ga0500637_0017519 | 3300053178 | Bacteria | 3836 |
| 558 | Ga0500645_000417 | 3300053730 | Bacteria | 29425 |
| 559 | Ga0500645_004197 | 3300053730 | Bacteria | 5605 |
| 560 | Ga0500645_017913 | 3300053730 | Bacteria | 2217 |
| 561 | Ga0501084_0997730 | 3300054114 | Bacteria | 704 |
| 562 | Ga0466962_0005694 | 3300061719 | Bacteria | 5986 |
| 563 | Ga0530510_0697718 | 3300061734 | Bacteria | 773 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046810 | Ga0495660_0102720 | Ga0495660_0102720_153_359 | 66 |
| 2 | iso_pu_bacteria | 2775507255 | 2778125107 | 73 |
| 3 | iso_pu_bacteria | 2808606401 | 2809063038 | 73 |
| 4 | iso_pu_bacteria | 2808606404 | 2809079002 | 73 |
| 5 | iso_pu_bacteria | 2808606405 | 2809083623 | 73 |
| 6 | iso_pu_bacteria | 2880518877 | 2880520293 | 73 |
| 7 | iso_pu_bacteria | 2919709256 | 2919713322 | 73 |
| 8 | iso_pu_bacteria | 2928027323 | 2928030297 | 73 |
| 9 | iso_pu_bacteria | 2984555340 | 2984558874 | 73 |
| 10 | iso_pu_bacteria | 2984564862 | 2984566612 | 73 |
| 11 | iso_pu_bacteria | 2993356040 | 2993357808 | 73 |
| 12 | 3300013100 | Ga0157373_10342280 | Ga0157373_103422803 | 74 |
| 13 | 3300025254 | Ga0209148_1028522 | Ga0209148_10285222 | 74 |
| 14 | 3300025904 | Ga0207647_10007503 | Ga0207647_100075039 | 74 |
| 15 | 3300025917 | Ga0207660_10211066 | Ga0207660_102110662 | 74 |
| 16 | 3300025925 | Ga0207650_10874867 | Ga0207650_108748672 | 74 |
| 17 | 3300025932 | Ga0207690_10355127 | Ga0207690_103551271 | 74 |
| 18 | 3300025933 | Ga0207706_10026490 | Ga0207706_100264905 | 74 |
| 19 | 3300025935 | Ga0207709_10779588 | Ga0207709_107795882 | 74 |
| 20 | 3300026078 | Ga0207702_10800264 | Ga0207702_108002642 | 74 |
| 21 | 3300028786 | Ga0307517_10039268 | Ga0307517_100392684 | 74 |
| 22 | 3300041452 | Ga0451793_0662985 | Ga0451793_0662985_707_937 | 74 |
| 23 | 3300041459 | Ga0451800_0020009 | Ga0451800_0020009_598_828 | 74 |
| 24 | 3300041460 | Ga0451802_0704079 | Ga0451802_0704079_117_347 | 74 |
| 25 | 3300041462 | Ga0451806_402659 | Ga0451806_402659_3639_3869 | 74 |
| 26 | 3300041463 | Ga0451804_0351077 | Ga0451804_0351077_223_453 | 74 |
| 27 | 3300041486 | Ga0451807_0382179 | Ga0451807_0382179_1743_1973 | 74 |
| 28 | 3300041501 | Ga0451845_0234870 | Ga0451845_0234870_50_280 | 74 |
| 29 | 3300041505 | Ga0451849_0396199 | Ga0451849_0396199_305_535 | 74 |
| 30 | 3300042005 | Ga0439448_0009693 | Ga0439448_0009693_214_444 | 74 |
| 31 | 3300042008 | Ga0439450_045931 | Ga0439450_045931_377_607 | 74 |
| 32 | 3300042439 | Ga0439464_0131240 | Ga0439464_0131240_90_320 | 74 |
| 33 | 3300048927 | Ga0496124_0290403 | Ga0496124_0290403_354_584 | 74 |
| 34 | 3300049824 | Ga0501045_0146480 | Ga0501045_0146480_916_1146 | 74 |
| 35 | 3300050489 | nmdc:mga03683_252847_c1 | nmdc:mga03683_252847_c1_474_704 | 74 |
| 36 | 3300053108 | Ga0500562_012822 | Ga0500562_012822_1877_2107 | 74 |
| 37 | 2162886007 | SwRhRL2b_contig_1292634 | SwRhRL2b_0809.00003660 | 75 |
| 38 | 2162886007 | SwRhRL2b_contig_453878 | SwRhRL2b_0731.00007040 | 75 |
| 39 | 3300001904 | JGI24736J21556_1000032 | JGI24736J21556_100003225 | 75 |
| 40 | 3300001915 | JGI24741J21665_1012703 | JGI24741J21665_10127033 | 75 |
| 41 | 3300001976 | JGI24752J21851_1000082 | JGI24752J21851_10000826 | 75 |
| 42 | 3300001979 | JGI24740J21852_10005188 | JGI24740J21852_100051886 | 75 |
| 43 | 3300001979 | JGI24740J21852_10042720 | JGI24740J21852_100427202 | 75 |
| 44 | 3300001989 | JGI24739J22299_10000162 | JGI24739J22299_1000016219 | 75 |
| 45 | 3300001989 | JGI24739J22299_10007626 | JGI24739J22299_100076265 | 75 |
| 46 | 3300001989 | JGI24739J22299_10025324 | JGI24739J22299_100253243 | 75 |
| 47 | 3300001990 | JGI24737J22298_10030621 | JGI24737J22298_100306214 | 75 |
| 48 | 3300001990 | JGI24737J22298_10144534 | JGI24737J22298_101445342 | 75 |
| 49 | 3300002067 | JGI24735J21928_10043770 | JGI24735J21928_100437703 | 75 |
| 50 | 3300002070 | JGI24750J21931_1000116 | JGI24750J21931_10001163 | 75 |
| 51 | 3300002074 | JGI24748J21848_1000036 | JGI24748J21848_100003662 | 75 |
| 52 | 3300002075 | JGI24738J21930_10061342 | JGI24738J21930_100613422 | 75 |
| 53 | 3300002239 | JGI24034J26672_10000008 | JGI24034J26672_1000000835 | 75 |
| 54 | 3300002239 | JGI24034J26672_10000038 | JGI24034J26672_1000003864 | 75 |
| 55 | 3300002244 | JGI24742J22300_10005496 | JGI24742J22300_100054962 | 75 |
| 56 | 3300002459 | JGI24751J29686_10006267 | JGI24751J29686_100062673 | 75 |
| 57 | 3300003215 | JGI25153J46596_10058825 | JGI25153J46596_100588252 | 75 |
| 58 | 3300003316 | rootH1_10052320 | rootH1_100523202 | 75 |
| 59 | 3300003322 | rootL2_10067350 | rootL2_100673501 | 75 |
| 60 | 3300003791 | Ga0055530_10000085 | Ga0055530_100000851 | 75 |
| 61 | 3300003794 | Ga0055531_10004719 | Ga0055531_100047196 | 75 |
| 62 | 3300004785 | Ga0058858_1328787 | Ga0058858_13287871 | 75 |
| 63 | 3300004800 | Ga0058861_11824849 | Ga0058861_118248492 | 75 |
| 64 | 3300005289 | Ga0065704_10001612 | Ga0065704_100016129 | 75 |
| 65 | 3300005289 | Ga0065704_10336440 | Ga0065704_103364402 | 75 |
| 66 | 3300005295 | Ga0065707_10098261 | Ga0065707_100982614 | 75 |
| 67 | 3300005327 | Ga0070658_10000479 | Ga0070658_1000047917 | 75 |
| 68 | 3300005327 | Ga0070658_10040826 | Ga0070658_100408264 | 75 |
| 69 | 3300005327 | Ga0070658_10527204 | Ga0070658_105272041 | 75 |
| 70 | 3300005329 | Ga0070683_101174001 | Ga0070683_1011740012 | 75 |
