F465192

General Info

Members Datasets Scaffolds Average Seq Length
573 320 563 77

Family's Representative Sequence

Representative Sequence 3300026118|Ga0207675_100279112|Ga0207675_1002791123
Length 84
Sequence VARRKTQPIISPDEVETLIRKGIPDAVVEITDLAGDGDHYAARVIAESFRGQTRLERQRRVYDALGGRMGGELHALQLSTAVPD

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
3 2808606401 Sphingobium sp. AEW010 Isolate Rhizosphere
4 2808606404 Sphingobium sp. AEW013 Isolate Rhizosphere
5 2808606405 Sphingobium sp. AEW001 Isolate Rhizosphere
6 2880518877 Sphingobium sp. JAI105 Isolate Rhizosphere
7 2919709256 Sphingobium xenophagum 4256 Isolate Unclassified
8 2928027323 Sphingomonas sp. 1185 Isolate Unclassified
9 2984555340 Sphingomonas sp. SORGH_AS789 Isolate Aerial Root
10 2984564862 Sphingomonas sp. SORGH_AS870 Isolate Aerial Root
11 2993356040 Sphingomonas sp. SORGH_AS742 Isolate Aerial Root
12 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
13 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
14 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
15 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
19 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
20 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
21 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
22 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
23 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
24 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
25 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
26 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
27 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
28 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
29 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
30 3300004785 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-1 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
31 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
32 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
33 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
36 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
37 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
38 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
39 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
40 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
41 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
42 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
45 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
46 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
47 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
48 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
49 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
50 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
51 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
52 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
53 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
54 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
55 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
56 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
78 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
79 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
80 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
83 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
87 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
99 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
105 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
106 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
120 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
121 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
167 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
168 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
169 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
170 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
173 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
174 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
179 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
180 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
184 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
187 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
188 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
189 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
190 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
191 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
192 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
193 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
194 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
195 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
196 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
197 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
198 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
199 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
200 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
201 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
202 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
203 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
204 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
205 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
206 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
207 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
208 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
209 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
210 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
211 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
212 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
213 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
214 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
215 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
227 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
228 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
229 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
230 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
231 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
232 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
233 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
237 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
238 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
239 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
242 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
245 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
246 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
247 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
250 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
251 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
252 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
253 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
254 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
255 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
256 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
258 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
259 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
263 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
264 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
265 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
277 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
278 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
279 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
280 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
281 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
282 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
283 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
284 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
285 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
286 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
287 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
288 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
295 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
296 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
297 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
298 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
299 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
300 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
301 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
302 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
303 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
306 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
307 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
308 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
309 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
310 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
311 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
312 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
313 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
314 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
315 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
316 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
317 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
318 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
319 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
320 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.81
Metatranscriptomes 2.44
Isolates 1.75