| 71 | 3300005330 | Ga0070690_100000021 | Ga0070690_10000002131 | 75 |
| 72 | 3300005331 | Ga0070670_100426848 | Ga0070670_1004268483 | 75 |
| 73 | 3300005331 | Ga0070670_100470703 | Ga0070670_1004707032 | 75 |
| 74 | 3300005331 | Ga0070670_101291983 | Ga0070670_1012919832 | 75 |
| 75 | 3300005333 | Ga0070677_10547462 | Ga0070677_105474621 | 75 |
| 76 | 3300005334 | Ga0068869_100085290 | Ga0068869_1000852902 | 75 |
| 77 | 3300005335 | Ga0070666_10000004 | Ga0070666_10000004252 | 75 |
| 78 | 3300005335 | Ga0070666_10489205 | Ga0070666_104892052 | 75 |
| 79 | 3300005335 | Ga0070666_11000847 | Ga0070666_110008472 | 75 |
| 80 | 3300005336 | Ga0070680_100037964 | Ga0070680_1000379645 | 75 |
| 81 | 3300005337 | Ga0070682_100178661 | Ga0070682_1001786612 | 75 |
| 82 | 3300005338 | Ga0068868_100531566 | Ga0068868_1005315663 | 75 |
| 83 | 3300005338 | Ga0068868_102076391 | Ga0068868_1020763911 | 75 |
| 84 | 3300005339 | Ga0070660_100003716 | Ga0070660_10000371612 | 75 |
| 85 | 3300005339 | Ga0070660_100004174 | Ga0070660_1000041742 | 75 |
| 86 | 3300005339 | Ga0070660_100075067 | Ga0070660_1000750672 | 75 |
| 87 | 3300005339 | Ga0070660_100299308 | Ga0070660_1002993083 | 75 |
| 88 | 3300005344 | Ga0070661_100000006 | Ga0070661_100000006145 | 75 |
| 89 | 3300005347 | Ga0070668_100041820 | Ga0070668_1000418202 | 75 |
| 90 | 3300005347 | Ga0070668_100063512 | Ga0070668_1000635125 | 75 |
| 91 | 3300005347 | Ga0070668_100288829 | Ga0070668_1002888293 | 75 |
| 92 | 3300005347 | Ga0070668_100518306 | Ga0070668_1005183062 | 75 |
| 93 | 3300005353 | Ga0070669_100000457 | Ga0070669_10000045735 | 75 |
| 94 | 3300005353 | Ga0070669_100123994 | Ga0070669_1001239942 | 75 |
| 95 | 3300005353 | Ga0070669_100124866 | Ga0070669_1001248662 | 75 |
| 96 | 3300005353 | Ga0070669_100380358 | Ga0070669_1003803582 | 75 |
| 97 | 3300005353 | Ga0070669_100849183 | Ga0070669_1008491832 | 75 |
| 98 | 3300005354 | Ga0070675_100660928 | Ga0070675_1006609282 | 75 |
| 99 | 3300005354 | Ga0070675_101271671 | Ga0070675_1012716711 | 75 |
| 100 | 3300005354 | Ga0070675_101723332 | Ga0070675_1017233322 | 75 |
| 101 | 3300005355 | Ga0070671_100017053 | Ga0070671_1000170533 | 75 |
| 102 | 3300005355 | Ga0070671_100060705 | Ga0070671_1000607053 | 75 |
| 103 | 3300005356 | Ga0070674_100041961 | Ga0070674_1000419613 | 75 |
| 104 | 3300005366 | Ga0070659_100035203 | Ga0070659_1000352033 | 75 |
| 105 | 3300005367 | Ga0070667_100000089 | Ga0070667_10000008913 | 75 |
| 106 | 3300005367 | Ga0070667_100010059 | Ga0070667_1000100597 | 75 |
| 107 | 3300005455 | Ga0070663_100129274 | Ga0070663_1001292743 | 75 |
| 108 | 3300005455 | Ga0070663_101778169 | Ga0070663_1017781692 | 75 |
| 109 | 3300005456 | Ga0070678_101949883 | Ga0070678_1019498832 | 75 |
| 110 | 3300005457 | Ga0070662_100112452 | Ga0070662_1001124522 | 75 |
| 111 | 3300005457 | Ga0070662_100152711 | Ga0070662_1001527114 | 75 |
| 112 | 3300005457 | Ga0070662_100223039 | Ga0070662_1002230393 | 75 |
| 113 | 3300005457 | Ga0070662_100350139 | Ga0070662_1003501393 | 75 |
| 114 | 3300005458 | Ga0070681_10379155 | Ga0070681_103791552 | 75 |
| 115 | 3300005458 | Ga0070681_10552789 | Ga0070681_105527893 | 75 |
| 116 | 3300005466 | Ga0070685_10000724 | Ga0070685_100007245 | 75 |
| 117 | 3300005468 | Ga0070707_102122948 | Ga0070707_1021229481 | 75 |
| 118 | 3300005471 | Ga0070698_100589375 | Ga0070698_1005893752 | 75 |
| 119 | 3300005530 | Ga0070679_100000001 | Ga0070679_10000000132 | 75 |
| 120 | 3300005530 | Ga0070679_101893626 | Ga0070679_1018936261 | 75 |
| 121 | 3300005539 | Ga0068853_100000825 | Ga0068853_10000082515 | 75 |
| 122 | 3300005539 | Ga0068853_100773978 | Ga0068853_1007739783 | 75 |
| 123 | 3300005539 | Ga0068853_101516668 | Ga0068853_1015166682 | 75 |
| 124 | 3300005539 | Ga0068853_101579703 | Ga0068853_1015797032 | 75 |
| 125 | 3300005539 | Ga0068853_101628703 | Ga0068853_1016287032 | 75 |
| 126 | 3300005544 | Ga0070686_100000012 | Ga0070686_100000012150 | 75 |
| 127 | 3300005544 | Ga0070686_101490742 | Ga0070686_1014907421 | 75 |
| 128 | 3300005546 | Ga0070696_100537433 | Ga0070696_1005374333 | 75 |
| 129 | 3300005547 | Ga0070693_101029673 | Ga0070693_1010296732 | 75 |
| 130 | 3300005548 | Ga0070665_100000004 | Ga0070665_100000004629 | 75 |
| 131 | 3300005548 | Ga0070665_100455638 | Ga0070665_1004556382 | 75 |
| 132 | 3300005548 | Ga0070665_101748961 | Ga0070665_1017489612 | 75 |
| 133 | 3300005563 | Ga0068855_100000023 | Ga0068855_10000002314 | 75 |
| 134 | 3300005563 | Ga0068855_100233728 | Ga0068855_1002337281 | 75 |
| 135 | 3300005563 | Ga0068855_100395754 | Ga0068855_1003957543 | 75 |
| 136 | 3300005564 | Ga0070664_100964425 | Ga0070664_1009644252 | 75 |
| 137 | 3300005577 | Ga0068857_100034254 | Ga0068857_1000342543 | 75 |
| 138 | 3300005577 | Ga0068857_100089221 | Ga0068857_1000892214 | 75 |
| 139 | 3300005577 | Ga0068857_100202528 | Ga0068857_1002025284 | 75 |
| 140 | 3300005577 | Ga0068857_100322020 | Ga0068857_1003220204 | 75 |
| 141 | 3300005577 | Ga0068857_100977674 | Ga0068857_1009776742 | 75 |
| 142 | 3300005577 | Ga0068857_100987882 | Ga0068857_1009878822 | 75 |
| 143 | 3300005578 | Ga0068854_100013420 | Ga0068854_1000134202 | 75 |
| 144 | 3300005578 | Ga0068854_100075543 | Ga0068854_1000755433 | 75 |
| 145 | 3300005578 | Ga0068854_100095718 | Ga0068854_1000957182 | 75 |
| 146 | 3300005578 | Ga0068854_100178512 | Ga0068854_1001785123 | 75 |