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0
Endosphere 10.99
Nodule 0.7
Rhizoplane 2.79
Rhizosphere 76.96
Stem 0
Stem Tuber 0
Unclassified 8.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1292634 2162886007 Bacteria 2441
2 SwRhRL2b_contig_453878 2162886007 Bacteria 5693
3 JGI24736J21556_1000032 3300001904 Bacteria 24066
4 JGI24741J21665_1012703 3300001915 Bacteria 1441
5 JGI24752J21851_1000082 3300001976 Bacteria 12689
6 JGI24740J21852_10005188 3300001979 Bacteria 5530
7 JGI24740J21852_10042720 3300001979 Bacteria 1357
8 JGI24739J22299_10000162 3300001989 Bacteria 21912
9 JGI24739J22299_10007626 3300001989 Bacteria 4050
10 JGI24739J22299_10025324 3300001989 Bacteria 2087
11 JGI24737J22298_10030621 3300001990 Bacteria 1683
12 JGI24737J22298_10144534 3300001990 Bacteria 702
13 JGI24735J21928_10043770 3300002067 Bacteria 1301
14 JGI24750J21931_1000116 3300002070 Bacteria 12611
15 JGI24748J21848_1000036 3300002074 Bacteria 72512
16 JGI24738J21930_10061342 3300002075 Bacteria 772
17 JGI24034J26672_10000008 3300002239 Bacteria 200986
18 JGI24034J26672_10000038 3300002239 Bacteria 75372
19 JGI24742J22300_10005496 3300002244 Bacteria 2085
20 JGI24751J29686_10006267 3300002459 Bacteria 2424
21 JGI25153J46596_10058825 3300003215 Bacteria 1055
22 rootH1_10052320 3300003316 Bacteria 2199
23 rootL2_10067350 3300003322 Bacteria 1217
24 Ga0055530_10000085 3300003791 Bacteria 80382
25 Ga0055531_10004719 3300003794 Bacteria 8152
26 Ga0058858_1328787 3300004785 Bacteria 504
27 Ga0058861_11824849 3300004800 Bacteria 836
28 Ga0065704_10001612 3300005289 Bacteria 10250
29 Ga0065704_10336440 3300005289 Bacteria 830
30 Ga0065707_10098261 3300005295 Bacteria 3099
31 Ga0070658_10000479 3300005327 Bacteria 34657
32 Ga0070658_10040826 3300005327 Bacteria 3744
33 Ga0070658_10527204 3300005327 Bacteria 1021
34 Ga0070683_101174001 3300005329 Bacteria 737
35 Ga0070690_100000021 3300005330 Bacteria 74350
36 Ga0070670_100426848 3300005331 Bacteria 1172
37 Ga0070670_100470703 3300005331 Bacteria 1115
38 Ga0070670_101291983 3300005331 Bacteria 668
39 Ga0070677_10547462 3300005333 Bacteria 634
40 Ga0068869_100085290 3300005334 Bacteria 2365
41 Ga0070666_10000004 3300005335 Bacteria 372098
42 Ga0070666_10489205 3300005335 Bacteria 891
43 Ga0070666_11000847 3300005335 Bacteria 620
44 Ga0070680_100037964 3300005336 Bacteria 3894
45 Ga0070682_100178661 3300005337 Bacteria 1481
46 Ga0068868_100531566 3300005338 Bacteria 1034
47 Ga0068868_102076391 3300005338 Bacteria 540
48 Ga0070660_100003716 3300005339 Bacteria 10542
49 Ga0070660_100004174 3300005339 Bacteria 9975
50 Ga0070660_100075067 3300005339 Bacteria 2646
51 Ga0070660_100299308 3300005339 Bacteria 1319
52 Ga0070661_100000006 3300005344 Bacteria 216544
53 Ga0070668_100041820 3300005347 Bacteria 3511
54 Ga0070668_100063512 3300005347 Bacteria 2862
55 Ga0070668_100288829 3300005347 Bacteria 1372
56 Ga0070668_100518306 3300005347 Bacteria 1034
57 Ga0070669_100000457 3300005353 Bacteria 31025
58 Ga0070669_100123994 3300005353 Bacteria 1975
59 Ga0070669_100124866 3300005353 Bacteria 1968
60 Ga0070669_100380358 3300005353 Bacteria 1151
61 Ga0070669_100849183 3300005353 Bacteria 778
62 Ga0070675_100660928 3300005354 Bacteria 950
63 Ga0070675_101271671 3300005354 Bacteria 678
64 Ga0070675_101723332 3300005354 Bacteria 578
65 Ga0070671_100017053 3300005355 Bacteria 5875
66 Ga0070671_100060705 3300005355 Bacteria 3148
67 Ga0070674_100041961 3300005356 Bacteria 3105
68 Ga0070659_100035203 3300005366 Bacteria 3899
69 Ga0070667_100000089 3300005367 Bacteria 113661
70 Ga0070667_100010059 3300005367 Bacteria 7835
71 Ga0070663_100129274 3300005455 Bacteria 1916
72 Ga0070663_101778169 3300005455 Bacteria 552
73 Ga0070678_101949883 3300005456 Bacteria 555
74 Ga0070662_100112452 3300005457 Bacteria 2076
75 Ga0070662_100152711 3300005457 Bacteria 1799
76 Ga0070662_100223039 3300005457 Bacteria 1505
77 Ga0070662_100350139 3300005457 Bacteria 1210
78 Ga0070681_10379155 3300005458 Bacteria 1325
79 Ga0070681_10552789 3300005458 Bacteria 1065
80 Ga0070685_10000724 3300005466 Bacteria 17961
81 Ga0070707_102122948 3300005468 Bacteria 529
82 Ga0070698_100589375 3300005471 Bacteria 1052
83 Ga0070679_100000001 3300005530 Bacteria 764811
84 Ga0070679_101893626 3300005530 Bacteria 545
85 Ga0068853_100000825 3300005539 Bacteria 21651
86 Ga0068853_100773978 3300005539 Bacteria 918
87 Ga0068853_101516668 3300005539 Bacteria 649
88 Ga0068853_101579703 3300005539 Bacteria 635
89 Ga0068853_101628703 3300005539 Bacteria 625
90 Ga0070686_100000012 3300005544 Bacteria 176038
91 Ga0070686_101490742 3300005544 Bacteria 570
92 Ga0070696_100537433 3300005546 Bacteria 935
93 Ga0070693_101029673 3300005547 Bacteria 624
94 Ga0070665_100000004 3300005548 Bacteria 785500
95 Ga0070665_100455638 3300005548 Bacteria 1289
96 Ga0070665_101748961 3300005548 Bacteria 629
97 Ga0068855_100000023 3300005563 Bacteria 190440
98 Ga0068855_100233728 3300005563 Bacteria 2057
99 Ga0068855_100395754 3300005563 Bacteria 1515
100 Ga0070664_100964425 3300005564 Bacteria 801
101 Ga0068857_100034254 3300005577 Bacteria 4491
102 Ga0068857_100089221 3300005577 Bacteria 2758
103 Ga0068857_100202528 3300005577 Bacteria 1809
104 Ga0068857_100322020 3300005577 Bacteria 1428
105 Ga0068857_100977674 3300005577 Bacteria 814
106 Ga0068857_100987882 3300005577 Bacteria 810
107 Ga0068854_100013420 3300005578 Bacteria 5377
108 Ga0068854_100075543 3300005578 Bacteria 2474
109 Ga0068854_100095718 3300005578 Bacteria 2217
110 Ga0068854_100178512 3300005578 Bacteria 1657
111 Ga0068854_101280455 3300005578 Bacteria 659
112 Ga0068856_100404112 3300005614 Bacteria 1385
113 Ga0070702_101132897 3300005615 Bacteria 627
114 Ga0068852_100003329 3300005616 Bacteria 11220
115 Ga0068852_100055224 3300005616 Bacteria 3427
116 Ga0068852_100086148 3300005616 Bacteria 2800
117 Ga0068852_100447063 3300005616 Bacteria 1279
118 Ga0068852_100748638 3300005616 Bacteria 989
119 Ga0068852_102813159 3300005616 Bacteria 505
120 Ga0068859_100028374 3300005617 Bacteria 5611
121 Ga0068859_100206389 3300005617 Bacteria 2050
122 Ga0068859_101398327 3300005617 Bacteria 772
123 Ga0068864_100005620 3300005618 Bacteria 10277
124 Ga0068864_100007081 3300005618 Bacteria 9208
125 Ga0068864_101499993 3300005618 Bacteria 677
126 Ga0068861_100020681 3300005719 Bacteria 4718
127 Ga0068861_100285888 3300005719 Bacteria 1422
128 Ga0068851_10062982 3300005834 Bacteria 1904
129 Ga0068851_10064379 3300005834 Bacteria 1884
130 Ga0068863_100000013 3300005841 Bacteria 220357
131 Ga0068863_100002259 3300005841 Bacteria 19135
132 Ga0068863_100238697 3300005841 Bacteria 1754
133 Ga0068858_100053891 3300005842 Bacteria 3719
134 Ga0068858_100337482 3300005842 Bacteria 1442
135 Ga0068860_100000009 3300005843 Bacteria 372089
136 Ga0068860_100000148 3300005843 Bacteria 113661
137 Ga0068860_100257834 3300005843 Bacteria 1699
138 Ga0068860_102150248 3300005843 Bacteria 579
139 Ga0068862_100000209 3300005844 Bacteria 65440
140 Ga0068862_100481286 3300005844 Bacteria 1175
141 Ga0068862_100869340 3300005844 Bacteria 885
142 Ga0081539_10009010 3300005985 Bacteria 8478
143 Ga0075365_10513913 3300006038 Bacteria 847
144 Ga0075368_10000385 3300006042 Bacteria 12968
145 Ga0075363_100005439 3300006048 Bacteria 5665
146 Ga0075363_100332179 3300006048 Bacteria 885
147 Ga0075362_10390886 3300006177 Bacteria 700
148 Ga0075367_10000692 3300006178 Bacteria 12968
149 Ga0075369_10587601 3300006186 Bacteria 533
150 Ga0075370_10010420 3300006353 Bacteria 4861
151 Ga0075370_10063950 3300006353 Bacteria 2098
152 Ga0075370_10126540 3300006353 Bacteria 1489
153 Ga0068871_102205143 3300006358 Bacteria 525
154 Ga0075430_100084382 3300006846 Bacteria 2660
155 Ga0097620_100028372 3300006931 Bacteria 5611
156 Ga0097620_100206405 3300006931 Bacteria 2050
157 Ga0097620_101397994 3300006931 Bacteria 772
158 Ga0079104_1052219 3300006946 Bacteria 906
159 Ga0079104_1054222 3300006946 Bacteria 883
160 Ga0105251_10016214 3300009011 Bacteria 4036
161 Ga0105250_10040167 3300009092 Bacteria 1876
162 Ga0105240_11380751 3300009093 Bacteria 741
163 Ga0105240_11857066 3300009093 Bacteria 627
164 Ga0105240_12340423 3300009093 Bacteria 553
165 Ga0111539_11288518 3300009094 Bacteria 848
166 Ga0105247_10144469 3300009101 Bacteria 1562
167 Ga0105243_10767589 3300009148 Bacteria 947
168 Ga0105241_10631007 3300009174 Bacteria 971
169 Ga0105241_11641341 3300009174 Bacteria 623
170 Ga0105241_12495943 3300009174 Bacteria 517
171 Ga0105248_10059949 3300009177 Bacteria 4274
172 Ga0105248_10501134 3300009177 Bacteria 1369
173 Ga0105248_11064157 3300009177 Bacteria 914
174 Ga0105237_10048537 3300009545 Bacteria 4268
175 Ga0105237_10059304 3300009545 Bacteria 3829
176 Ga0105237_10091535 3300009545 Bacteria 3031
177 Ga0105237_12287021 3300009545 Bacteria 550
178 Ga0105238_10102613 3300009551 Bacteria 2842
179 Ga0105238_10455402 3300009551 Bacteria 1277
180 Ga0105238_10668100 3300009551 Bacteria 1050
181 Ga0105238_10763869 3300009551 Bacteria 981
182 Ga0105249_10000006 3300009553 Bacteria 354449