| 147 | 3300005578 | Ga0068854_101280455 | Ga0068854_1012804552 | 75 |
| 148 | 3300005614 | Ga0068856_100404112 | Ga0068856_1004041122 | 75 |
| 149 | 3300005615 | Ga0070702_101132897 | Ga0070702_1011328972 | 75 |
| 150 | 3300005616 | Ga0068852_100003329 | Ga0068852_1000033298 | 75 |
| 151 | 3300005616 | Ga0068852_100055224 | Ga0068852_1000552244 | 75 |
| 152 | 3300005616 | Ga0068852_100086148 | Ga0068852_1000861483 | 75 |
| 153 | 3300005616 | Ga0068852_100447063 | Ga0068852_1004470633 | 75 |
| 154 | 3300005616 | Ga0068852_100748638 | Ga0068852_1007486383 | 75 |
| 155 | 3300005616 | Ga0068852_102813159 | Ga0068852_1028131591 | 75 |
| 156 | 3300005617 | Ga0068859_100028374 | Ga0068859_1000283745 | 75 |
| 157 | 3300005617 | Ga0068859_100206389 | Ga0068859_1002063893 | 75 |
| 158 | 3300005617 | Ga0068859_101398327 | Ga0068859_1013983272 | 75 |
| 159 | 3300005618 | Ga0068864_100005620 | Ga0068864_1000056205 | 75 |
| 160 | 3300005618 | Ga0068864_100007081 | Ga0068864_1000070814 | 75 |
| 161 | 3300005618 | Ga0068864_101499993 | Ga0068864_1014999931 | 75 |
| 162 | 3300005719 | Ga0068861_100020681 | Ga0068861_1000206812 | 75 |
| 163 | 3300005719 | Ga0068861_100285888 | Ga0068861_1002858883 | 75 |
| 164 | 3300005834 | Ga0068851_10062982 | Ga0068851_100629825 | 75 |
| 165 | 3300005834 | Ga0068851_10064379 | Ga0068851_100643793 | 75 |
| 166 | 3300005841 | Ga0068863_100000013 | Ga0068863_100000013175 | 75 |
| 167 | 3300005841 | Ga0068863_100002259 | Ga0068863_10000225916 | 75 |
| 168 | 3300005841 | Ga0068863_100238697 | Ga0068863_1002386972 | 75 |
| 169 | 3300005842 | Ga0068858_100053891 | Ga0068858_1000538913 | 75 |
| 170 | 3300005842 | Ga0068858_100337482 | Ga0068858_1003374822 | 75 |
| 171 | 3300005843 | Ga0068860_100000009 | Ga0068860_100000009251 | 75 |
| 172 | 3300005843 | Ga0068860_100000148 | Ga0068860_100000148118 | 75 |
| 173 | 3300005843 | Ga0068860_100257834 | Ga0068860_1002578344 | 75 |
| 174 | 3300005843 | Ga0068860_102150248 | Ga0068860_1021502482 | 75 |
| 175 | 3300005844 | Ga0068862_100000209 | Ga0068862_10000020929 | 75 |
| 176 | 3300005844 | Ga0068862_100481286 | Ga0068862_1004812862 | 75 |
| 177 | 3300005844 | Ga0068862_100869340 | Ga0068862_1008693402 | 75 |
| 178 | 3300005985 | Ga0081539_10009010 | Ga0081539_100090109 | 75 |
| 179 | 3300006038 | Ga0075365_10513913 | Ga0075365_105139132 | 75 |
| 180 | 3300006042 | Ga0075368_10000385 | Ga0075368_100003859 | 75 |
| 181 | 3300006048 | Ga0075363_100005439 | Ga0075363_1000054396 | 75 |
| 182 | 3300006048 | Ga0075363_100332179 | Ga0075363_1003321792 | 75 |
| 183 | 3300006177 | Ga0075362_10390886 | Ga0075362_103908861 | 75 |
| 184 | 3300006178 | Ga0075367_10000692 | Ga0075367_100006929 | 75 |
| 185 | 3300006186 | Ga0075369_10587601 | Ga0075369_105876012 | 75 |
| 186 | 3300006353 | Ga0075370_10010420 | Ga0075370_100104208 | 75 |
| 187 | 3300006353 | Ga0075370_10063950 | Ga0075370_100639505 | 75 |
| 188 | 3300006353 | Ga0075370_10126540 | Ga0075370_101265403 | 75 |
| 189 | 3300006358 | Ga0068871_102205143 | Ga0068871_1022051432 | 75 |
| 190 | 3300006846 | Ga0075430_100084382 | Ga0075430_1000843824 | 75 |
| 191 | 3300006931 | Ga0097620_100028372 | Ga0097620_1000283725 | 75 |
| 192 | 3300006931 | Ga0097620_100206405 | Ga0097620_1002064053 | 75 |
| 193 | 3300006931 | Ga0097620_101397994 | Ga0097620_1013979942 | 75 |
| 194 | 3300006946 | Ga0079104_1052219 | Ga0079104_10522192 | 75 |
| 195 | 3300006946 | Ga0079104_1054222 | Ga0079104_10542222 | 75 |
| 196 | 3300009011 | Ga0105251_10016214 | Ga0105251_100162144 | 75 |
| 197 | 3300009092 | Ga0105250_10040167 | Ga0105250_100401673 | 75 |
| 198 | 3300009093 | Ga0105240_11380751 | Ga0105240_113807512 | 75 |
| 199 | 3300009093 | Ga0105240_11857066 | Ga0105240_118570662 | 75 |
| 200 | 3300009093 | Ga0105240_12340423 | Ga0105240_123404232 | 75 |
| 201 | 3300009094 | Ga0111539_11288518 | Ga0111539_112885182 | 75 |
| 202 | 3300009101 | Ga0105247_10144469 | Ga0105247_101444693 | 75 |
| 203 | 3300009148 | Ga0105243_10767589 | Ga0105243_107675891 | 75 |
| 204 | 3300009174 | Ga0105241_10631007 | Ga0105241_106310072 | 75 |
| 205 | 3300009174 | Ga0105241_11641341 | Ga0105241_116413412 | 75 |
| 206 | 3300009174 | Ga0105241_12495943 | Ga0105241_124959432 | 75 |
| 207 | 3300009177 | Ga0105248_10059949 | Ga0105248_100599493 | 75 |
| 208 | 3300009177 | Ga0105248_10501134 | Ga0105248_105011343 | 75 |
| 209 | 3300009177 | Ga0105248_11064157 | Ga0105248_110641572 | 75 |
| 210 | 3300009545 | Ga0105237_10048537 | Ga0105237_100485374 | 75 |
| 211 | 3300009545 | Ga0105237_10059304 | Ga0105237_100593043 | 75 |
| 212 | 3300009545 | Ga0105237_10091535 | Ga0105237_100915355 | 75 |
| 213 | 3300009545 | Ga0105237_12287021 | Ga0105237_122870212 | 75 |
| 214 | 3300009551 | Ga0105238_10102613 | Ga0105238_101026134 | 75 |
| 215 | 3300009551 | Ga0105238_10455402 | Ga0105238_104554022 | 75 |
| 216 | 3300009551 | Ga0105238_10668100 | Ga0105238_106681001 | 75 |
| 217 | 3300009551 | Ga0105238_10763869 | Ga0105238_107638693 | 75 |
| 218 | 3300009553 | Ga0105249_10000006 | Ga0105249_10000006114 | 75 |
| 219 | 3300009553 | Ga0105249_10291555 | Ga0105249_102915555 | 75 |
| 220 | 3300009553 | Ga0105249_11366562 | Ga0105249_113665622 | 75 |
| 221 | 3300009978 | Ga0105148_100540 | Ga0105148_1005405 | 75 |
| 222 | 3300010375 | Ga0105239_10570804 | Ga0105239_105708042 | 75 |
| 223 | 3300010375 | Ga0105239_10620545 | Ga0105239_106205452 | 75 |
| 224 | 3300010375 | Ga0105239_12198078 | Ga0105239_121980781 | 75 |
| 225 | 3300011119 | Ga0105246_10477789 | Ga0105246_104777893 | 75 |
| 226 | 3300013100 | Ga0157373_10087299 | Ga0157373_100872994 | 75 |
| 227 | 3300013100 | Ga0157373_10152393 | Ga0157373_101523933 | 75 |
| 228 | 3300013100 | Ga0157373_10615179 | Ga0157373_106151792 | 75 |
| 229 | 3300013104 | Ga0157370_11983841 | Ga0157370_119838411 | 75 |
| 230 | 3300013105 | Ga0157369_10000713 | Ga0157369_1000071319 | 75 |
| 231 | 3300013105 | Ga0157369_10335132 | Ga0157369_103351322 | 75 |
| 232 | 3300013105 | Ga0157369_10445942 | Ga0157369_104459425 | 75 |
| 233 | 3300013105 | Ga0157369_10666774 | Ga0157369_106667742 | 75 |
| 234 | 3300013105 | Ga0157369_11745265 | Ga0157369_117452652 | 75 |
| 235 | 3300013297 | Ga0157378_10501215 | Ga0157378_105012153 | 75 |
| 236 | 3300013306 | Ga0163162_10008623 | Ga0163162_100086237 | 75 |
| 237 | 3300013307 | Ga0157372_10032771 | Ga0157372_100327718 | 75 |
| 238 | 3300013307 | Ga0157372_10059842 | Ga0157372_100598426 | 75 |
| 239 | 3300013307 | Ga0157372_10354637 | Ga0157372_103546374 | 75 |
| 240 | 3300013307 | Ga0157372_10901142 | Ga0157372_109011421 | 75 |
| 241 | 3300013307 | Ga0157372_11525579 | Ga0157372_115255792 | 75 |
| 242 | 3300013307 | Ga0157372_12055020 | Ga0157372_120550202 | 75 |
| 243 | 3300013307 | Ga0157372_12223916 | Ga0157372_122239162 | 75 |
| 244 | 3300013308 | Ga0157375_12028727 | Ga0157375_120287272 | 75 |
| 245 | 3300014325 | Ga0163163_10071955 | Ga0163163_100719554 | 75 |
| 246 | 3300014326 | Ga0157380_10000182 | Ga0157380_100001828 | 75 |
| 247 | 3300014326 | Ga0157380_10058444 | Ga0157380_100584443 | 75 |
| 248 | 3300014968 | Ga0157379_10049804 | Ga0157379_100498043 | 75 |
| 249 | 3300017792 | Ga0163161_12080327 | Ga0163161_120803271 | 75 |
| 250 | 3300020081 | Ga0206354_11591560 | Ga0206354_115915601 | 75 |
| 251 | 3300021384 | Ga0213876_10001077 | Ga0213876_1000107716 | 75 |
| 252 | 3300021384 | Ga0213876_10022787 | Ga0213876_100227871 | 75 |
| 253 | 3300025250 | Ga0209026_1001465 | Ga0209026_10014658 | 75 |
| 254 | 3300025297 | Ga0209758_1000555 | Ga0209758_100055538 | 75 |
| 255 | 3300025298 | Ga0209050_1000034 | Ga0209050_1000034228 | 75 |
| 256 | 3300025304 | Ga0209257_1000052 | Ga0209257_1000052182 | 75 |
| 257 | 3300025304 | Ga0209257_1000100 | Ga0209257_100010047 | 75 |
| 258 | 3300025304 | Ga0209257_1014543 | Ga0209257_10145433 | 75 |
| 259 | 3300025321 | Ga0207656_10246283 | Ga0207656_102462832 | 75 |
| 260 | 3300025901 | Ga0207688_10591391 | Ga0207688_105913911 | 75 |
| 261 | 3300025903 | Ga0207680_10400053 | Ga0207680_104000532 | 75 |
| 262 | 3300025903 | Ga0207680_10806718 | Ga0207680_108067182 | 75 |
| 263 | 3300025903 | Ga0207680_11279796 | Ga0207680_112797961 | 75 |
| 264 | 3300025909 | Ga0207705_10385123 | Ga0207705_103851232 | 75 |
| 265 | 3300025909 | Ga0207705_10925174 | Ga0207705_109251741 | 75 |
| 266 | 3300025911 | Ga0207654_10187655 | Ga0207654_101876552 | 75 |
| 267 | 3300025913 | Ga0207695_11450916 | Ga0207695_114509162 | 75 |
| 268 | 3300025914 | Ga0207671_10229002 | Ga0207671_102290023 | 75 |
| 269 | 3300025917 | Ga0207660_10365805 | Ga0207660_103658052 | 75 |
| 270 | 3300025918 | Ga0207662_10472288 | Ga0207662_104722883 | 75 |
| 271 | 3300025919 | Ga0207657_10052419 | Ga0207657_100524195 | 75 |
| 272 | 3300025920 | Ga0207649_10000043 | Ga0207649_1000004378 | 75 |
| 273 | 3300025923 | Ga0207681_10361412 | Ga0207681_103614123 | 75 |
| 274 | 3300025923 | Ga0207681_10595161 | Ga0207681_105951612 | 75 |
| 275 | 3300025923 | Ga0207681_11816477 | Ga0207681_118164772 | 75 |
| 276 | 3300025923 | Ga0207681_11871021 | Ga0207681_118710212 | 75 |
| 277 | 3300025924 | Ga0207694_10035042 | Ga0207694_100350426 | 75 |
| 278 | 3300025924 | Ga0207694_10322619 | Ga0207694_103226193 | 75 |
| 279 | 3300025924 | Ga0207694_10359393 | Ga0207694_103593932 | 75 |
| 280 | 3300025924 | Ga0207694_10585392 | Ga0207694_105853921 | 75 |
| 281 | 3300025925 | Ga0207650_10176847 | Ga0207650_101768472 | 75 |
| 282 | 3300025926 | Ga0207659_11720034 | Ga0207659_117200342 | 75 |
| 283 | 3300025931 | Ga0207644_10022986 | Ga0207644_100229861 | 75 |
| 284 | 3300025931 | Ga0207644_11532315 | Ga0207644_115323152 | 75 |
| 285 | 3300025932 | Ga0207690_10052761 | Ga0207690_100527612 | 75 |
| 286 | 3300025933 | Ga0207706_10015340 | Ga0207706_100153404 | 75 |
| 287 | 3300025933 | Ga0207706_10211000 | Ga0207706_102110001 | 75 |
| 288 | 3300025935 | Ga0207709_10413443 | Ga0207709_104134433 | 75 |
| 289 | 3300025937 | Ga0207669_10156416 | Ga0207669_101564163 | 75 |
| 290 | 3300025941 | Ga0207711_10033334 | Ga0207711_100333344 | 75 |
| 291 | 3300025941 | Ga0207711_10663848 | Ga0207711_106638482 | 75 |
| 292 | 3300025942 | Ga0207689_10391024 | Ga0207689_103910242 | 75 |
| 293 | 3300025942 | Ga0207689_10587898 | Ga0207689_105878981 | 75 |
| 294 | 3300025944 | Ga0207661_11905538 | Ga0207661_119055382 | 75 |
| 295 | 3300025949 | Ga0207667_11327157 | Ga0207667_113271572 | 75 |
| 296 | 3300025972 | Ga0207668_10012421 | Ga0207668_100124219 | 75 |
| 297 | 3300025972 | Ga0207668_10034185 | Ga0207668_100341855 | 75 |
| 298 | 3300025972 | Ga0207668_11605880 | Ga0207668_116058802 | 75 |
| 299 | 3300025981 | Ga0207640_10020993 | Ga0207640_100209934 | 75 |
| 300 | 3300025981 | Ga0207640_10080263 | Ga0207640_100802633 | 75 |
| 301 | 3300025981 | Ga0207640_10380129 | Ga0207640_103801292 | 75 |