183 Ga0105249_10291555 3300009553 Bacteria 1633
184 Ga0105249_11366562 3300009553 Bacteria 780
185 Ga0105148_100540 3300009978 Bacteria 3258
186 Ga0105239_10570804 3300010375 Bacteria 1289
187 Ga0105239_10620545 3300010375 Bacteria 1234
188 Ga0105239_12198078 3300010375 Bacteria 642
189 Ga0105246_10477789 3300011119 Bacteria 1054
190 Ga0157373_10087299 3300013100 Bacteria 2198
191 Ga0157373_10152393 3300013100 Bacteria 1626
192 Ga0157373_10342280 3300013100 Bacteria 1066
193 Ga0157373_10615179 3300013100 Bacteria 791
194 Ga0157370_11983841 3300013104 Bacteria 522
195 Ga0157369_10000713 3300013105 Bacteria 42758
196 Ga0157369_10335132 3300013105 Bacteria 1572
197 Ga0157369_10445942 3300013105 Bacteria 1340
198 Ga0157369_10666774 3300013105 Bacteria 1072
199 Ga0157369_11745265 3300013105 Bacteria 632
200 Ga0157378_10501215 3300013297 Bacteria 1213
201 Ga0163162_10008623 3300013306 Bacteria 9934
202 Ga0157372_10032771 3300013307 Bacteria 5701
203 Ga0157372_10059842 3300013307 Bacteria 4262
204 Ga0157372_10354637 3300013307 Bacteria 1709
205 Ga0157372_10901142 3300013307 Bacteria 1026
206 Ga0157372_11525579 3300013307 Bacteria 770
207 Ga0157372_12055020 3300013307 Bacteria 657
208 Ga0157372_12223916 3300013307 Unclassified 630
209 Ga0157375_12028727 3300013308 Bacteria 684
210 Ga0163163_10071955 3300014325 Bacteria 3446
211 Ga0157380_10000182 3300014326 Bacteria 36263
212 Ga0157380_10058444 3300014326 Bacteria 3074
213 Ga0157379_10049804 3300014968 Bacteria 3740
214 Ga0163161_12080327 3300017792 Bacteria 505
215 Ga0206354_11591560 3300020081 Bacteria 1669
216 Ga0213876_10001077 3300021384 Bacteria 17543
217 Ga0213876_10022787 3300021384 Bacteria 3309
218 Ga0209026_1001465 3300025250 Bacteria 10416
219 Ga0209148_1028522 3300025254 Bacteria 849
220 Ga0209758_1000555 3300025297 Bacteria 59166
221 Ga0209050_1000034 3300025298 Bacteria 433906
222 Ga0209257_1000052 3300025304 Bacteria 430947
223 Ga0209257_1000100 3300025304 Bacteria 253399
224 Ga0209257_1014543 3300025304 Bacteria 3372
225 Ga0207656_10246283 3300025321 Bacteria 875
226 Ga0207688_10591391 3300025901 Bacteria 699
227 Ga0207680_10400053 3300025903 Bacteria 970
228 Ga0207680_10806718 3300025903 Bacteria 673
229 Ga0207680_11279796 3300025903 Bacteria 522
230 Ga0207647_10007503 3300025904 Bacteria 7877
231 Ga0207705_10385123 3300025909 Bacteria 1083
232 Ga0207705_10925174 3300025909 Bacteria 675
233 Ga0207654_10187655 3300025911 Bacteria 1353
234 Ga0207695_11450916 3300025913 Bacteria 566
235 Ga0207671_10229002 3300025914 Bacteria 1458
236 Ga0207660_10211066 3300025917 Bacteria 1520
237 Ga0207660_10365805 3300025917 Bacteria 1157
238 Ga0207662_10472288 3300025918 Bacteria 860
239 Ga0207657_10052419 3300025919 Bacteria 3540
240 Ga0207649_10000043 3300025920 Bacteria 115777
241 Ga0207681_10361412 3300025923 Bacteria 1164
242 Ga0207681_10595161 3300025923 Bacteria 913
243 Ga0207681_11816477 3300025923 Bacteria 508
244 Ga0207681_11871021 3300025923 Bacteria 500
245 Ga0207694_10035042 3300025924 Bacteria 3849
246 Ga0207694_10322619 3300025924 Bacteria 1275
247 Ga0207694_10359393 3300025924 Bacteria 1206
248 Ga0207694_10585392 3300025924 Bacteria 938
249 Ga0207650_10176847 3300025925 Bacteria 1699
250 Ga0207650_10874867 3300025925 Bacteria 763
251 Ga0207659_11720034 3300025926 Bacteria 534
252 Ga0207644_10022986 3300025931 Bacteria 4265
253 Ga0207644_11532315 3300025931 Bacteria 559
254 Ga0207690_10052761 3300025932 Bacteria 2725
255 Ga0207690_10355127 3300025932 Bacteria 1160
256 Ga0207706_10015340 3300025933 Bacteria 6923
257 Ga0207706_10026490 3300025933 Bacteria 5189
258 Ga0207706_10211000 3300025933 Bacteria 1702
259 Ga0207709_10413443 3300025935 Bacteria 1034
260 Ga0207709_10779588 3300025935 Bacteria 770
261 Ga0207669_10156416 3300025937 Bacteria 1604
262 Ga0207711_10033334 3300025941 Bacteria 4357
263 Ga0207711_10663848 3300025941 Bacteria 973
264 Ga0207689_10391024 3300025942 Bacteria 1159
265 Ga0207689_10587898 3300025942 Bacteria 936
266 Ga0207661_11905538 3300025944 Bacteria 540
267 Ga0207667_11327157 3300025949 Bacteria 695
268 Ga0207668_10012421 3300025972 Bacteria 5214
269 Ga0207668_10034185 3300025972 Bacteria 3374
270 Ga0207668_11605880 3300025972 Bacteria 587
271 Ga0207640_10020993 3300025981 Bacteria 3884
272 Ga0207640_10080263 3300025981 Bacteria 2226
273 Ga0207640_10380129 3300025981 Bacteria 1144
274 Ga0207640_10726370 3300025981 Bacteria 854
275 Ga0207658_10000069 3300025986 Bacteria 113687
276 Ga0207677_10733962 3300026023 Bacteria 879
277 Ga0207639_10000771 3300026041 Bacteria 21846
278 Ga0207639_10160773 3300026041 Bacteria 1892
279 Ga0207639_10187001 3300026041 Bacteria 1766
280 Ga0207639_10730579 3300026041 Bacteria 920
281 Ga0207639_11486247 3300026041 Bacteria 636
282 Ga0207678_10889898 3300026067 Bacteria 787
283 Ga0207702_10291064 3300026078 Bacteria 1547
284 Ga0207702_10800264 3300026078 Bacteria 932
285 Ga0207641_10003319 3300026088 Bacteria 14317
286 Ga0207641_10004490 3300026088 Bacteria 12070
287 Ga0207676_10041840 3300026095 Bacteria 3520
288 Ga0207674_10008322 3300026116 Bacteria 12002
289 Ga0207674_10016903 3300026116 Bacteria 7971
290 Ga0207674_10088087 3300026116 Bacteria 3098
291 Ga0207674_10239259 3300026116 Bacteria 1762
292 Ga0207674_10895518 3300026116 Bacteria 855
293 Ga0207674_10959275 3300026116 Bacteria 824
294 Ga0207675_100001918 3300026118 Bacteria 20742
295 Ga0207675_100231134 3300026118 Bacteria 1784
296 Ga0207675_100279112 3300026118 Bacteria 1623
297 Ga0207683_10820574 3300026121 Bacteria 863
298 Ga0207683_11590295 3300026121 Bacteria 603
299 Ga0207698_10000130 3300026142 Bacteria 47043
300 Ga0207698_10102005 3300026142 Bacteria 2381
301 Ga0207698_10109159 3300026142 Bacteria 2314
302 Ga0207698_10407978 3300026142 Bacteria 1300
303 Ga0207698_10602564 3300026142 Bacteria 1083
304 Ga0207698_10675077 3300026142 Bacteria 1026
305 Ga0207698_11276964 3300026142 Bacteria 749
306 Ga0209281_1021396 3300027111 Bacteria 1251
307 Ga0209281_1042409 3300027111 Bacteria 759
308 Ga0268265_10648415 3300028380 Bacteria 1015
309 Ga0268264_10000217 3300028381 Bacteria 113674
310 Ga0268264_10157361 3300028381 Bacteria 2043
311 Ga0268264_11740826 3300028381 Bacteria 634
312 Ga0307517_10039268 3300028786 Bacteria 5205
313 Ga0307511_10082979 3300030521 Bacteria 2236
314 Ga0307408_100388134 3300031548 Bacteria 1195
315 Ga0307408_100545382 3300031548 Bacteria 1022
316 Ga0307408_101275253 3300031548 Bacteria 688
317 Ga0307408_101927041 3300031548 Bacteria 567
318 Ga0307405_10015706 3300031731 Bacteria 4108
319 Ga0307405_10233043 3300031731 Bacteria 1358
320 Ga0307405_10422638 3300031731 Bacteria 1049
321 Ga0307405_10442013 3300031731 Bacteria 1029
322 Ga0307405_10830145 3300031731 Bacteria 776
323 Ga0307413_10375086 3300031824 Bacteria 1106
324 Ga0307413_11004602 3300031824 Bacteria 715
325 Ga0307413_11966890 3300031824 Bacteria 526
326 Ga0307410_10572941 3300031852 Bacteria 938
327 Ga0307406_10071868 3300031901 Bacteria 2269
328 Ga0307406_10151212 3300031901 Bacteria 1656
329 Ga0307406_10312328 3300031901 Bacteria 1212
330 Ga0307406_10350397 3300031901 Bacteria 1153
331 Ga0307407_10227621 3300031903 Bacteria 1264
332 Ga0307412_10075035 3300031911 Bacteria 2318
333 Ga0307412_10135773 3300031911 Bacteria 1794
334 Ga0307412_10379010 3300031911 Bacteria 1145
335 Ga0307412_11378238 3300031911 Bacteria 637
336 Ga0307412_11460401 3300031911 Bacteria 620
337 Ga0307409_100244787 3300031995 Bacteria 1635
338 Ga0307409_100365136 3300031995 Bacteria 1367
339 Ga0307409_100485830 3300031995 Bacteria 1199
340 Ga0307416_100491586 3300032002 Bacteria 1289
341 Ga0307416_102537652 3300032002 Bacteria 611
342 Ga0307414_10001522 3300032004 Bacteria 12055
343 Ga0307414_10085486 3300032004 Bacteria 2324
344 Ga0307414_10202434 3300032004 Bacteria 1616
345 Ga0307411_10459087 3300032005 Bacteria 1067
346 Ga0307411_11195573 3300032005 Bacteria 689
347 Ga0307411_12179013 3300032005 Bacteria 519
348 Ga0307415_100060290 3300032126 Bacteria 2621
349 Ga0307415_100197799 3300032126 Bacteria 1592
350 Ga0307415_100740511 3300032126 Bacteria 891
351 Ga0307510_10308054 3300033180 Bacteria 1044
352 Ga0373937_0267550 3300036401 Bacteria 1613
353 Ga0395905_0356568 3300037471 Bacteria 1355
354 Ga0395905_0364976 3300037471 Bacteria 1337
355 Ga0395905_0487066 3300037471 Bacteria 1133
356 Ga0395905_1046289 3300037471 Bacteria 719
357 Ga0436365_0378480 3300039437 Bacteria 4964
358 Ga0436365_0600332 3300039437 Bacteria 1176
359 Ga0436365_0770163 3300039437 Bacteria 534
360 Ga0436365_1117045 3300039437 Bacteria 20483
361 Ga0436363_1615302 3300039450 Bacteria 931
362 Ga0436362_0438371 3300039453 Bacteria 969
363 Ga0439436_0045695 3300041404 Bacteria 1245
364 Ga0439461_0046235 3300041410 Bacteria 954
365 Ga0451789_0051834 3300041443 Bacteria 702
366 Ga0451791_1915041 3300041451 Bacteria 976
367 Ga0451793_0662985 3300041452 Bacteria 1593
368 Ga0451800_0020009 3300041459 Bacteria 1613
369 Ga0451802_0252467 3300041460 Bacteria 607
370 Ga0451802_0704079 3300041460 Bacteria 918
371 Ga0451806_402659 3300041462 Bacteria 6155
372 Ga0451804_0351077 3300041463 Bacteria 1017
373 Ga0451807_0382179 3300041486 Bacteria 6263
374 Ga0451807_1450983 3300041486 Bacteria 631
375 Ga0451839_1164718 3300041496 Bacteria 639
376 Ga0451845_0234870 3300041501 Bacteria 503
377 Ga0451849_0396199 3300041505 Bacteria 733
378 Ga0451843_0433053 3300041509 Bacteria 572
379 Ga0451843_1746187 3300041509 Bacteria 535
380 Ga0451853_0669204 3300041512 Bacteria 556
381 Ga0439431_0000140 3300041997 Bacteria 13006
382 Ga0439442_013335 3300042002 Bacteria 1685
383 Ga0439448_0001939 3300042005 Bacteria 5514
384 Ga0439448_0009693 3300042005 Bacteria 2843
385 Ga0439449_0289840 3300042007 Bacteria 617
386 Ga0439450_045931 3300042008 Bacteria 1026
387 Ga0439455_0001428 3300042012 Bacteria 3992
388 Ga0439455_0003870 3300042012 Bacteria 2911
389 Ga0439455_0014742 3300042012 Bacteria 1788
390 Ga0439434_0006562 3300042435 Bacteria 3398
391 Ga0439464_0131240 3300042439 Bacteria 776
392 Ga0466972_0000826 3300044658 Bacteria 14820
393 Ga0466966_0217347 3300044684 Bacteria 1154
394 Ga0466961_0036040 3300044693 Bacteria 3176
395 Ga0466961_0070130 3300044693 Bacteria 2224
396 Ga0466961_0307740 3300044693 Bacteria 967
397 Ga0466963_0005815 3300044694 Bacteria 7256
398 Ga0466964_0000258 3300044706 Bacteria 15333
399 Ga0466964_0142197 3300044706 Bacteria 1104
400 Ga0466971_0005805 3300044719 Bacteria 5372
401 Ga0466968_0038917 3300044735 Bacteria 1999
402 Ga0466968_0236455 3300044735 Bacteria 864
403 Ga0466970_0638277 3300044765 Bacteria 619
404 Ga0466957_0042426 3300044842 Bacteria 2752
405 Ga0466960_0004100 3300044901 Bacteria 5665
406 Ga0466959_0561217 3300045049 Bacteria 769
407 Ga0466958_0017628 3300045836 Bacteria 4132
408 Ga0466967_0053000 3300045976 Bacteria 3564
409 Ga0466967_2154385 3300045976 Bacteria 554
410 Ga0495638_0006069 3300046460 Bacteria 8842
411 Ga0495638_0019313 3300046460 Bacteria 4509
412 Ga0495638_0102689 3300046460 Bacteria 1708
413 Ga0495650_0027516 3300046471 Bacteria 2625
414 Ga0495583_0000218 3300046506 Bacteria 96349
415 Ga0495632_0317276 3300046519 Bacteria 689
416 Ga0495663_0003548 3300046525 Bacteria 4489
417 Ga0495654_0001073 3300046530 Bacteria 19918
418 Ga0495598_0004672 3300046537 Bacteria 2982
419 Ga0495621_0003301 3300046539 Bacteria 4442
420 Ga0495621_0179383 3300046539 Bacteria 845
421 Ga0495597_0090244 3300046542 Bacteria 1302
422 Ga0495622_0478758 3300046557 Bacteria 533
423 Ga0495668_0006416 3300046616 Bacteria 7706
424 Ga0495668_0011998 3300046616 Bacteria 5159
425 Ga0495668_0091593 3300046616 Bacteria 1666
426 Ga0495668_0133256 3300046616 Bacteria 1360
427 Ga0495668_0181938 3300046616 Bacteria 1151
428 Ga0495668_0307692 3300046616 Bacteria 869
429 Ga0495625_0045065 3300046660 Bacteria 3190
430 Ga0495625_0287690 3300046660 Bacteria 1055
431 Ga0495670_0010027 3300046691 Bacteria 4659
432 Ga0495589_0067756 3300046794 Bacteria 1747
433 Ga0495660_0102720 3300046810 Bacteria 1469
434 Ga0495673_0011196 3300047469 Bacteria 4841
435 Ga0495686_0001246 3300047472 Bacteria 29040
436 Ga0495686_0048131 3300047472 Bacteria 2689
437 Ga0495686_0684368 3300047472 Bacteria 524
438 Ga0495626_0421678 3300048091 Bacteria 514
439 Ga0496102_0087675 3300048905 Bacteria 2876
440 Ga0496102_1416872 3300048905 Bacteria 614
441 Ga0496104_1390858 3300048907 Bacteria 605
442 Ga0496108_0000682 3300048911 Bacteria 26248
443 Ga0496110_0419373 3300048913 Bacteria 1220
444 Ga0496113_0519615 3300048916 Bacteria 956
445 Ga0496116_0021417 3300048919 Bacteria 4878
446 Ga0496117_0354351 3300048920 Bacteria 756
447 Ga0496118_0109131 3300048921 Bacteria 1843
448 Ga0496121_0000296 3300048924 Bacteria 103215
449 Ga0496121_0003051 3300048924 Bacteria 24286
450 Ga0496122_0039577 3300048925 Bacteria 3758
451 Ga0496122_0192299 3300048925 Bacteria 1203
452 Ga0496122_0313438 3300048925 Bacteria 838
453 Ga0496123_0116075 3300048926 Bacteria 1517
454 Ga0496123_0156766 3300048926 Bacteria 1219
455 Ga0496124_0005852 3300048927 Bacteria 13640
456 Ga0496124_0033927 3300048927 Bacteria 4485
457 Ga0496124_0048088 3300048927 Bacteria 3647
458 Ga0496124_0265665 3300048927 Bacteria 1260
459 Ga0496124_0290403 3300048927 Bacteria 1187
460 Ga0496124_0363072 3300048927 Bacteria 1019
461 Ga0496124_0750333 3300048927 Bacteria 611
462 Ga0496125_0049187 3300048928 Bacteria 3506
463 Ga0496125_0072386 3300048928 Bacteria 2685
464 Ga0496125_0091131 3300048928 Bacteria 2285
465 Ga0496125_0286884 3300048928 Bacteria 1016
466 Ga0496125_0308228 3300048928 Bacteria 966
467 Ga0496125_0394973 3300048928 Bacteria 810
468 Ga0496126_0004477 3300048929 Bacteria 16680
469 Ga0501306_009105 3300049127 Bacteria 1225
470 Ga0501305_021695 3300049161 Bacteria 951
471 Ga0501307_005380 3300049162 Bacteria 1348
472 Ga0495678_137000 3300049459 Bacteria 805
473 Ga0495682_0053138 3300049460 Bacteria 1471
474 Ga0501311_027272 3300049527 Bacteria 810
475 Ga0501312_025302 3300049528 Bacteria 904
476 Ga0501313_020213 3300049529 Bacteria 819
477 Ga0501314_017825 3300049530 Bacteria 718
478 Ga0501315_046231 3300049531 Bacteria 672
479 Ga0501320_006506 3300049536 Bacteria 1097
480 Ga0501321_056218 3300049537 Bacteria 585
481 Ga0501336_018821 3300049552 Bacteria 615
482 Ga0501033_0205815 3300049570 Bacteria 1404
483 Ga0501033_0214787 3300049570 Bacteria 1371
484 Ga0501034_1557758 3300049571 Bacteria 534
485 Ga0501036_1078947 3300049572 Bacteria 656
486 Ga0501038_0059946 3300049574 Bacteria 3258
487 Ga0501038_0905183 3300049574 Bacteria 651
488 Ga0501039_0229604 3300049575 Bacteria 1459
489 Ga0501042_0229792 3300049578 Bacteria 1338
490 Ga0501043_0049166 3300049579 Bacteria 3315
491 Ga0501046_0476873 3300049580 Bacteria 895
492 Ga0501047_0104148 3300049581 Bacteria 2718
493 Ga0501047_0130480 3300049581 Bacteria 2394
494 Ga0501047_0673401 3300049581 Bacteria 853
495 Ga0501047_0885518 3300049581 Bacteria 706
496 Ga0501073_0480905 3300049589 Bacteria 859
497 Ga0501074_0436178 3300049590 Bacteria 929
498 Ga0501076_0137133 3300049592 Bacteria 1987
499 Ga0501198_007724 3300049649 Bacteria 1551
500 Ga0501202_214062 3300049652 Bacteria 531
501 Ga0501223_000039 3300049663 Bacteria 45537
502 Ga0501246_001398 3300049676 Bacteria 1843
503 Ga0501249_000213 3300049679 Bacteria 17777
504 Ga0501257_000049 3300049686 Bacteria 33138
505 Ga0501225_0000010 3300049705 Bacteria 82395
506 Ga0501241_014967 3300049758 Bacteria 1410
507 Ga0501241_024823 3300049758 Bacteria 1114
508 Ga0501267_002297 3300049764 Bacteria 1703
509 Ga0501269_003897 3300049766 Bacteria 1795
510 Ga0501035_0350527 3300049822 Bacteria 1235
511 Ga0501035_0526827 3300049822 Bacteria 970
512 Ga0501035_1366166 3300049822 Bacteria 544
513 Ga0501044_0074300 3300049823 Bacteria 3454
514 Ga0501045_0146480 3300049824 Bacteria 1757
515 Ga0501204_000430 3300049850 Bacteria 3639
516 nmdc:mga03683_252847_c1 3300050489 Bacteria 819
517 nmdc:mga0k408_150993_c1 3300050493 Bacteria 1383
518 nmdc:mga0k408_9833_c1 3300050493 Bacteria 5164
519 nmdc:mga07m45_144097_c1 3300050496 Bacteria 1380
520 nmdc:mga07m45_65525_c1 3300050496 Bacteria 2063
521 nmdc:mga0qj67_77287_c1 3300050509 Bacteria 2663
522 Ga0500643_000135 3300053087 Bacteria 74911
523 Ga0500643_000195 3300053087 Bacteria 57960
524 Ga0500643_000783 3300053087 Bacteria 20603
525 Ga0500643_003224 3300053087 Bacteria 7943
526 Ga0500643_018446 3300053087 Bacteria 2314
527 Ga0500643_020706 3300053087 Bacteria 2143
528 Ga0500643_025387 3300053087 Bacteria 1869
529 Ga0500643_097989 3300053087 Bacteria 796
530 Ga0500643_193444 3300053087 Bacteria 545
531 Ga0500555_000575 3300053103 Bacteria 14512
532 Ga0500555_142520 3300053103 Bacteria 590
533 Ga0500556_0000222 3300053104 Bacteria 45971
534 Ga0500557_124997 3300053105 Bacteria 853
535 Ga0500562_012822 3300053108 Bacteria 2134
536 Ga0500562_049382 3300053108 Bacteria 1124
537 Ga0500572_271158 3300053111 Bacteria 550
538 Ga0500592_002248 3300053116 Bacteria 3112
539 Ga0500595_012152 3300053119 Bacteria 3338
540 Ga0500607_000844 3300053121 Bacteria 29501
541 Ga0500608_007769 3300053122 Bacteria 4458
542 Ga0500642_0000011 3300053130 Bacteria 215963
543 Ga0500642_0121939 3300053130 Bacteria 1220
544 Ga0500559_0003805 3300053136 Bacteria 7307
545 Ga0500559_0008073 3300053136 Bacteria 4632
546 Ga0500559_0166247 3300053136 Bacteria 1037
547 Ga0500559_0304718 3300053136 Bacteria 748
548 Ga0500568_0260875 3300053139 Bacteria 630
549 Ga0500573_0000114 3300053140 Bacteria 32888
550 Ga0500590_065735 3300053148 Bacteria 1812
551 Ga0500604_0039631 3300053151 Bacteria 1417
552 Ga0500624_000106 3300053157 Bacteria 40037
553 Ga0500627_0000570 3300053158 Bacteria 9930
554 Ga0500627_0279338 3300053158 Bacteria 733
555 Ga0500627_0358637 3300053158 Bacteria 628
556 Ga0500636_0005955 3300053177 Bacteria 6988
557 Ga0500637_0017519 3300053178 Bacteria 3836
558 Ga0500645_000417 3300053730 Bacteria 29425
559 Ga0500645_004197 3300053730 Bacteria 5605
560 Ga0500645_017913 3300053730 Bacteria 2217
561 Ga0501084_0997730 3300054114 Bacteria 704
562 Ga0466962_0005694 3300061719 Bacteria 5986
563 Ga0530510_0697718 3300061734 Bacteria 773