| 302 | 3300025981 | Ga0207640_10726370 | Ga0207640_107263702 | 75 |
| 303 | 3300025986 | Ga0207658_10000069 | Ga0207658_10000069115 | 75 |
| 304 | 3300026023 | Ga0207677_10733962 | Ga0207677_107339623 | 75 |
| 305 | 3300026041 | Ga0207639_10000771 | Ga0207639_1000077113 | 75 |
| 306 | 3300026041 | Ga0207639_10160773 | Ga0207639_101607734 | 75 |
| 307 | 3300026041 | Ga0207639_10187001 | Ga0207639_101870013 | 75 |
| 308 | 3300026041 | Ga0207639_10730579 | Ga0207639_107305792 | 75 |
| 309 | 3300026041 | Ga0207639_11486247 | Ga0207639_114862472 | 75 |
| 310 | 3300026067 | Ga0207678_10889898 | Ga0207678_108898982 | 75 |
| 311 | 3300026078 | Ga0207702_10291064 | Ga0207702_102910643 | 75 |
| 312 | 3300026088 | Ga0207641_10003319 | Ga0207641_100033196 | 75 |
| 313 | 3300026088 | Ga0207641_10004490 | Ga0207641_100044905 | 75 |
| 314 | 3300026095 | Ga0207676_10041840 | Ga0207676_100418405 | 75 |
| 315 | 3300026116 | Ga0207674_10008322 | Ga0207674_1000832210 | 75 |
| 316 | 3300026116 | Ga0207674_10016903 | Ga0207674_1001690311 | 75 |
| 317 | 3300026116 | Ga0207674_10088087 | Ga0207674_100880874 | 75 |
| 318 | 3300026116 | Ga0207674_10239259 | Ga0207674_102392593 | 75 |
| 319 | 3300026116 | Ga0207674_10895518 | Ga0207674_108955182 | 75 |
| 320 | 3300026116 | Ga0207674_10959275 | Ga0207674_109592751 | 75 |
| 321 | 3300026118 | Ga0207675_100001918 | Ga0207675_10000191823 | 75 |
| 322 | 3300026118 | Ga0207675_100231134 | Ga0207675_1002311343 | 75 |
| 323 | 3300026118 | Ga0207675_100279112 | Ga0207675_1002791123 | 75 |
| 324 | 3300026121 | Ga0207683_10820574 | Ga0207683_108205742 | 75 |
| 325 | 3300026121 | Ga0207683_11590295 | Ga0207683_115902952 | 75 |
| 326 | 3300026142 | Ga0207698_10000130 | Ga0207698_1000013027 | 75 |
| 327 | 3300026142 | Ga0207698_10102005 | Ga0207698_101020053 | 75 |
| 328 | 3300026142 | Ga0207698_10109159 | Ga0207698_101091592 | 75 |
| 329 | 3300026142 | Ga0207698_10407978 | Ga0207698_104079783 | 75 |
| 330 | 3300026142 | Ga0207698_10602564 | Ga0207698_106025642 | 75 |
| 331 | 3300026142 | Ga0207698_10675077 | Ga0207698_106750771 | 75 |
| 332 | 3300026142 | Ga0207698_11276964 | Ga0207698_112769642 | 75 |
| 333 | 3300027111 | Ga0209281_1021396 | Ga0209281_10213963 | 75 |
| 334 | 3300027111 | Ga0209281_1042409 | Ga0209281_10424092 | 75 |
| 335 | 3300028380 | Ga0268265_10648415 | Ga0268265_106484152 | 75 |
| 336 | 3300028381 | Ga0268264_10000217 | Ga0268264_10000217115 | 75 |
| 337 | 3300028381 | Ga0268264_10157361 | Ga0268264_101573612 | 75 |
| 338 | 3300028381 | Ga0268264_11740826 | Ga0268264_117408262 | 75 |
| 339 | 3300030521 | Ga0307511_10082979 | Ga0307511_100829794 | 75 |
| 340 | 3300031548 | Ga0307408_100388134 | Ga0307408_1003881343 | 75 |
| 341 | 3300031548 | Ga0307408_100545382 | Ga0307408_1005453822 | 75 |
| 342 | 3300031548 | Ga0307408_101275253 | Ga0307408_1012752532 | 75 |
| 343 | 3300031548 | Ga0307408_101927041 | Ga0307408_1019270412 | 75 |
| 344 | 3300031731 | Ga0307405_10015706 | Ga0307405_100157064 | 75 |
| 345 | 3300031731 | Ga0307405_10233043 | Ga0307405_102330433 | 75 |
| 346 | 3300031731 | Ga0307405_10422638 | Ga0307405_104226383 | 75 |
| 347 | 3300031731 | Ga0307405_10442013 | Ga0307405_104420133 | 75 |
| 348 | 3300031731 | Ga0307405_10830145 | Ga0307405_108301452 | 75 |
| 349 | 3300031824 | Ga0307413_10375086 | Ga0307413_103750863 | 75 |
| 350 | 3300031824 | Ga0307413_11004602 | Ga0307413_110046022 | 75 |
| 351 | 3300031824 | Ga0307413_11966890 | Ga0307413_119668902 | 75 |
| 352 | 3300031852 | Ga0307410_10572941 | Ga0307410_105729412 | 75 |
| 353 | 3300031901 | Ga0307406_10071868 | Ga0307406_100718683 | 75 |
| 354 | 3300031901 | Ga0307406_10151212 | Ga0307406_101512122 | 75 |
| 355 | 3300031901 | Ga0307406_10312328 | Ga0307406_103123282 | 75 |
| 356 | 3300031901 | Ga0307406_10350397 | Ga0307406_103503972 | 75 |
| 357 | 3300031903 | Ga0307407_10227621 | Ga0307407_102276213 | 75 |
| 358 | 3300031911 | Ga0307412_10075035 | Ga0307412_100750353 | 75 |
| 359 | 3300031911 | Ga0307412_10135773 | Ga0307412_101357733 | 75 |
| 360 | 3300031911 | Ga0307412_10379010 | Ga0307412_103790102 | 75 |
| 361 | 3300031911 | Ga0307412_11378238 | Ga0307412_113782382 | 75 |
| 362 | 3300031911 | Ga0307412_11460401 | Ga0307412_114604012 | 75 |
| 363 | 3300031995 | Ga0307409_100244787 | Ga0307409_1002447872 | 75 |
| 364 | 3300031995 | Ga0307409_100365136 | Ga0307409_1003651363 | 75 |
| 365 | 3300031995 | Ga0307409_100485830 | Ga0307409_1004858303 | 75 |
| 366 | 3300032002 | Ga0307416_100491586 | Ga0307416_1004915863 | 75 |
| 367 | 3300032002 | Ga0307416_102537652 | Ga0307416_1025376521 | 75 |
| 368 | 3300032004 | Ga0307414_10001522 | Ga0307414_1000152213 | 75 |
| 369 | 3300032004 | Ga0307414_10085486 | Ga0307414_100854862 | 75 |
| 370 | 3300032004 | Ga0307414_10202434 | Ga0307414_102024343 | 75 |
| 371 | 3300032005 | Ga0307411_10459087 | Ga0307411_104590873 | 75 |
| 372 | 3300032005 | Ga0307411_11195573 | Ga0307411_111955732 | 75 |
| 373 | 3300032005 | Ga0307411_12179013 | Ga0307411_121790132 | 75 |
| 374 | 3300032126 | Ga0307415_100060290 | Ga0307415_1000602903 | 75 |
| 375 | 3300032126 | Ga0307415_100197799 | Ga0307415_1001977993 | 75 |
| 376 | 3300032126 | Ga0307415_100740511 | Ga0307415_1007405112 | 75 |
| 377 | 3300033180 | Ga0307510_10308054 | Ga0307510_103080542 | 75 |
| 378 | 3300036401 | Ga0373937_0267550 | Ga0373937_0267550_198_431 | 75 |