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046810 Ga0495660_0102720 Ga0495660_0102720_153_359 66
2 iso_pu_bacteria 2775507255 2778125107 73
3 iso_pu_bacteria 2808606401 2809063038 73
4 iso_pu_bacteria 2808606404 2809079002 73
5 iso_pu_bacteria 2808606405 2809083623 73
6 iso_pu_bacteria 2880518877 2880520293 73
7 iso_pu_bacteria 2919709256 2919713322 73
8 iso_pu_bacteria 2928027323 2928030297 73
9 iso_pu_bacteria 2984555340 2984558874 73
10 iso_pu_bacteria 2984564862 2984566612 73
11 iso_pu_bacteria 2993356040 2993357808 73
12 3300013100 Ga0157373_10342280 Ga0157373_103422803 74
13 3300025254 Ga0209148_1028522 Ga0209148_10285222 74
14 3300025904 Ga0207647_10007503 Ga0207647_100075039 74
15 3300025917 Ga0207660_10211066 Ga0207660_102110662 74
16 3300025925 Ga0207650_10874867 Ga0207650_108748672 74
17 3300025932 Ga0207690_10355127 Ga0207690_103551271 74
18 3300025933 Ga0207706_10026490 Ga0207706_100264905 74
19 3300025935 Ga0207709_10779588 Ga0207709_107795882 74
20 3300026078 Ga0207702_10800264 Ga0207702_108002642 74
21 3300028786 Ga0307517_10039268 Ga0307517_100392684 74
22 3300041452 Ga0451793_0662985 Ga0451793_0662985_707_937 74
23 3300041459 Ga0451800_0020009 Ga0451800_0020009_598_828 74
24 3300041460 Ga0451802_0704079 Ga0451802_0704079_117_347 74
25 3300041462 Ga0451806_402659 Ga0451806_402659_3639_3869 74
26 3300041463 Ga0451804_0351077 Ga0451804_0351077_223_453 74
27 3300041486 Ga0451807_0382179 Ga0451807_0382179_1743_1973 74
28 3300041501 Ga0451845_0234870 Ga0451845_0234870_50_280 74
29 3300041505 Ga0451849_0396199 Ga0451849_0396199_305_535 74
30 3300042005 Ga0439448_0009693 Ga0439448_0009693_214_444 74
31 3300042008 Ga0439450_045931 Ga0439450_045931_377_607 74
32 3300042439 Ga0439464_0131240 Ga0439464_0131240_90_320 74
33 3300048927 Ga0496124_0290403 Ga0496124_0290403_354_584 74
34 3300049824 Ga0501045_0146480 Ga0501045_0146480_916_1146 74
35 3300050489 nmdc:mga03683_252847_c1 nmdc:mga03683_252847_c1_474_704 74
36 3300053108 Ga0500562_012822 Ga0500562_012822_1877_2107 74
37 2162886007 SwRhRL2b_contig_1292634 SwRhRL2b_0809.00003660 75
38 2162886007 SwRhRL2b_contig_453878 SwRhRL2b_0731.00007040 75
39 3300001904 JGI24736J21556_1000032 JGI24736J21556_100003225 75
40 3300001915 JGI24741J21665_1012703 JGI24741J21665_10127033 75
41 3300001976 JGI24752J21851_1000082 JGI24752J21851_10000826 75
42 3300001979 JGI24740J21852_10005188 JGI24740J21852_100051886 75
43 3300001979 JGI24740J21852_10042720 JGI24740J21852_100427202 75
44 3300001989 JGI24739J22299_10000162 JGI24739J22299_1000016219 75
45 3300001989 JGI24739J22299_10007626 JGI24739J22299_100076265 75
46 3300001989 JGI24739J22299_10025324 JGI24739J22299_100253243 75
47 3300001990 JGI24737J22298_10030621 JGI24737J22298_100306214 75
48 3300001990 JGI24737J22298_10144534 JGI24737J22298_101445342 75
49 3300002067 JGI24735J21928_10043770 JGI24735J21928_100437703 75
50 3300002070 JGI24750J21931_1000116 JGI24750J21931_10001163 75
51 3300002074 JGI24748J21848_1000036 JGI24748J21848_100003662 75
52 3300002075 JGI24738J21930_10061342 JGI24738J21930_100613422 75
53 3300002239 JGI24034J26672_10000008 JGI24034J26672_1000000835 75
54 3300002239 JGI24034J26672_10000038 JGI24034J26672_1000003864 75
55 3300002244 JGI24742J22300_10005496 JGI24742J22300_100054962 75
56 3300002459 JGI24751J29686_10006267 JGI24751J29686_100062673 75
57 3300003215 JGI25153J46596_10058825 JGI25153J46596_100588252 75
58 3300003316 rootH1_10052320 rootH1_100523202 75
59 3300003322 rootL2_10067350 rootL2_100673501 75
60 3300003791 Ga0055530_10000085 Ga0055530_100000851 75
61 3300003794 Ga0055531_10004719 Ga0055531_100047196 75
62 3300004785 Ga0058858_1328787 Ga0058858_13287871 75
63 3300004800 Ga0058861_11824849 Ga0058861_118248492 75
64 3300005289 Ga0065704_10001612 Ga0065704_100016129 75
65 3300005289 Ga0065704_10336440 Ga0065704_103364402 75
66 3300005295 Ga0065707_10098261 Ga0065707_100982614 75
67 3300005327 Ga0070658_10000479 Ga0070658_1000047917 75
68 3300005327 Ga0070658_10040826 Ga0070658_100408264 75
69 3300005327 Ga0070658_10527204 Ga0070658_105272041 75
70 3300005329 Ga0070683_101174001 Ga0070683_1011740012 75
71 3300005330 Ga0070690_100000021 Ga0070690_10000002131 75
72 3300005331 Ga0070670_100426848 Ga0070670_1004268483 75
73 3300005331 Ga0070670_100470703 Ga0070670_1004707032 75
74 3300005331 Ga0070670_101291983 Ga0070670_1012919832 75
75 3300005333 Ga0070677_10547462 Ga0070677_105474621 75
76 3300005334 Ga0068869_100085290 Ga0068869_1000852902 75
77 3300005335 Ga0070666_10000004 Ga0070666_10000004252 75
78 3300005335 Ga0070666_10489205 Ga0070666_104892052 75
79 3300005335 Ga0070666_11000847 Ga0070666_110008472 75
80 3300005336 Ga0070680_100037964 Ga0070680_1000379645 75
81 3300005337 Ga0070682_100178661 Ga0070682_1001786612 75
82 3300005338 Ga0068868_100531566 Ga0068868_1005315663 75
83 3300005338 Ga0068868_102076391 Ga0068868_1020763911 75
84 3300005339 Ga0070660_100003716 Ga0070660_10000371612 75
85 3300005339 Ga0070660_100004174 Ga0070660_1000041742 75
86 3300005339 Ga0070660_100075067 Ga0070660_1000750672 75
87 3300005339 Ga0070660_100299308 Ga0070660_1002993083 75
88 3300005344 Ga0070661_100000006 Ga0070661_100000006145 75
89 3300005347 Ga0070668_100041820 Ga0070668_1000418202 75
90 3300005347 Ga0070668_100063512 Ga0070668_1000635125 75
91 3300005347 Ga0070668_100288829 Ga0070668_1002888293 75
92 3300005347 Ga0070668_100518306 Ga0070668_1005183062 75
93 3300005353 Ga0070669_100000457 Ga0070669_10000045735 75
94 3300005353 Ga0070669_100123994 Ga0070669_1001239942 75
95 3300005353 Ga0070669_100124866 Ga0070669_1001248662 75
96 3300005353 Ga0070669_100380358 Ga0070669_1003803582 75
97 3300005353 Ga0070669_100849183 Ga0070669_1008491832 75
98 3300005354 Ga0070675_100660928 Ga0070675_1006609282 75
99 3300005354 Ga0070675_101271671 Ga0070675_1012716711 75
100 3300005354 Ga0070675_101723332 Ga0070675_1017233322 75
101 3300005355 Ga0070671_100017053 Ga0070671_1000170533 75
102 3300005355 Ga0070671_100060705 Ga0070671_1000607053 75
103 3300005356 Ga0070674_100041961 Ga0070674_1000419613 75
104 3300005366 Ga0070659_100035203 Ga0070659_1000352033 75
105 3300005367 Ga0070667_100000089 Ga0070667_10000008913 75
106 3300005367 Ga0070667_100010059 Ga0070667_1000100597 75
107 3300005455 Ga0070663_100129274 Ga0070663_1001292743 75
108 3300005455 Ga0070663_101778169 Ga0070663_1017781692 75
109 3300005456 Ga0070678_101949883 Ga0070678_1019498832 75
110 3300005457 Ga0070662_100112452 Ga0070662_1001124522 75
111 3300005457 Ga0070662_100152711 Ga0070662_1001527114 75
112 3300005457 Ga0070662_100223039 Ga0070662_1002230393 75
113 3300005457 Ga0070662_100350139 Ga0070662_1003501393 75
114 3300005458 Ga0070681_10379155 Ga0070681_103791552 75
115 3300005458 Ga0070681_10552789 Ga0070681_105527893 75
116 3300005466 Ga0070685_10000724 Ga0070685_100007245 75
117 3300005468 Ga0070707_102122948 Ga0070707_1021229481 75
118 3300005471 Ga0070698_100589375 Ga0070698_1005893752 75
119 3300005530 Ga0070679_100000001 Ga0070679_10000000132 75
120 3300005530 Ga0070679_101893626 Ga0070679_1018936261 75
121 3300005539 Ga0068853_100000825 Ga0068853_10000082515 75
122 3300005539 Ga0068853_100773978 Ga0068853_1007739783 75
123 3300005539 Ga0068853_101516668 Ga0068853_1015166682 75
124 3300005539 Ga0068853_101579703 Ga0068853_1015797032 75
125 3300005539 Ga0068853_101628703 Ga0068853_1016287032 75
126 3300005544 Ga0070686_100000012 Ga0070686_100000012150 75
127 3300005544 Ga0070686_101490742 Ga0070686_1014907421 75
128 3300005546 Ga0070696_100537433 Ga0070696_1005374333 75
129 3300005547 Ga0070693_101029673 Ga0070693_1010296732 75
130 3300005548 Ga0070665_100000004 Ga0070665_100000004629 75
131 3300005548 Ga0070665_100455638 Ga0070665_1004556382 75
132 3300005548 Ga0070665_101748961 Ga0070665_1017489612 75
133 3300005563 Ga0068855_100000023 Ga0068855_10000002314 75
134 3300005563 Ga0068855_100233728 Ga0068855_1002337281 75
135 3300005563 Ga0068855_100395754 Ga0068855_1003957543 75
136 3300005564 Ga0070664_100964425 Ga0070664_1009644252 75
137 3300005577 Ga0068857_100034254 Ga0068857_1000342543 75
138 3300005577 Ga0068857_100089221 Ga0068857_1000892214 75
139 3300005577 Ga0068857_100202528 Ga0068857_1002025284 75
140 3300005577 Ga0068857_100322020 Ga0068857_1003220204 75
141 3300005577 Ga0068857_100977674 Ga0068857_1009776742 75
142 3300005577 Ga0068857_100987882 Ga0068857_1009878822 75
143 3300005578 Ga0068854_100013420 Ga0068854_1000134202 75
144 3300005578 Ga0068854_100075543 Ga0068854_1000755433 75
145 3300005578 Ga0068854_100095718 Ga0068854_1000957182 75
146 3300005578 Ga0068854_100178512 Ga0068854_1001785123 75
147 3300005578 Ga0068854_101280455 Ga0068854_1012804552 75
148 3300005614 Ga0068856_100404112 Ga0068856_1004041122 75
149 3300005615 Ga0070702_101132897 Ga0070702_1011328972 75
150 3300005616 Ga0068852_100003329 Ga0068852_1000033298 75
151 3300005616 Ga0068852_100055224 Ga0068852_1000552244 75
152 3300005616 Ga0068852_100086148 Ga0068852_1000861483 75
153 3300005616 Ga0068852_100447063 Ga0068852_1004470633 75
154 3300005616 Ga0068852_100748638 Ga0068852_1007486383 75
155 3300005616 Ga0068852_102813159 Ga0068852_1028131591 75
156 3300005617 Ga0068859_100028374 Ga0068859_1000283745 75
157 3300005617 Ga0068859_100206389 Ga0068859_1002063893 75
158 3300005617 Ga0068859_101398327 Ga0068859_1013983272 75
159 3300005618 Ga0068864_100005620 Ga0068864_1000056205 75
160 3300005618 Ga0068864_100007081 Ga0068864_1000070814 75
161 3300005618 Ga0068864_101499993 Ga0068864_1014999931 75
162 3300005719 Ga0068861_100020681 Ga0068861_1000206812 75
163 3300005719 Ga0068861_100285888 Ga0068861_1002858883 75
164 3300005834 Ga0068851_10062982 Ga0068851_100629825 75
165 3300005834 Ga0068851_10064379 Ga0068851_100643793 75
166 3300005841 Ga0068863_100000013 Ga0068863_100000013175 75
167 3300005841 Ga0068863_100002259 Ga0068863_10000225916 75
168 3300005841 Ga0068863_100238697 Ga0068863_1002386972 75
169 3300005842 Ga0068858_100053891 Ga0068858_1000538913 75
170 3300005842 Ga0068858_100337482 Ga0068858_1003374822 75
171 3300005843 Ga0068860_100000009 Ga0068860_100000009251 75
172 3300005843 Ga0068860_100000148 Ga0068860_100000148118 75
173 3300005843 Ga0068860_100257834 Ga0068860_1002578344 75
174 3300005843 Ga0068860_102150248 Ga0068860_1021502482 75
175 3300005844 Ga0068862_100000209 Ga0068862_10000020929 75
176 3300005844 Ga0068862_100481286 Ga0068862_1004812862 75
177 3300005844 Ga0068862_100869340 Ga0068862_1008693402 75
178 3300005985 Ga0081539_10009010 Ga0081539_100090109 75
179 3300006038 Ga0075365_10513913 Ga0075365_105139132 75
180 3300006042 Ga0075368_10000385 Ga0075368_100003859 75
181 3300006048 Ga0075363_100005439 Ga0075363_1000054396 75
182 3300006048 Ga0075363_100332179 Ga0075363_1003321792 75
183 3300006177 Ga0075362_10390886 Ga0075362_103908861 75
184 3300006178 Ga0075367_10000692 Ga0075367_100006929 75
185 3300006186 Ga0075369_10587601 Ga0075369_105876012 75
186 3300006353 Ga0075370_10010420 Ga0075370_100104208 75
187 3300006353 Ga0075370_10063950 Ga0075370_100639505 75
188 3300006353 Ga0075370_10126540 Ga0075370_101265403 75
189 3300006358 Ga0068871_102205143 Ga0068871_1022051432 75
190 3300006846 Ga0075430_100084382 Ga0075430_1000843824 75
191 3300006931 Ga0097620_100028372 Ga0097620_1000283725 75
192 3300006931 Ga0097620_100206405 Ga0097620_1002064053 75
193 3300006931 Ga0097620_101397994 Ga0097620_1013979942 75
194 3300006946 Ga0079104_1052219 Ga0079104_10522192 75
195 3300006946 Ga0079104_1054222 Ga0079104_10542222 75
196 3300009011 Ga0105251_10016214 Ga0105251_100162144 75
197 3300009092 Ga0105250_10040167 Ga0105250_100401673 75
198 3300009093 Ga0105240_11380751 Ga0105240_113807512 75
199 3300009093 Ga0105240_11857066 Ga0105240_118570662 75
200 3300009093 Ga0105240_12340423 Ga0105240_123404232 75
201 3300009094 Ga0111539_11288518 Ga0111539_112885182 75
202 3300009101 Ga0105247_10144469 Ga0105247_101444693 75
203 3300009148 Ga0105243_10767589 Ga0105243_107675891 75
204 3300009174 Ga0105241_10631007 Ga0105241_106310072 75
205 3300009174 Ga0105241_11641341 Ga0105241_116413412 75
206 3300009174 Ga0105241_12495943 Ga0105241_124959432 75
207 3300009177 Ga0105248_10059949 Ga0105248_100599493 75
208 3300009177 Ga0105248_10501134 Ga0105248_105011343 75
209 3300009177 Ga0105248_11064157 Ga0105248_110641572 75
210 3300009545 Ga0105237_10048537 Ga0105237_100485374 75
211 3300009545 Ga0105237_10059304 Ga0105237_100593043 75
212 3300009545 Ga0105237_10091535 Ga0105237_100915355 75
213 3300009545 Ga0105237_12287021 Ga0105237_122870212 75
214 3300009551 Ga0105238_10102613 Ga0105238_101026134 75
215 3300009551 Ga0105238_10455402 Ga0105238_104554022 75
216 3300009551 Ga0105238_10668100 Ga0105238_106681001 75
217 3300009551 Ga0105238_10763869 Ga0105238_107638693 75
218 3300009553 Ga0105249_10000006 Ga0105249_10000006114 75
219 3300009553 Ga0105249_10291555 Ga0105249_102915555 75
220 3300009553 Ga0105249_11366562 Ga0105249_113665622 75
221 3300009978 Ga0105148_100540 Ga0105148_1005405 75
222 3300010375 Ga0105239_10570804 Ga0105239_105708042 75
223 3300010375 Ga0105239_10620545 Ga0105239_106205452 75
224 3300010375 Ga0105239_12198078 Ga0105239_121980781 75
225 3300011119 Ga0105246_10477789 Ga0105246_104777893 75
226 3300013100 Ga0157373_10087299 Ga0157373_100872994 75
227 3300013100 Ga0157373_10152393 Ga0157373_101523933 75
228 3300013100 Ga0157373_10615179 Ga0157373_106151792 75
229 3300013104 Ga0157370_11983841 Ga0157370_119838411 75
230 3300013105 Ga0157369_10000713 Ga0157369_1000071319 75
231 3300013105 Ga0157369_10335132 Ga0157369_103351322 75
232 3300013105 Ga0157369_10445942 Ga0157369_104459425 75
233 3300013105 Ga0157369_10666774 Ga0157369_106667742 75
234 3300013105 Ga0157369_11745265 Ga0157369_117452652 75
235 3300013297 Ga0157378_10501215 Ga0157378_105012153 75
236 3300013306 Ga0163162_10008623 Ga0163162_100086237 75
237 3300013307 Ga0157372_10032771 Ga0157372_100327718 75
238 3300013307 Ga0157372_10059842 Ga0157372_100598426 75
239 3300013307 Ga0157372_10354637 Ga0157372_103546374 75
240 3300013307 Ga0157372_10901142 Ga0157372_109011421 75
241 3300013307 Ga0157372_11525579 Ga0157372_115255792 75
242 3300013307 Ga0157372_12055020 Ga0157372_120550202 75
243 3300013307 Ga0157372_12223916 Ga0157372_122239162 75
244 3300013308 Ga0157375_12028727 Ga0157375_120287272 75
245 3300014325 Ga0163163_10071955 Ga0163163_100719554 75
246 3300014326 Ga0157380_10000182 Ga0157380_100001828 75
247 3300014326 Ga0157380_10058444 Ga0157380_100584443 75
248 3300014968 Ga0157379_10049804 Ga0157379_100498043 75
249 3300017792 Ga0163161_12080327 Ga0163161_120803271 75
250 3300020081 Ga0206354_11591560 Ga0206354_115915601 75
251 3300021384 Ga0213876_10001077 Ga0213876_1000107716 75
252 3300021384 Ga0213876_10022787 Ga0213876_100227871 75
253 3300025250 Ga0209026_1001465 Ga0209026_10014658 75
254 3300025297 Ga0209758_1000555 Ga0209758_100055538 75
255 3300025298 Ga0209050_1000034 Ga0209050_1000034228 75
256 3300025304 Ga0209257_1000052 Ga0209257_1000052182 75
257 3300025304 Ga0209257_1000100 Ga0209257_100010047 75
258 3300025304 Ga0209257_1014543 Ga0209257_10145433 75
259 3300025321 Ga0207656_10246283 Ga0207656_102462832 75
260 3300025901 Ga0207688_10591391 Ga0207688_105913911 75
261 3300025903 Ga0207680_10400053 Ga0207680_104000532 75
262 3300025903 Ga0207680_10806718 Ga0207680_108067182 75
263 3300025903 Ga0207680_11279796 Ga0207680_112797961 75
264 3300025909 Ga0207705_10385123 Ga0207705_103851232 75
265 3300025909 Ga0207705_10925174 Ga0207705_109251741 75
266 3300025911 Ga0207654_10187655 Ga0207654_101876552 75
267 3300025913 Ga0207695_11450916 Ga0207695_114509162 75
268 3300025914 Ga0207671_10229002 Ga0207671_102290023 75
269 3300025917 Ga0207660_10365805 Ga0207660_103658052 75
270 3300025918 Ga0207662_10472288 Ga0207662_104722883 75
271 3300025919 Ga0207657_10052419 Ga0207657_100524195 75
272 3300025920 Ga0207649_10000043 Ga0207649_1000004378 75
273 3300025923 Ga0207681_10361412 Ga0207681_103614123 75
274 3300025923 Ga0207681_10595161 Ga0207681_105951612 75
275 3300025923 Ga0207681_11816477 Ga0207681_118164772 75
276 3300025923 Ga0207681_11871021 Ga0207681_118710212 75
277 3300025924 Ga0207694_10035042 Ga0207694_100350426 75
278 3300025924 Ga0207694_10322619 Ga0207694_103226193 75
279 3300025924 Ga0207694_10359393 Ga0207694_103593932 75
280 3300025924 Ga0207694_10585392 Ga0207694_105853921 75
281 3300025925 Ga0207650_10176847 Ga0207650_101768472 75
282 3300025926 Ga0207659_11720034 Ga0207659_117200342 75
283 3300025931 Ga0207644_10022986 Ga0207644_100229861 75
284 3300025931 Ga0207644_11532315 Ga0207644_115323152 75
285 3300025932 Ga0207690_10052761 Ga0207690_100527612 75
286 3300025933 Ga0207706_10015340 Ga0207706_100153404 75
287 3300025933 Ga0207706_10211000 Ga0207706_102110001 75
288 3300025935 Ga0207709_10413443 Ga0207709_104134433 75
289 3300025937 Ga0207669_10156416 Ga0207669_101564163 75
290 3300025941 Ga0207711_10033334 Ga0207711_100333344 75
291 3300025941 Ga0207711_10663848 Ga0207711_106638482 75
292 3300025942 Ga0207689_10391024 Ga0207689_103910242 75
293 3300025942 Ga0207689_10587898 Ga0207689_105878981 75
294 3300025944 Ga0207661_11905538 Ga0207661_119055382 75
295 3300025949 Ga0207667_11327157 Ga0207667_113271572 75
296 3300025972 Ga0207668_10012421 Ga0207668_100124219 75
297 3300025972 Ga0207668_10034185 Ga0207668_100341855 75
298 3300025972 Ga0207668_11605880 Ga0207668_116058802 75
299 3300025981 Ga0207640_10020993 Ga0207640_100209934 75
300 3300025981 Ga0207640_10080263 Ga0207640_100802633 75
301 3300025981 Ga0207640_10380129 Ga0207640_103801292 75
302 3300025981 Ga0207640_10726370 Ga0207640_107263702 75
303 3300025986 Ga0207658_10000069 Ga0207658_10000069115 75
304 3300026023 Ga0207677_10733962 Ga0207677_107339623 75
305 3300026041 Ga0207639_10000771 Ga0207639_1000077113 75
306 3300026041 Ga0207639_10160773 Ga0207639_101607734 75
307 3300026041 Ga0207639_10187001 Ga0207639_101870013 75
308 3300026041 Ga0207639_10730579 Ga0207639_107305792 75
309 3300026041 Ga0207639_11486247 Ga0207639_114862472 75
310 3300026067 Ga0207678_10889898 Ga0207678_108898982 75
311 3300026078 Ga0207702_10291064 Ga0207702_102910643 75
312 3300026088 Ga0207641_10003319 Ga0207641_100033196 75
313 3300026088 Ga0207641_10004490 Ga0207641_100044905 75
314 3300026095 Ga0207676_10041840 Ga0207676_100418405 75
315 3300026116 Ga0207674_10008322 Ga0207674_1000832210 75
316 3300026116 Ga0207674_10016903 Ga0207674_1001690311 75
317 3300026116 Ga0207674_10088087 Ga0207674_100880874 75
318 3300026116 Ga0207674_10239259 Ga0207674_102392593 75
319 3300026116 Ga0207674_10895518 Ga0207674_108955182 75
320 3300026116 Ga0207674_10959275 Ga0207674_109592751 75
321 3300026118 Ga0207675_100001918 Ga0207675_10000191823 75
322 3300026118 Ga0207675_100231134 Ga0207675_1002311343 75
323 3300026118 Ga0207675_100279112 Ga0207675_1002791123 75
324 3300026121 Ga0207683_10820574 Ga0207683_108205742 75
325 3300026121 Ga0207683_11590295 Ga0207683_115902952 75
326 3300026142 Ga0207698_10000130 Ga0207698_1000013027 75
327 3300026142 Ga0207698_10102005 Ga0207698_101020053 75
328 3300026142 Ga0207698_10109159 Ga0207698_101091592 75
329 3300026142 Ga0207698_10407978 Ga0207698_104079783 75
330 3300026142 Ga0207698_10602564 Ga0207698_106025642 75
331 3300026142 Ga0207698_10675077 Ga0207698_106750771 75
332 3300026142 Ga0207698_11276964 Ga0207698_112769642 75
333 3300027111 Ga0209281_1021396 Ga0209281_10213963 75
334 3300027111 Ga0209281_1042409 Ga0209281_10424092 75
335 3300028380 Ga0268265_10648415 Ga0268265_106484152 75
336 3300028381 Ga0268264_10000217 Ga0268264_10000217115 75
337 3300028381 Ga0268264_10157361 Ga0268264_101573612 75
338 3300028381 Ga0268264_11740826 Ga0268264_117408262 75
339 3300030521 Ga0307511_10082979 Ga0307511_100829794 75
340 3300031548 Ga0307408_100388134 Ga0307408_1003881343 75
341 3300031548 Ga0307408_100545382 Ga0307408_1005453822 75
342 3300031548 Ga0307408_101275253 Ga0307408_1012752532 75
343 3300031548 Ga0307408_101927041 Ga0307408_1019270412 75
344 3300031731 Ga0307405_10015706 Ga0307405_100157064 75
345 3300031731 Ga0307405_10233043 Ga0307405_102330433 75
346 3300031731 Ga0307405_10422638 Ga0307405_104226383 75
347 3300031731 Ga0307405_10442013 Ga0307405_104420133 75
348 3300031731 Ga0307405_10830145 Ga0307405_108301452 75
349 3300031824 Ga0307413_10375086 Ga0307413_103750863 75
350 3300031824 Ga0307413_11004602 Ga0307413_110046022 75
351 3300031824 Ga0307413_11966890 Ga0307413_119668902 75
352 3300031852 Ga0307410_10572941 Ga0307410_105729412 75
353 3300031901 Ga0307406_10071868 Ga0307406_100718683 75
354 3300031901 Ga0307406_10151212 Ga0307406_101512122 75
355 3300031901 Ga0307406_10312328 Ga0307406_103123282 75
356 3300031901 Ga0307406_10350397 Ga0307406_103503972 75
357 3300031903 Ga0307407_10227621 Ga0307407_102276213 75
358 3300031911 Ga0307412_10075035 Ga0307412_100750353 75
359 3300031911 Ga0307412_10135773 Ga0307412_101357733 75
360 3300031911 Ga0307412_10379010 Ga0307412_103790102 75
361 3300031911 Ga0307412_11378238 Ga0307412_113782382 75
362 3300031911 Ga0307412_11460401 Ga0307412_114604012 75
363 3300031995 Ga0307409_100244787 Ga0307409_1002447872 75
364 3300031995 Ga0307409_100365136 Ga0307409_1003651363 75
365 3300031995 Ga0307409_100485830 Ga0307409_1004858303 75
366 3300032002 Ga0307416_100491586 Ga0307416_1004915863 75
367 3300032002 Ga0307416_102537652 Ga0307416_1025376521 75
368 3300032004 Ga0307414_10001522 Ga0307414_1000152213 75
369 3300032004 Ga0307414_10085486 Ga0307414_100854862 75
370 3300032004 Ga0307414_10202434 Ga0307414_102024343 75
371 3300032005 Ga0307411_10459087 Ga0307411_104590873 75
372 3300032005 Ga0307411_11195573 Ga0307411_111955732 75
373 3300032005 Ga0307411_12179013 Ga0307411_121790132 75
374 3300032126 Ga0307415_100060290 Ga0307415_1000602903 75
375 3300032126 Ga0307415_100197799 Ga0307415_1001977993 75
376 3300032126 Ga0307415_100740511 Ga0307415_1007405112 75
377 3300033180 Ga0307510_10308054 Ga0307510_103080542 75
378 3300036401 Ga0373937_0267550 Ga0373937_0267550_198_431 75
379 3300037471 Ga0395905_0356568 Ga0395905_0356568_567_800 75
380 3300037471 Ga0395905_0364976 Ga0395905_0364976_580_813 75
381 3300037471 Ga0395905_0487066 Ga0395905_0487066_380_613 75
382 3300037471 Ga0395905_1046289 Ga0395905_1046289_62_295 75
383 3300039437 Ga0436365_0378480 Ga0436365_0378480_1656_1889 75
384 3300039437 Ga0436365_0600332 Ga0436365_0600332_109_342 75
385 3300039437 Ga0436365_0770163 Ga0436365_0770163_201_434 75
386 3300039437 Ga0436365_1117045 Ga0436365_1117045_3511_3738 75
387 3300039450 Ga0436363_1615302 Ga0436363_1615302_621_860 75
388 3300039453 Ga0436362_0438371 Ga0436362_0438371_493_732 75
389 3300041404 Ga0439436_0045695 Ga0439436_0045695_640_879 75
390 3300041410 Ga0439461_0046235 Ga0439461_0046235_223_456 75
391 3300041443 Ga0451789_0051834 Ga0451789_0051834_258_491 75
392 3300041451 Ga0451791_1915041 Ga0451791_1915041_635_862 75