| 379 | 3300037471 | Ga0395905_0356568 | Ga0395905_0356568_567_800 | 75 |
| 380 | 3300037471 | Ga0395905_0364976 | Ga0395905_0364976_580_813 | 75 |
| 381 | 3300037471 | Ga0395905_0487066 | Ga0395905_0487066_380_613 | 75 |
| 382 | 3300037471 | Ga0395905_1046289 | Ga0395905_1046289_62_295 | 75 |
| 383 | 3300039437 | Ga0436365_0378480 | Ga0436365_0378480_1656_1889 | 75 |
| 384 | 3300039437 | Ga0436365_0600332 | Ga0436365_0600332_109_342 | 75 |
| 385 | 3300039437 | Ga0436365_0770163 | Ga0436365_0770163_201_434 | 75 |
| 386 | 3300039437 | Ga0436365_1117045 | Ga0436365_1117045_3511_3738 | 75 |
| 387 | 3300039450 | Ga0436363_1615302 | Ga0436363_1615302_621_860 | 75 |
| 388 | 3300039453 | Ga0436362_0438371 | Ga0436362_0438371_493_732 | 75 |
| 389 | 3300041404 | Ga0439436_0045695 | Ga0439436_0045695_640_879 | 75 |
| 390 | 3300041410 | Ga0439461_0046235 | Ga0439461_0046235_223_456 | 75 |
| 391 | 3300041443 | Ga0451789_0051834 | Ga0451789_0051834_258_491 | 75 |
| 392 | 3300041451 | Ga0451791_1915041 | Ga0451791_1915041_635_862 | 75 |
| 393 | 3300041460 | Ga0451802_0252467 | Ga0451802_0252467_99_332 | 75 |
| 394 | 3300041486 | Ga0451807_1450983 | Ga0451807_1450983_232_468 | 75 |
| 395 | 3300041496 | Ga0451839_1164718 | Ga0451839_1164718_256_483 | 75 |
| 396 | 3300041509 | Ga0451843_0433053 | Ga0451843_0433053_32_265 | 75 |
| 397 | 3300041509 | Ga0451843_1746187 | Ga0451843_1746187_141_374 | 75 |
| 398 | 3300041512 | Ga0451853_0669204 | Ga0451853_0669204_224_460 | 75 |
| 399 | 3300041997 | Ga0439431_0000140 | Ga0439431_0000140_12433_12672 | 75 |
| 400 | 3300042002 | Ga0439442_013335 | Ga0439442_013335_475_714 | 75 |
| 401 | 3300042005 | Ga0439448_0001939 | Ga0439448_0001939_279_512 | 75 |
| 402 | 3300042007 | Ga0439449_0289840 | Ga0439449_0289840_218_457 | 75 |
| 403 | 3300042012 | Ga0439455_0001428 | Ga0439455_0001428_3169_3402 | 75 |
| 404 | 3300042012 | Ga0439455_0003870 | Ga0439455_0003870_874_1107 | 75 |
| 405 | 3300042012 | Ga0439455_0014742 | Ga0439455_0014742_1517_1750 | 75 |
| 406 | 3300042435 | Ga0439434_0006562 | Ga0439434_0006562_1487_1726 | 75 |
| 407 | 3300044658 | Ga0466972_0000826 | Ga0466972_0000826_5375_5608 | 75 |
| 408 | 3300044684 | Ga0466966_0217347 | Ga0466966_0217347_241_474 | 75 |
| 409 | 3300044693 | Ga0466961_0036040 | Ga0466961_0036040_1727_1960 | 75 |
| 410 | 3300044693 | Ga0466961_0070130 | Ga0466961_0070130_1873_2106 | 75 |
| 411 | 3300044693 | Ga0466961_0307740 | Ga0466961_0307740_510_752 | 75 |
| 412 | 3300044694 | Ga0466963_0005815 | Ga0466963_0005815_3463_3696 | 75 |
| 413 | 3300044706 | Ga0466964_0000258 | Ga0466964_0000258_4015_4248 | 75 |
| 414 | 3300044706 | Ga0466964_0142197 | Ga0466964_0142197_216_449 | 75 |
| 415 | 3300044719 | Ga0466971_0005805 | Ga0466971_0005805_534_767 | 75 |
| 416 | 3300044735 | Ga0466968_0038917 | Ga0466968_0038917_1693_1932 | 75 |
| 417 | 3300044735 | Ga0466968_0236455 | Ga0466968_0236455_610_843 | 75 |
| 418 | 3300044765 | Ga0466970_0638277 | Ga0466970_0638277_51_284 | 75 |
| 419 | 3300044842 | Ga0466957_0042426 | Ga0466957_0042426_1329_1562 | 75 |
| 420 | 3300044901 | Ga0466960_0004100 | Ga0466960_0004100_3110_3343 | 75 |
| 421 | 3300045049 | Ga0466959_0561217 | Ga0466959_0561217_440_673 | 75 |
| 422 | 3300045836 | Ga0466958_0017628 | Ga0466958_0017628_1681_1914 | 75 |
| 423 | 3300045976 | Ga0466967_0053000 | Ga0466967_0053000_2247_2480 | 75 |
| 424 | 3300045976 | Ga0466967_2154385 | Ga0466967_2154385_240_473 | 75 |
| 425 | 3300046460 | Ga0495638_0006069 | Ga0495638_0006069_3018_3245 | 75 |
| 426 | 3300046460 | Ga0495638_0019313 | Ga0495638_0019313_1702_1935 | 75 |
| 427 | 3300046460 | Ga0495638_0102689 | Ga0495638_0102689_221_454 | 75 |
| 428 | 3300046471 | Ga0495650_0027516 | Ga0495650_0027516_1295_1528 | 75 |
| 429 | 3300046506 | Ga0495583_0000218 | Ga0495583_0000218_87283_87516 | 75 |
| 430 | 3300046519 | Ga0495632_0317276 | Ga0495632_0317276_77_310 | 75 |
| 431 | 3300046525 | Ga0495663_0003548 | Ga0495663_0003548_723_962 | 75 |
| 432 | 3300046530 | Ga0495654_0001073 | Ga0495654_0001073_15359_15592 | 75 |
| 433 | 3300046537 | Ga0495598_0004672 | Ga0495598_0004672_565_804 | 75 |
| 434 | 3300046539 | Ga0495621_0003301 | Ga0495621_0003301_218_457 | 75 |
| 435 | 3300046539 | Ga0495621_0179383 | Ga0495621_0179383_283_510 | 75 |
| 436 | 3300046542 | Ga0495597_0090244 | Ga0495597_0090244_486_719 | 75 |
| 437 | 3300046557 | Ga0495622_0478758 | Ga0495622_0478758_198_431 | 75 |
| 438 | 3300046616 | Ga0495668_0006416 | Ga0495668_0006416_3121_3354 | 75 |
| 439 | 3300046616 | Ga0495668_0011998 | Ga0495668_0011998_2664_2897 | 75 |
| 440 | 3300046616 | Ga0495668_0091593 | Ga0495668_0091593_776_1009 | 75 |
| 441 | 3300046616 | Ga0495668_0133256 | Ga0495668_0133256_851_1084 | 75 |
| 442 | 3300046616 | Ga0495668_0181938 | Ga0495668_0181938_98_340 | 75 |
| 443 | 3300046616 | Ga0495668_0307692 | Ga0495668_0307692_164_397 | 75 |
| 444 | 3300046660 | Ga0495625_0045065 | Ga0495625_0045065_596_829 | 75 |
| 445 | 3300046660 | Ga0495625_0287690 | Ga0495625_0287690_681_914 | 75 |
| 446 | 3300046691 | Ga0495670_0010027 | Ga0495670_0010027_1512_1745 | 75 |
| 447 | 3300046794 | Ga0495589_0067756 | Ga0495589_0067756_768_1001 | 75 |
| 448 | 3300047469 | Ga0495673_0011196 | Ga0495673_0011196_1640_1873 | 75 |
| 449 | 3300047472 | Ga0495686_0001246 | Ga0495686_0001246_25634_25873 | 75 |
| 450 | 3300047472 | Ga0495686_0048131 | Ga0495686_0048131_1480_1713 | 75 |