393 3300041460 Ga0451802_0252467 Ga0451802_0252467_99_332 75
394 3300041486 Ga0451807_1450983 Ga0451807_1450983_232_468 75
395 3300041496 Ga0451839_1164718 Ga0451839_1164718_256_483 75
396 3300041509 Ga0451843_0433053 Ga0451843_0433053_32_265 75
397 3300041509 Ga0451843_1746187 Ga0451843_1746187_141_374 75
398 3300041512 Ga0451853_0669204 Ga0451853_0669204_224_460 75
399 3300041997 Ga0439431_0000140 Ga0439431_0000140_12433_12672 75
400 3300042002 Ga0439442_013335 Ga0439442_013335_475_714 75
401 3300042005 Ga0439448_0001939 Ga0439448_0001939_279_512 75
402 3300042007 Ga0439449_0289840 Ga0439449_0289840_218_457 75
403 3300042012 Ga0439455_0001428 Ga0439455_0001428_3169_3402 75
404 3300042012 Ga0439455_0003870 Ga0439455_0003870_874_1107 75
405 3300042012 Ga0439455_0014742 Ga0439455_0014742_1517_1750 75
406 3300042435 Ga0439434_0006562 Ga0439434_0006562_1487_1726 75
407 3300044658 Ga0466972_0000826 Ga0466972_0000826_5375_5608 75
408 3300044684 Ga0466966_0217347 Ga0466966_0217347_241_474 75
409 3300044693 Ga0466961_0036040 Ga0466961_0036040_1727_1960 75
410 3300044693 Ga0466961_0070130 Ga0466961_0070130_1873_2106 75
411 3300044693 Ga0466961_0307740 Ga0466961_0307740_510_752 75
412 3300044694 Ga0466963_0005815 Ga0466963_0005815_3463_3696 75
413 3300044706 Ga0466964_0000258 Ga0466964_0000258_4015_4248 75
414 3300044706 Ga0466964_0142197 Ga0466964_0142197_216_449 75
415 3300044719 Ga0466971_0005805 Ga0466971_0005805_534_767 75
416 3300044735 Ga0466968_0038917 Ga0466968_0038917_1693_1932 75
417 3300044735 Ga0466968_0236455 Ga0466968_0236455_610_843 75
418 3300044765 Ga0466970_0638277 Ga0466970_0638277_51_284 75
419 3300044842 Ga0466957_0042426 Ga0466957_0042426_1329_1562 75
420 3300044901 Ga0466960_0004100 Ga0466960_0004100_3110_3343 75
421 3300045049 Ga0466959_0561217 Ga0466959_0561217_440_673 75
422 3300045836 Ga0466958_0017628 Ga0466958_0017628_1681_1914 75
423 3300045976 Ga0466967_0053000 Ga0466967_0053000_2247_2480 75
424 3300045976 Ga0466967_2154385 Ga0466967_2154385_240_473 75
425 3300046460 Ga0495638_0006069 Ga0495638_0006069_3018_3245 75
426 3300046460 Ga0495638_0019313 Ga0495638_0019313_1702_1935 75
427 3300046460 Ga0495638_0102689 Ga0495638_0102689_221_454 75
428 3300046471 Ga0495650_0027516 Ga0495650_0027516_1295_1528 75
429 3300046506 Ga0495583_0000218 Ga0495583_0000218_87283_87516 75
430 3300046519 Ga0495632_0317276 Ga0495632_0317276_77_310 75
431 3300046525 Ga0495663_0003548 Ga0495663_0003548_723_962 75
432 3300046530 Ga0495654_0001073 Ga0495654_0001073_15359_15592 75
433 3300046537 Ga0495598_0004672 Ga0495598_0004672_565_804 75
434 3300046539 Ga0495621_0003301 Ga0495621_0003301_218_457 75
435 3300046539 Ga0495621_0179383 Ga0495621_0179383_283_510 75
436 3300046542 Ga0495597_0090244 Ga0495597_0090244_486_719 75
437 3300046557 Ga0495622_0478758 Ga0495622_0478758_198_431 75
438 3300046616 Ga0495668_0006416 Ga0495668_0006416_3121_3354 75
439 3300046616 Ga0495668_0011998 Ga0495668_0011998_2664_2897 75
440 3300046616 Ga0495668_0091593 Ga0495668_0091593_776_1009 75
441 3300046616 Ga0495668_0133256 Ga0495668_0133256_851_1084 75
442 3300046616 Ga0495668_0181938 Ga0495668_0181938_98_340 75
443 3300046616 Ga0495668_0307692 Ga0495668_0307692_164_397 75
444 3300046660 Ga0495625_0045065 Ga0495625_0045065_596_829 75
445 3300046660 Ga0495625_0287690 Ga0495625_0287690_681_914 75
446 3300046691 Ga0495670_0010027 Ga0495670_0010027_1512_1745 75
447 3300046794 Ga0495589_0067756 Ga0495589_0067756_768_1001 75
448 3300047469 Ga0495673_0011196 Ga0495673_0011196_1640_1873 75
449 3300047472 Ga0495686_0001246 Ga0495686_0001246_25634_25873 75
450 3300047472 Ga0495686_0048131 Ga0495686_0048131_1480_1713 75
451 3300047472 Ga0495686_0684368 Ga0495686_0684368_227_466 75
452 3300048091 Ga0495626_0421678 Ga0495626_0421678_118_351 75
453 3300048905 Ga0496102_0087675 Ga0496102_0087675_386_619 75
454 3300048905 Ga0496102_1416872 Ga0496102_1416872_251_484 75
455 3300048907 Ga0496104_1390858 Ga0496104_1390858_281_520 75
456 3300048911 Ga0496108_0000682 Ga0496108_0000682_14343_14570 75
457 3300048913 Ga0496110_0419373 Ga0496110_0419373_622_849 75
458 3300048916 Ga0496113_0519615 Ga0496113_0519615_261_500 75
459 3300048919 Ga0496116_0021417 Ga0496116_0021417_672_899 75
460 3300048920 Ga0496117_0354351 Ga0496117_0354351_126_359 75
461 3300048921 Ga0496118_0109131 Ga0496118_0109131_552_785 75
462 3300048924 Ga0496121_0000296 Ga0496121_0000296_28450_28689 75
463 3300048924 Ga0496121_0003051 Ga0496121_0003051_8419_8646 75
464 3300048925 Ga0496122_0039577 Ga0496122_0039577_2879_3106 75
465 3300048925 Ga0496122_0192299 Ga0496122_0192299_311_544 75
466 3300048925 Ga0496122_0313438 Ga0496122_0313438_241_480 75
467 3300048926 Ga0496123_0116075 Ga0496123_0116075_1221_1454 75
468 3300048926 Ga0496123_0156766 Ga0496123_0156766_489_728 75
469 3300048927 Ga0496124_0005852 Ga0496124_0005852_11026_11265 75
470 3300048927 Ga0496124_0033927 Ga0496124_0033927_1924_2151 75
471 3300048927 Ga0496124_0048088 Ga0496124_0048088_418_657 75
472 3300048927 Ga0496124_0265665 Ga0496124_0265665_865_1092 75
473 3300048927 Ga0496124_0363072 Ga0496124_0363072_51_278 75
474 3300048927 Ga0496124_0750333 Ga0496124_0750333_47_286 75
475 3300048928 Ga0496125_0049187 Ga0496125_0049187_2394_2639 75
476 3300048928 Ga0496125_0072386 Ga0496125_0072386_1244_1471 75
477 3300048928 Ga0496125_0091131 Ga0496125_0091131_964_1191 75
478 3300048928 Ga0496125_0286884 Ga0496125_0286884_499_738 75
479 3300048928 Ga0496125_0308228 Ga0496125_0308228_71_310 75
480 3300048928 Ga0496125_0394973 Ga0496125_0394973_338_565 75
481 3300048929 Ga0496126_0004477 Ga0496126_0004477_8128_8355 75
482 3300049127 Ga0501306_009105 Ga0501306_009105_172_405 75
483 3300049161 Ga0501305_021695 Ga0501305_021695_645_878 75
484 3300049162 Ga0501307_005380 Ga0501307_005380_723_956 75
485 3300049459 Ga0495678_137000 Ga0495678_137000_417_650 75
486 3300049460 Ga0495682_0053138 Ga0495682_0053138_919_1152 75
487 3300049527 Ga0501311_027272 Ga0501311_027272_141_374 75
488 3300049528 Ga0501312_025302 Ga0501312_025302_510_743 75
489 3300049529 Ga0501313_020213 Ga0501313_020213_515_748 75
490 3300049530 Ga0501314_017825 Ga0501314_017825_386_619 75
491 3300049531 Ga0501315_046231 Ga0501315_046231_74_307 75
492 3300049536 Ga0501320_006506 Ga0501320_006506_294_527 75
493 3300049537 Ga0501321_056218 Ga0501321_056218_209_442 75
494 3300049552 Ga0501336_018821 Ga0501336_018821_288_521 75
495 3300049570 Ga0501033_0205815 Ga0501033_0205815_80_319 75
496 3300049570 Ga0501033_0214787 Ga0501033_0214787_648_881 75
497 3300049571 Ga0501034_1557758 Ga0501034_1557758_23_262 75
498 3300049572 Ga0501036_1078947 Ga0501036_1078947_173_412 75
499 3300049574 Ga0501038_0059946 Ga0501038_0059946_2980_3207 75
500 3300049574 Ga0501038_0905183 Ga0501038_0905183_162_410 75
501 3300049575 Ga0501039_0229604 Ga0501039_0229604_1089_1316 75
502 3300049578 Ga0501042_0229792 Ga0501042_0229792_1058_1291 75
503 3300049579 Ga0501043_0049166 Ga0501043_0049166_2324_2563 75
504 3300049580 Ga0501046_0476873 Ga0501046_0476873_441_674 75
505 3300049581 Ga0501047_0104148 Ga0501047_0104148_1670_1903 75
506 3300049581 Ga0501047_0130480 Ga0501047_0130480_2148_2381 75
507 3300049581 Ga0501047_0673401 Ga0501047_0673401_285_518 75
508 3300049581 Ga0501047_0885518 Ga0501047_0885518_398_637 75
509 3300049589 Ga0501073_0480905 Ga0501073_0480905_153_386 75
510 3300049590 Ga0501074_0436178 Ga0501074_0436178_10_243 75
511 3300049592 Ga0501076_0137133 Ga0501076_0137133_1683_1916 75
512 3300049649 Ga0501198_007724 Ga0501198_007724_194_427 75
513 3300049652 Ga0501202_214062 Ga0501202_214062_58_291 75
514 3300049663 Ga0501223_000039 Ga0501223_000039_17621_17848 75
515 3300049676 Ga0501246_001398 Ga0501246_001398_992_1219 75
516 3300049679 Ga0501249_000213 Ga0501249_000213_16123_16356 75
517 3300049686 Ga0501257_000049 Ga0501257_000049_24393_24626 75
518 3300049705 Ga0501225_0000010 Ga0501225_0000010_74009_74236 75
519 3300049758 Ga0501241_014967 Ga0501241_014967_921_1154 75
520 3300049758 Ga0501241_024823 Ga0501241_024823_226_459 75
521 3300049764 Ga0501267_002297 Ga0501267_002297_1371_1604 75
522 3300049766 Ga0501269_003897 Ga0501269_003897_1231_1464 75
523 3300049822 Ga0501035_0350527 Ga0501035_0350527_648_887 75
524 3300049822 Ga0501035_0526827 Ga0501035_0526827_539_772 75
525 3300049822 Ga0501035_1366166 Ga0501035_1366166_298_531 75
526 3300049823 Ga0501044_0074300 Ga0501044_0074300_2441_2680 75
527 3300049850 Ga0501204_000430 Ga0501204_000430_1164_1397 75
528 3300050493 nmdc:mga0k408_150993_c1 nmdc:mga0k408_150993_c1_112_339 75
529 3300050493 nmdc:mga0k408_9833_c1 nmdc:mga0k408_9833_c1_4595_4828 75
530 3300050496 nmdc:mga07m45_144097_c1 nmdc:mga07m45_144097_c1_830_1063 75
531 3300050496 nmdc:mga07m45_65525_c1 nmdc:mga07m45_65525_c1_1052_1285 75
532 3300050509 nmdc:mga0qj67_77287_c1 nmdc:mga0qj67_77287_c1_480_713 75
533 3300053087 Ga0500643_000135 Ga0500643_000135_50699_50932 75
534 3300053087 Ga0500643_000195 Ga0500643_000195_54767_55009 75
535 3300053087 Ga0500643_000783 Ga0500643_000783_11692_11925 75
536 3300053087 Ga0500643_003224 Ga0500643_003224_3105_3347 75
537 3300053087 Ga0500643_018446 Ga0500643_018446_385_612 75
538 3300053087 Ga0500643_020706 Ga0500643_020706_1447_1674 75
539 3300053087 Ga0500643_025387 Ga0500643_025387_1013_1246 75
540 3300053087 Ga0500643_097989 Ga0500643_097989_193_426 75
541 3300053087 Ga0500643_193444 Ga0500643_193444_33_266 75
542 3300053103 Ga0500555_000575 Ga0500555_000575_8830_9063 75
543 3300053103 Ga0500555_142520 Ga0500555_142520_56_289 75
544 3300053104 Ga0500556_0000222 Ga0500556_0000222_4392_4625 75
545 3300053105 Ga0500557_124997 Ga0500557_124997_425_658 75
546 3300053108 Ga0500562_049382 Ga0500562_049382_204_437 75
547 3300053111 Ga0500572_271158 Ga0500572_271158_212_445 75
548 3300053116 Ga0500592_002248 Ga0500592_002248_1596_1838 75
549 3300053119 Ga0500595_012152 Ga0500595_012152_231_464 75
550 3300053121 Ga0500607_000844 Ga0500607_000844_26304_26537 75
551 3300053122 Ga0500608_007769 Ga0500608_007769_3269_3496 75
552 3300053130 Ga0500642_0000011 Ga0500642_0000011_147278_147511 75
553 3300053130 Ga0500642_0121939 Ga0500642_0121939_425_658 75
554 3300053136 Ga0500559_0003805 Ga0500559_0003805_2916_3149 75
555 3300053136 Ga0500559_0008073 Ga0500559_0008073_3051_3284 75
556 3300053136 Ga0500559_0166247 Ga0500559_0166247_787_1020 75
557 3300053136 Ga0500559_0304718 Ga0500559_0304718_454_681 75
558 3300053139 Ga0500568_0260875 Ga0500568_0260875_194_421 75
559 3300053140 Ga0500573_0000114 Ga0500573_0000114_23623_23856 75
560 3300053148 Ga0500590_065735 Ga0500590_065735_1358_1591 75
561 3300053151 Ga0500604_0039631 Ga0500604_0039631_921_1154 75
562 3300053157 Ga0500624_000106 Ga0500624_000106_35734_35961 75
563 3300053158 Ga0500627_0000570 Ga0500627_0000570_6722_6955 75
564 3300053158 Ga0500627_0279338 Ga0500627_0279338_463_705 75
565 3300053158 Ga0500627_0358637 Ga0500627_0358637_137_370 75
566 3300053177 Ga0500636_0005955 Ga0500636_0005955_4649_4876 75
567 3300053178 Ga0500637_0017519 Ga0500637_0017519_265_498 75
568 3300053730 Ga0500645_000417 Ga0500645_000417_27889_28122 75
569 3300053730 Ga0500645_004197 Ga0500645_004197_2811_3044 75
570 3300053730 Ga0500645_017913 Ga0500645_017913_173_406 75
571 3300054114 Ga0501084_0997730 Ga0501084_0997730_245_478 75
572 3300061719 Ga0466962_0005694 Ga0466962_0005694_1564_1797 75
573 3300061734 Ga0530510_0697718 Ga0530510_0697718_231_464 75

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01722

BolA

BolA-like protein

24

84

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.9018 2 75
5nfl-assembly1.cif.gz_A crystal structure of yrba from sinorhizobium meliloti in complex with cobalt. 0.8905 2 75
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8465 1 74
2mma-assembly1.cif.gz_B nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.8266 1 74
3tr3-assembly2.cif.gz_A structure of a bola protein homologue from coxiella burnetii 0.8252 1 74
ID Description Score Start End Superfamily
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.9018 2 75 3.30.300.90
5nflA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8905 2 75 3.30.300.90
af_P53082_9_118_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8733 1 73 3.10.20.90
af_Q53S33_27_107_3.30.300.90 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;BolA-like 0.8726 5 75 3.30.300.90
af_Q67VQ4_70_166_3.10.20.90 Alpha Beta;Roll;Ubiquitin-like (UB roll);Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 0.8615 4 74 3.10.20.90
ID Description Score Start End GO Terms
AF-A0A1G3ISV3-F1-model_v4 ATP-binding protein 0.9932 1 55 GO:0005524
AF-A0A5C8PQA4-F1-model_v4 BolA family transcriptional regulator 0.9626 1 75
AF-A0A258E1I0-F1-model_v4 BolA family transcriptional regulator 0.9557 1 75
AF-A0A5S9P6V0-F1-model_v4 DNA-binding transcriptional regulator BolA 0.9546 1 75
AF-A0A512IM53-F1-model_v4 ATP-binding protein 0.9531 1 75 GO:0005524

Feature Viewer

pLDDT pTM Quality
86.08 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map