| 451 | 3300047472 | Ga0495686_0684368 | Ga0495686_0684368_227_466 | 75 |
| 452 | 3300048091 | Ga0495626_0421678 | Ga0495626_0421678_118_351 | 75 |
| 453 | 3300048905 | Ga0496102_0087675 | Ga0496102_0087675_386_619 | 75 |
| 454 | 3300048905 | Ga0496102_1416872 | Ga0496102_1416872_251_484 | 75 |
| 455 | 3300048907 | Ga0496104_1390858 | Ga0496104_1390858_281_520 | 75 |
| 456 | 3300048911 | Ga0496108_0000682 | Ga0496108_0000682_14343_14570 | 75 |
| 457 | 3300048913 | Ga0496110_0419373 | Ga0496110_0419373_622_849 | 75 |
| 458 | 3300048916 | Ga0496113_0519615 | Ga0496113_0519615_261_500 | 75 |
| 459 | 3300048919 | Ga0496116_0021417 | Ga0496116_0021417_672_899 | 75 |
| 460 | 3300048920 | Ga0496117_0354351 | Ga0496117_0354351_126_359 | 75 |
| 461 | 3300048921 | Ga0496118_0109131 | Ga0496118_0109131_552_785 | 75 |
| 462 | 3300048924 | Ga0496121_0000296 | Ga0496121_0000296_28450_28689 | 75 |
| 463 | 3300048924 | Ga0496121_0003051 | Ga0496121_0003051_8419_8646 | 75 |
| 464 | 3300048925 | Ga0496122_0039577 | Ga0496122_0039577_2879_3106 | 75 |
| 465 | 3300048925 | Ga0496122_0192299 | Ga0496122_0192299_311_544 | 75 |
| 466 | 3300048925 | Ga0496122_0313438 | Ga0496122_0313438_241_480 | 75 |
| 467 | 3300048926 | Ga0496123_0116075 | Ga0496123_0116075_1221_1454 | 75 |
| 468 | 3300048926 | Ga0496123_0156766 | Ga0496123_0156766_489_728 | 75 |
| 469 | 3300048927 | Ga0496124_0005852 | Ga0496124_0005852_11026_11265 | 75 |
| 470 | 3300048927 | Ga0496124_0033927 | Ga0496124_0033927_1924_2151 | 75 |
| 471 | 3300048927 | Ga0496124_0048088 | Ga0496124_0048088_418_657 | 75 |
| 472 | 3300048927 | Ga0496124_0265665 | Ga0496124_0265665_865_1092 | 75 |
| 473 | 3300048927 | Ga0496124_0363072 | Ga0496124_0363072_51_278 | 75 |
| 474 | 3300048927 | Ga0496124_0750333 | Ga0496124_0750333_47_286 | 75 |
| 475 | 3300048928 | Ga0496125_0049187 | Ga0496125_0049187_2394_2639 | 75 |
| 476 | 3300048928 | Ga0496125_0072386 | Ga0496125_0072386_1244_1471 | 75 |
| 477 | 3300048928 | Ga0496125_0091131 | Ga0496125_0091131_964_1191 | 75 |
| 478 | 3300048928 | Ga0496125_0286884 | Ga0496125_0286884_499_738 | 75 |
| 479 | 3300048928 | Ga0496125_0308228 | Ga0496125_0308228_71_310 | 75 |
| 480 | 3300048928 | Ga0496125_0394973 | Ga0496125_0394973_338_565 | 75 |
| 481 | 3300048929 | Ga0496126_0004477 | Ga0496126_0004477_8128_8355 | 75 |
| 482 | 3300049127 | Ga0501306_009105 | Ga0501306_009105_172_405 | 75 |
| 483 | 3300049161 | Ga0501305_021695 | Ga0501305_021695_645_878 | 75 |
| 484 | 3300049162 | Ga0501307_005380 | Ga0501307_005380_723_956 | 75 |
| 485 | 3300049459 | Ga0495678_137000 | Ga0495678_137000_417_650 | 75 |
| 486 | 3300049460 | Ga0495682_0053138 | Ga0495682_0053138_919_1152 | 75 |
| 487 | 3300049527 | Ga0501311_027272 | Ga0501311_027272_141_374 | 75 |
| 488 | 3300049528 | Ga0501312_025302 | Ga0501312_025302_510_743 | 75 |
| 489 | 3300049529 | Ga0501313_020213 | Ga0501313_020213_515_748 | 75 |
| 490 | 3300049530 | Ga0501314_017825 | Ga0501314_017825_386_619 | 75 |
| 491 | 3300049531 | Ga0501315_046231 | Ga0501315_046231_74_307 | 75 |
| 492 | 3300049536 | Ga0501320_006506 | Ga0501320_006506_294_527 | 75 |
| 493 | 3300049537 | Ga0501321_056218 | Ga0501321_056218_209_442 | 75 |
| 494 | 3300049552 | Ga0501336_018821 | Ga0501336_018821_288_521 | 75 |
| 495 | 3300049570 | Ga0501033_0205815 | Ga0501033_0205815_80_319 | 75 |
| 496 | 3300049570 | Ga0501033_0214787 | Ga0501033_0214787_648_881 | 75 |
| 497 | 3300049571 | Ga0501034_1557758 | Ga0501034_1557758_23_262 | 75 |
| 498 | 3300049572 | Ga0501036_1078947 | Ga0501036_1078947_173_412 | 75 |
| 499 | 3300049574 | Ga0501038_0059946 | Ga0501038_0059946_2980_3207 | 75 |
| 500 | 3300049574 | Ga0501038_0905183 | Ga0501038_0905183_162_410 | 75 |
| 501 | 3300049575 | Ga0501039_0229604 | Ga0501039_0229604_1089_1316 | 75 |
| 502 | 3300049578 | Ga0501042_0229792 | Ga0501042_0229792_1058_1291 | 75 |
| 503 | 3300049579 | Ga0501043_0049166 | Ga0501043_0049166_2324_2563 | 75 |
| 504 | 3300049580 | Ga0501046_0476873 | Ga0501046_0476873_441_674 | 75 |
| 505 | 3300049581 | Ga0501047_0104148 | Ga0501047_0104148_1670_1903 | 75 |
| 506 | 3300049581 | Ga0501047_0130480 | Ga0501047_0130480_2148_2381 | 75 |
| 507 | 3300049581 | Ga0501047_0673401 | Ga0501047_0673401_285_518 | 75 |
| 508 | 3300049581 | Ga0501047_0885518 | Ga0501047_0885518_398_637 | 75 |
| 509 | 3300049589 | Ga0501073_0480905 | Ga0501073_0480905_153_386 | 75 |
| 510 | 3300049590 | Ga0501074_0436178 | Ga0501074_0436178_10_243 | 75 |
| 511 | 3300049592 | Ga0501076_0137133 | Ga0501076_0137133_1683_1916 | 75 |
| 512 | 3300049649 | Ga0501198_007724 | Ga0501198_007724_194_427 | 75 |
| 513 | 3300049652 | Ga0501202_214062 | Ga0501202_214062_58_291 | 75 |
| 514 | 3300049663 | Ga0501223_000039 | Ga0501223_000039_17621_17848 | 75 |
| 515 | 3300049676 | Ga0501246_001398 | Ga0501246_001398_992_1219 | 75 |
| 516 | 3300049679 | Ga0501249_000213 | Ga0501249_000213_16123_16356 | 75 |
| 517 | 3300049686 | Ga0501257_000049 | Ga0501257_000049_24393_24626 | 75 |
| 518 | 3300049705 | Ga0501225_0000010 | Ga0501225_0000010_74009_74236 | 75 |
| 519 | 3300049758 | Ga0501241_014967 | Ga0501241_014967_921_1154 | 75 |
| 520 | 3300049758 | Ga0501241_024823 | Ga0501241_024823_226_459 | 75 |
| 521 | 3300049764 | Ga0501267_002297 | Ga0501267_002297_1371_1604 | 75 |
| 522 | 3300049766 | Ga0501269_003897 | Ga0501269_003897_1231_1464 | 75 |
| 523 | 3300049822 | Ga0501035_0350527 | Ga0501035_0350527_648_887 | 75 |
| 524 | 3300049822 | Ga0501035_0526827 | Ga0501035_0526827_539_772 | 75 |
| 525 | 3300049822 | Ga0501035_1366166 | Ga0501035_1366166_298_531 | 75 |
| 526 | 3300049823 | Ga0501044_0074300 | Ga0501044_0074300_2441_2680 | 75 |
| 527 | 3300049850 | Ga0501204_000430 | Ga0501204_000430_1164_1397 | 75 |
| 528 | 3300050493 | nmdc:mga0k408_150993_c1 | nmdc:mga0k408_150993_c1_112_339 | 75 |
| 529 | 3300050493 | nmdc:mga0k408_9833_c1 | nmdc:mga0k408_9833_c1_4595_4828 | 75 |
| 530 | 3300050496 | nmdc:mga07m45_144097_c1 | nmdc:mga07m45_144097_c1_830_1063 | 75 |
| 531 | 3300050496 | nmdc:mga07m45_65525_c1 | nmdc:mga07m45_65525_c1_1052_1285 | 75 |
| 532 | 3300050509 | nmdc:mga0qj67_77287_c1 | nmdc:mga0qj67_77287_c1_480_713 | 75 |
| 533 | 3300053087 | Ga0500643_000135 | Ga0500643_000135_50699_50932 | 75 |
| 534 | 3300053087 | Ga0500643_000195 | Ga0500643_000195_54767_55009 | 75 |
| 535 | 3300053087 | Ga0500643_000783 | Ga0500643_000783_11692_11925 | 75 |
| 536 | 3300053087 | Ga0500643_003224 | Ga0500643_003224_3105_3347 | 75 |
| 537 | 3300053087 | Ga0500643_018446 | Ga0500643_018446_385_612 | 75 |
| 538 | 3300053087 | Ga0500643_020706 | Ga0500643_020706_1447_1674 | 75 |
| 539 | 3300053087 | Ga0500643_025387 | Ga0500643_025387_1013_1246 | 75 |
| 540 | 3300053087 | Ga0500643_097989 | Ga0500643_097989_193_426 | 75 |
| 541 | 3300053087 | Ga0500643_193444 | Ga0500643_193444_33_266 | 75 |
| 542 | 3300053103 | Ga0500555_000575 | Ga0500555_000575_8830_9063 | 75 |
| 543 | 3300053103 | Ga0500555_142520 | Ga0500555_142520_56_289 | 75 |
| 544 | 3300053104 | Ga0500556_0000222 | Ga0500556_0000222_4392_4625 | 75 |
| 545 | 3300053105 | Ga0500557_124997 | Ga0500557_124997_425_658 | 75 |
| 546 | 3300053108 | Ga0500562_049382 | Ga0500562_049382_204_437 | 75 |
| 547 | 3300053111 | Ga0500572_271158 | Ga0500572_271158_212_445 | 75 |
| 548 | 3300053116 | Ga0500592_002248 | Ga0500592_002248_1596_1838 | 75 |
| 549 | 3300053119 | Ga0500595_012152 | Ga0500595_012152_231_464 | 75 |
| 550 | 3300053121 | Ga0500607_000844 | Ga0500607_000844_26304_26537 | 75 |
| 551 | 3300053122 | Ga0500608_007769 | Ga0500608_007769_3269_3496 | 75 |
| 552 | 3300053130 | Ga0500642_0000011 | Ga0500642_0000011_147278_147511 | 75 |
| 553 | 3300053130 | Ga0500642_0121939 | Ga0500642_0121939_425_658 | 75 |
| 554 | 3300053136 | Ga0500559_0003805 | Ga0500559_0003805_2916_3149 | 75 |
| 555 | 3300053136 | Ga0500559_0008073 | Ga0500559_0008073_3051_3284 | 75 |
| 556 | 3300053136 | Ga0500559_0166247 | Ga0500559_0166247_787_1020 | 75 |
| 557 | 3300053136 | Ga0500559_0304718 | Ga0500559_0304718_454_681 | 75 |
| 558 | 3300053139 | Ga0500568_0260875 | Ga0500568_0260875_194_421 | 75 |
| 559 | 3300053140 | Ga0500573_0000114 | Ga0500573_0000114_23623_23856 | 75 |
| 560 | 3300053148 | Ga0500590_065735 | Ga0500590_065735_1358_1591 | 75 |
| 561 | 3300053151 | Ga0500604_0039631 | Ga0500604_0039631_921_1154 | 75 |
| 562 | 3300053157 | Ga0500624_000106 | Ga0500624_000106_35734_35961 | 75 |
| 563 | 3300053158 | Ga0500627_0000570 | Ga0500627_0000570_6722_6955 | 75 |
| 564 | 3300053158 | Ga0500627_0279338 | Ga0500627_0279338_463_705 | 75 |
| 565 | 3300053158 | Ga0500627_0358637 | Ga0500627_0358637_137_370 | 75 |
| 566 | 3300053177 | Ga0500636_0005955 | Ga0500636_0005955_4649_4876 | 75 |
| 567 | 3300053178 | Ga0500637_0017519 | Ga0500637_0017519_265_498 | 75 |
| 568 | 3300053730 | Ga0500645_000417 | Ga0500645_000417_27889_28122 | 75 |
| 569 | 3300053730 | Ga0500645_004197 | Ga0500645_004197_2811_3044 | 75 |
| 570 | 3300053730 | Ga0500645_017913 | Ga0500645_017913_173_406 | 75 |
| 571 | 3300054114 | Ga0501084_0997730 | Ga0501084_0997730_245_478 | 75 |
| 572 | 3300061719 | Ga0466962_0005694 | Ga0466962_0005694_1564_1797 | 75 |
| 573 | 3300061734 | Ga0530510_0697718 | Ga0530510_0697718_231_464 | 75 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.9018 | 2 | 75 |
| 5nfl-assembly1.cif.gz_A | crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. | 0.8905 | 2 | 75 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8465 | 1 | 74 |
| 2mma-assembly1.cif.gz_B | nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana | 0.8266 | 1 | 74 |
| 3tr3-assembly2.cif.gz_A | structure of a bola protein homologue from coxiella burnetii | 0.8252 | 1 | 74 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5nflA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.9018 | 2 | 75 | 3.30.300.90 |
| 5nflA00 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8905 | 2 | 75 | 3.30.300.90 |
| af_P53082_9_118_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.8733 | 1 | 73 | 3.10.20.90 |
| af_Q53S33_27_107_3.30.300.90 | Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like | 0.8726 | 5 | 75 | 3.30.300.90 |
| af_Q67VQ4_70_166_3.10.20.90 | Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 | 0.8615 | 4 | 74 | 3.10.20.90 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G3ISV3-F1-model_v4 | ATP-binding protein | 0.9932 | 1 | 55 |
GO:0005524
|
| AF-A0A5C8PQA4-F1-model_v4 | BolA family transcriptional regulator | 0.9626 | 1 | 75 |
|
| AF-A0A258E1I0-F1-model_v4 | BolA family transcriptional regulator | 0.9557 | 1 | 75 |
|
| AF-A0A5S9P6V0-F1-model_v4 | DNA-binding transcriptional regulator BolA | 0.9546 | 1 | 75 |
|
| AF-A0A512IM53-F1-model_v4 | ATP-binding protein | 0.9531 | 1 | 75 |
GO:0005524
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar