F465179

General Info

Members Datasets Scaffolds Average Seq Length
573 425 1146 223

Family's Representative Sequence

Representative Sequence 3300009098|Ga0105245_10160732|Ga0105245_101607322
Length 252
Sequence MAACPDRAAASTSGFEETNMTTASGVAPSVVSGTTPLPPAKTDSSGATLSTTADSTLAGNFQTFLTLLTTQLQNQNPLDPLDTNQFTQQLVQFAGVEQQLKTNDQLTSLVSLQQTAQATQALGFVGKTAVVDGASTRLTNSAATWTLGVEQNSNVAITIASSTGQNVFTGNYPVTAGANQAFNWDGKGNDGTQWPDGKYTLTATAIDGSGNPVAVSTQIQGVVNSVDLTQTPPLLSINGQTYTVSQIKSITN

Samples

Sample ID Description Type Environment
1 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
52 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
53 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
54 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
55 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
56 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
59 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
102 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
105 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
106 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
108 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
111 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
112 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
113 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
118 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
119 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
124 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
127 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
132 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
133 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
134 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
135 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
136 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
137 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
138 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
139 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
140 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
141 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
142 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
143 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
144 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
145 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
146 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
147 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
148 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
149 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
150 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
151 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
152 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
153 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
154 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
155 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
156 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
157 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
161 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
162 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
163 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
164 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
165 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
166 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
167 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
168 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
169 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
170 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
171 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
172 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
173 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
186 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
187 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
188 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
189 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
190 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
191 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
192 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
193 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
194 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
195 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
196 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
197 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
198 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
201 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
202 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
203 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
204 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
205 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
206 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
207 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
208 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
209 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
210 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
211 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
212 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
213 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
214 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
215 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
216 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
217 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
218 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
219 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
220 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
221 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
222 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
223 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
224 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
225 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
226 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
227 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
228 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
233 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
234 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
235 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
236 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
237 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
238 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
239 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
240 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
241 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
242 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
243 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
244 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
245 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
246 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
247 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
248 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
249 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
250 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
251 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
252 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
253 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
254 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
255 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
256 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
257 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
258 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
259 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
260 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
261 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
262 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
263 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
264 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
265 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
266 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
267 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
268 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
269 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
270 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
271 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
272 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
273 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
274 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
275 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
276 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
277 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
278 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
279 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
280 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
281 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
282 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
283 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
284 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
285 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
286 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
287 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
288 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
289 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
290 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
291 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
292 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
293 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
294 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
295 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
296 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
297 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
298 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
299 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
300 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
301 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
302 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
303 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
304 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
305 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
306 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
307 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
308 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
309 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
310 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
311 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
312 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
313 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
314 2904699407
315 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
316 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
317 2906610324
318 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
319 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
320 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
321 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
322 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
323 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
324 2922368715
325 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
326 2922425934
327 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
328 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
329 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
330 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
331 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
332 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
333 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
334 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
335 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
336 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
337 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
338 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
339 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
340 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
341 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
342 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
343 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
344 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
345 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
346 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
347 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
348 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
349 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
350 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
351 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
352 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
353 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
354 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
355 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
356 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
357 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
358 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
359 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
360 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
361 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
362 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
363 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
364 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
365 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
366 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
367 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
368 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
369 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
370 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
371 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
372 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
373 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
374 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
375 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
376 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
377 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
378 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
379 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
380 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
381 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
382 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
383 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
384 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
385 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
386 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
387 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
388 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
389 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
390 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
391 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
392 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
393 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
394 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
395 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
396 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
397 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
398 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
399 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
400 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
401 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
402 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
403 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
404 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
405 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
406 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
407 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
408 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
409 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
410 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
411 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
412 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
413 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
414 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
415 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
416 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
417 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
418 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
419 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
420 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
421 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
422 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
423 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
424 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
425 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 66.61
Metatranscriptomes 0
Isolates 33.39

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.46
Nodule 24.78
Rhizoplane 1.4
Rhizosphere 56.2
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105245_10160732 3300009098 Bacteria 2131
2 JGI24739J22299_10050646 3300001989 Bacteria 1342
3 JGI24735J21928_10110101 3300002067 Bacteria 792
4 JGI25406J46586_10000042 3300003203 Bacteria 56211
5 JGI25153J46596_10014824 3300003215 Bacteria 3216
6 Ga0070683_100022840 3300005329 Bacteria 5595
7 Ga0070683_100027061 3300005329 Bacteria 5169
8 Ga0070690_100202293 3300005330 Bacteria 1382
9 Ga0070690_100340444 3300005330 Bacteria 1086
10 Ga0070666_10212266 3300005335 Bacteria 1364
11 Ga0070680_100020496 3300005336 Bacteria 5247
12 Ga0070680_100153092 3300005336 Bacteria 1936
13 Ga0070689_100069797 3300005340 Bacteria 2742
14 Ga0070689_100247013 3300005340 Bacteria 1471
15 Ga0070687_100315436 3300005343 Bacteria 997
16 Ga0070661_100305337 3300005344 Bacteria 1239
17 Ga0070671_100044481 3300005355 Bacteria 3690
18 Ga0070671_100446400 3300005355 Bacteria 1109
19 Ga0070671_100797809 3300005355 Bacteria 822
20 Ga0070673_100107274 3300005364 Bacteria 2310
21 Ga0070688_100024352 3300005365 Bacteria 3571
22 Ga0070709_10150998 3300005434 Bacteria 1606
23 Ga0070714_100070360 3300005435 Bacteria 3025
24 Ga0070713_100226289 3300005436 Bacteria 1698
25 Ga0070713_100325217 3300005436 Bacteria 1421
26 Ga0070713_100464757 3300005436 Bacteria 1190
27 Ga0070701_10109353 3300005438 Bacteria 1542
28 Ga0070663_100228282 3300005455 Bacteria 1465
29 Ga0070678_100015942 3300005456 Bacteria 4790
30 Ga0070681_10035109 3300005458 Bacteria 5037
31 Ga0070681_10050878 3300005458 Bacteria 4133
32 Ga0070681_10077166 3300005458 Bacteria 3289
33 Ga0070681_10176640 3300005458 Bacteria 2057
34 Ga0070706_100608863 3300005467 Bacteria 1015
35 Ga0070679_100074241 3300005530 Bacteria 3391
36 Ga0070679_100752768 3300005530 Bacteria 917
37 Ga0070684_100002394 3300005535 Bacteria 13823
38 Ga0070684_100020934 3300005535 Bacteria 5430
39 Ga0070684_100182940 3300005535 Bacteria 1906
40 Ga0070684_100447159 3300005535 Bacteria 1194
41 Ga0068853_100033735 3300005539 Bacteria 4342
42 Ga0068853_100139030 3300005539 Bacteria 2179
43 Ga0068853_100356031 3300005539 Bacteria 1362
44 Ga0070686_100627235 3300005544 Bacteria 850
45 Ga0068855_100029090 3300005563 Bacteria 6607
46 Ga0068855_100111323 3300005563 Bacteria 3143
47 Ga0068855_100348152 3300005563 Bacteria 1632
48 Ga0068855_100648047 3300005563 Bacteria 1134
49 Ga0068857_100076323 3300005577 Bacteria 2988
50 Ga0068857_100100459 3300005577 Bacteria 2595
51 Ga0068857_100135571 3300005577 Bacteria 2223
52 Ga0068857_100158685 3300005577 Bacteria 2052
53 Ga0068854_100006442 3300005578 Bacteria 7466
54 Ga0068854_100148964 3300005578 Bacteria 1803
55 Ga0068856_100026411 3300005614 Bacteria 5663
56 Ga0068856_100028835 3300005614 Bacteria 5423
57 Ga0068856_100111364 3300005614 Bacteria 2735
58 Ga0068856_100627456 3300005614 Bacteria 1095
59 Ga0068852_100037219 3300005616 Bacteria 4078
60 Ga0068852_100574675 3300005616 Bacteria 1129
61 Ga0068866_10224155 3300005718 Bacteria 1136
62 Ga0068851_10034075 3300005834 Bacteria 2541
63 Ga0068858_100583205 3300005842 Bacteria 1084
64 Ga0068860_100156595 3300005843 Bacteria 2196
65 Ga0081455_10083191 3300005937 Bacteria 2616
66 Ga0081540_1004136 3300005983 Bacteria 11192
67 Ga0081540_1026941 3300005983 Bacteria 3269
68 Ga0081539_10000099 3300005985 Bacteria 201018
69 Ga0070717_10054401 3300006028 Bacteria 3301
70 Ga0070717_10546376 3300006028 Bacteria 1049
71 Ga0075369_10189812 3300006186 Bacteria 947
72 Ga0075435_100088607 3300007076 Bacteria 2551
73 Ga0075435_100679899 3300007076 Unclassified 894
74 Ga0099795_10097845 3300007788 Bacteria 1147
75 Ga0105240_10044018 3300009093 Bacteria 5676
76 Ga0105240_10050592 3300009093 Bacteria 5237
77 Ga0105240_10258859 3300009093 Bacteria 2008
78 Ga0105240_10314480 3300009093 Bacteria 1787
79 Ga0105247_10019179 3300009101 Bacteria 4106
80 Ga0105243_10172452 3300009148 Bacteria 1875
81 Ga0105241_10008764 3300009174 Bacteria 7435
82 Ga0105241_10068734 3300009174 Bacteria 2745
83 Ga0105248_10017131 3300009177 Bacteria 7982
84 Ga0105248_10460191 3300009177 Bacteria 1434
85 Ga0105248_10616288 3300009177 Bacteria 1224
86 Ga0105237_10068311 3300009545 Bacteria 3547
87 Ga0105237_10192135 3300009545 Bacteria 2041
88 Ga0105237_10305958 3300009545 Bacteria 1592
89 Ga0105237_10527902 3300009545 Bacteria 1187
90 Ga0105238_10001064 3300009551 Bacteria 27700
91 Ga0105238_10189986 3300009551 Bacteria 2030
92 Ga0105239_10026044 3300010375 Bacteria 6439
93 Ga0105239_10064909 3300010375 Bacteria 4008
94 Ga0157370_10176670 3300013104 Bacteria 1985
95 Ga0157369_10029605 3300013105 Bacteria 6049
96 Ga0157369_10168227 3300013105 Bacteria 2311
97 Ga0157369_10274663 3300013105 Bacteria 1756
98 Ga0157369_10883745 3300013105 Bacteria 917
99 Ga0157378_10170204 3300013297 Bacteria 2042
100 Ga0157378_10537078 3300013297 Bacteria 1173
101 Ga0157372_10018081 3300013307 Bacteria 7577
102 Ga0157372_10087602 3300013307 Bacteria 3533
103 Ga0157372_10203272 3300013307 Bacteria 2295
104 Ga0157372_10472127 3300013307 Bacteria 1462
105 Ga0157372_10513208 3300013307 Bacteria 1397
106 Ga0157372_10829621 3300013307 Bacteria 1074
107 Ga0157372_11163610 3300013307 Bacteria 892
108 Ga0157375_10130243 3300013308 Bacteria 2634
109 Ga0209233_1001695 3300025261 Bacteria 8542
110 Ga0209758_1000761 3300025297 Bacteria 46617
111 Ga0209758_1002441 3300025297 Bacteria 18971
112 Ga0207656_10028798 3300025321 Bacteria 2282
113 Ga0207642_10079766 3300025899 Bacteria 1586
114 Ga0207680_10284012 3300025903 Bacteria 1150
115 Ga0207647_10017616 3300025904 Bacteria 4853
116 Ga0207647_10125826 3300025904 Bacteria 1508
117 Ga0207699_10066665 3300025906 Bacteria 2186
118 Ga0207699_10218530 3300025906 Bacteria 1300
119 Ga0207699_10239506 3300025906 Bacteria 1246
120 Ga0207643_10120863 3300025908 Bacteria 1551
121 Ga0207654_10004349 3300025911 Bacteria 7138
122 Ga0207654_10098018 3300025911 Bacteria 1800
123 Ga0207707_10003440 3300025912 Bacteria 14039
124 Ga0207707_10011326 3300025912 Bacteria 7764
125 Ga0207695_10003805 3300025913 Bacteria 20923
126 Ga0207695_10066223 3300025913 Bacteria 3711
127 Ga0207695_10088058 3300025913 Bacteria 3126
128 Ga0207695_10195404 3300025913 Bacteria 1939
129 Ga0207671_10289462 3300025914 Bacteria 1293
130 Ga0207693_10142026 3300025915 Bacteria 1888
131 Ga0207660_10007858 3300025917 Bacteria 6903
132 Ga0207660_10052634 3300025917 Bacteria 2899
133 Ga0207660_10160257 3300025917 Bacteria 1735
134 Ga0207662_10128924 3300025918 Bacteria 1593
135 Ga0207657_10046371 3300025919 Bacteria 3807
136 Ga0207649_10349794 3300025920 Bacteria 1093
137 Ga0207652_10012932 3300025921 Bacteria 6752
138 Ga0207694_10000273 3300025924 Bacteria 49024
139 Ga0207694_10149971 3300025924 Bacteria 1878
140 Ga0207694_10314119 3300025924 Bacteria 1292
141 Ga0207700_10412459 3300025928 Bacteria 1185
142 Ga0207664_10009049 3300025929 Bacteria 6975
143 Ga0207664_10768779 3300025929 Bacteria 866
144 Ga0207644_10046626 3300025931 Bacteria 3089
145 Ga0207644_10368816 3300025931 Bacteria 1169
146 Ga0207690_10062812 3300025932 Bacteria 2530
147 Ga0207709_10053211 3300025935 Bacteria 2490
148 Ga0207709_10201201 3300025935 Bacteria 1423
149 Ga0207670_10002365 3300025936 Bacteria 9878
150 Ga0207711_10039971 3300025941 Bacteria 3990
151 Ga0207711_10470500 3300025941 Bacteria 1170
152 Ga0207661_10011036 3300025944 Bacteria 6529
153 Ga0207661_10013783 3300025944 Bacteria 5906
154 Ga0207667_10061434 3300025949 Bacteria 3930
155 Ga0207667_10310636 3300025949 Bacteria 1610
156 Ga0207651_10138888 3300025960 Bacteria 1874
157 Ga0207712_10328337 3300025961 Bacteria 1264
158 Ga0207640_10024299 3300025981 Bacteria 3654
159 Ga0207640_10048246 3300025981 Bacteria 2751
160 Ga0207640_10196278 3300025981 Bacteria 1525
161 Ga0207658_10339476 3300025986 Bacteria 1305
162 Ga0207658_10649441 3300025986 Bacteria 951
163 Ga0207703_10238974 3300026035 Bacteria 1632
164 Ga0207703_10580561 3300026035 Bacteria 1059
165 Ga0207639_10026618 3300026041 Bacteria 4202
166 Ga0207639_10111980 3300026041 Bacteria 2226
167 Ga0207639_10200536 3300026041 Bacteria 1711
168 Ga0207678_10190273 3300026067 Bacteria 1753
169 Ga0207678_10442348 3300026067 Bacteria 1129
170 Ga0207702_10000003 3300026078 Bacteria 434196
171 Ga0207702_10250716 3300026078 Bacteria 1662
172 Ga0207702_11043305 3300026078 Bacteria 811
173 Ga0207676_10064466 3300026095 Bacteria 2914
174 Ga0207674_10017609 3300026116 Bacteria 7793
175 Ga0207674_10017929 3300026116 Bacteria 7716
176 Ga0207674_10080352 3300026116 Bacteria 3264
177 Ga0207674_10081035 3300026116 Bacteria 3248
178 Ga0207683_10080308 3300026121 Bacteria 2893
179 Ga0207698_10070159 3300026142 Bacteria 2775
180 Ga0207698_10226349 3300026142 Bacteria 1694
181 Ga0207698_10747018 3300026142 Bacteria 977
182 Ga0209179_1037038 3300027512 Bacteria 1017
183 Ga0268265_10331649 3300028380 Bacteria 1382
184 Ga0268264_10116491 3300028381 Bacteria 2349
185 Ga0265338_10002710 3300028800 Bacteria 25984
186 Ga0307509_10166363 3300031507 Bacteria 2093
187 Ga0265314_10099841 3300031711 Bacteria 1868
188 Ga0307510_10017344 3300033180 Bacteria 8494
189 Ga0315911_1000041 3300033442 Bacteria 50391
190 Ga0373934_0076062 3300035086 Bacteria 1346
191 Ga0373936_0079887 3300035113 Bacteria 1360
192 Ga0373953_0160102 3300035117 Bacteria 967
193 Ga0373957_0016848 3300035120 Bacteria 2536
194 Ga0373960_0048765 3300035121 Bacteria 1250
195 Ga0373943_0066748 3300035170 Bacteria 1812
196 Ga0373946_0072589 3300035171 Bacteria 1490
197 Ga0373942_0013108 3300035207 Bacteria 1989
198 Ga0373924_0023203 3300035410 Bacteria 2431
199 Ga0373931_0091364 3300035691 Bacteria 1696
200 Ga0373931_0177609 3300035691 Bacteria 1259
201 Ga0373935_0010722 3300035692 Bacteria 5505
202 Ga0373927_0004552 3300035695 Bacteria 9687
203 Ga0373933_0000348 3300035724 Bacteria 29489
204 Ga0373947_0089344 3300035725 Bacteria 1919
205 Ga0373947_0143862 3300035725 Bacteria 1531
206 Ga0373947_0144547 3300035725 Bacteria 1528
207 Ga0373937_0024377 3300036401 Bacteria 5456
208 Ga0373937_0029314 3300036401 Bacteria 4984
209 Ga0373925_0039919 3300037068 Bacteria 3473
210 Ga0373925_0084450 3300037068 Bacteria 2420
211 Ga0395900_0066102 3300037418 Bacteria 3716
212 Ga0395900_0348145 3300037418 Bacteria 1456
213 Ga0395898_0110956 3300037466 Bacteria 2629
214 Ga0395901_0784382 3300038443 Bacteria 943
215 Ga0436360_0246302 3300039438 Bacteria 1141
216 Ga0436361_0841583 3300039447 Bacteria 5858
217 Ga0436362_0898273 3300039453 Bacteria 1744
218 Ga0451797_1437678 3300041453 Bacteria 1404
219 Ga0466966_0153054 3300044684 Bacteria 1406
220 Ga0495592_0063091 3300046454 Bacteria 2718
221 Ga0495603_0007644 3300046455 Bacteria 6509
222 Ga0495580_0022211 3300046472 Bacteria 4672
223 Ga0495582_0089863 3300046473 Bacteria 1712
224 Ga0495639_0038161 3300046475 Bacteria 2156
225 Ga0495639_0040739 3300046475 Bacteria 2091
226 Ga0495662_0070276 3300046476 Bacteria 1696
227 Ga0495664_0024455 3300046477 Bacteria 3511
228 Ga0495664_0029513 3300046477 Bacteria 3208
229 Ga0495664_0135552 3300046477 Bacteria 1492
230 Ga0495596_0131864 3300046500 Bacteria 970
231 Ga0495606_0001165 3300046507 Bacteria 37175
232 Ga0495606_0087193 3300046507 Bacteria 1927
233 Ga0495618_0058621 3300046514 Bacteria 2439
234 Ga0495628_0353410 3300046516 Bacteria 1080
235 Ga0495630_0021600 3300046517 Bacteria 4752
236 Ga0495652_0141788 3300046529 Bacteria 1889
237 Ga0495652_0206336 3300046529 Bacteria 1488
238 Ga0495665_0001765 3300046531 Bacteria 11653
239 Ga0495645_0079829 3300046543 Bacteria 2349
240 Ga0495622_0140039 3300046557 Bacteria 1099
241 Ga0495634_0047695 3300046642 Bacteria 2885
242 Ga0495635_0095648 3300046663 Bacteria 2031
243 Ga0495635_0261533 3300046663 Bacteria 1165
244 Ga0495599_0152401 3300046678 Bacteria 1431
245 Ga0495669_0033793 3300046684 Bacteria 2253
246 Ga0495624_0034980 3300046690 Bacteria 3246
247 Ga0495589_0055698 3300046794 Bacteria 1948
248 Ga0495581_0015207 3300047315 Bacteria 4466
249 Ga0495604_0060788 3300047317 Bacteria 2892
250 Ga0495674_0025110 3300047319 Bacteria 5468
251 Ga0495672_0075515 3300047320 Bacteria 1895
252 Ga0495680_0440066 3300047322 Bacteria 894
253 Ga0495675_0244444 3300047444 Bacteria 1079
254 Ga0495684_0044321 3300047471 Bacteria 3405
255 Ga0495686_0230778 3300047472 Bacteria 1048
256 Ga0495593_0020413 3300047673 Bacteria 3711
257 Ga0495602_0146068 3300048088 Bacteria 1866
258 Ga0496107_0032832 3300048910 Bacteria 3711
259 Ga0496109_0032849 3300048912 Bacteria 4668
260 Ga0496112_0000092 3300048915 Bacteria 58800
261 Ga0496112_0368208 3300048915 Bacteria 1379
262 Ga0496113_0061960 3300048916 Bacteria 2824
263 Ga0496113_0458071 3300048916 Bacteria 1025
264 Ga0496117_0269748 3300048920 Bacteria 917
265 Ga0496118_0091623 3300048921 Bacteria 2090
266 Ga0496118_0104807 3300048921 Bacteria 1897
267 Ga0496119_0072754 3300048922 Bacteria 2007
268 Ga0496120_0225305 3300048923 Bacteria 893
269 Ga0496121_0001543 3300048924 Bacteria 38548
270 Ga0496121_0002390 3300048924 Bacteria 28777
271 Ga0496121_0080808 3300048924 Bacteria 2575
272 Ga0496124_0234488 3300048927 Bacteria 1369
273 Ga0496125_0040742 3300048928 Bacteria 3980
274 Ga0496126_0077035 3300048929 Bacteria 2957
275 Ga0501031_0013983 3300049568 Bacteria 5226
276 Ga0501031_0116748 3300049568 Bacteria 1743
277 Ga0501032_0001501 3300049569 Bacteria 18648
278 Ga0501032_0137725 3300049569 Bacteria 1608
279 Ga0501033_0000394 3300049570 Bacteria 42043
280 Ga0501033_0000639 3300049570 Bacteria 32342
281 Ga0501033_0365296 3300049570 Bacteria 1009
282 Ga0501034_0000157 3300049571 Bacteria 128661
283 Ga0501034_0050250 3300049571 Bacteria 4206
284 Ga0501034_0129753 3300049571 Bacteria 2504
285 Ga0501036_0000440 3300049572 Bacteria 29582
286 Ga0501036_0079868 3300049572 Bacteria 2766
287 Ga0501036_0165307 3300049572 Bacteria 1865
288 Ga0501036_0398275 3300049572 Bacteria 1148
289 Ga0501037_0000969 3300049573 Bacteria 21316
290 Ga0501037_0001723 3300049573 Bacteria 15886
291 Ga0501037_0131239 3300049573 Bacteria 1796
292 Ga0501037_0189493 3300049573 Bacteria 1456
293 Ga0501037_0194661 3300049573 Bacteria 1434
294 Ga0501038_0000473 3300049574 Bacteria 35337
295 Ga0501038_0010530 3300049574 Bacteria 8458
296 Ga0501038_0028444 3300049574 Bacteria 4966
297 Ga0501038_0124204 3300049574 Bacteria 2125
298 Ga0501038_0234309 3300049574 Bacteria 1459
299 Ga0501039_0002012 3300049575 Bacteria 15036
300 Ga0501039_0079953 3300049575 Bacteria 2544
301 Ga0501039_0090868 3300049575 Bacteria 2379
302 Ga0501040_0050301 3300049576 Bacteria 2850
303 Ga0501042_0045581 3300049578 Bacteria 3125
304 Ga0501043_0001087 3300049579 Bacteria 23901
305 Ga0501043_0003168 3300049579 Bacteria 13612
306 Ga0501043_0047701 3300049579 Bacteria 3367
307 Ga0501046_0000181 3300049580 Bacteria 64035
308 Ga0501046_0040280 3300049580 Bacteria 3734
309 Ga0501046_0041747 3300049580 Bacteria 3659
310 Ga0501047_0000419 3300049581 Bacteria 47535
311 Ga0501048_0000057 3300049582 Bacteria 56138
312 Ga0501048_0012727 3300049582 Bacteria 6255
313 Ga0501048_0111717 3300049582 Bacteria 1930
314 Ga0501067_0000507 3300049583 Bacteria 21269
315 Ga0501068_0004195 3300049584 Bacteria 7818
316 Ga0501068_0064932 3300049584 Bacteria 2221
317 Ga0501070_0003003 3300049586 Bacteria 14682
318 Ga0501070_0340417 3300049586 Bacteria 1218
319 Ga0501071_0048953 3300049587 Bacteria 3041
320 Ga0501072_0032143 3300049588 Bacteria 4109
321 Ga0501073_0000027 3300049589 Bacteria 121860
322 Ga0501073_0118530 3300049589 Bacteria 1834
323 Ga0501074_0000081 3300049590 Bacteria 46487
324 Ga0501077_0029372 3300049593 Bacteria 3495
325 Ga0501077_0225251 3300049593 Bacteria 1192
326 Ga0501079_0139416 3300049741 Bacteria 1889
327 Ga0501080_0000313 3300049742 Bacteria 37111
328 Ga0501080_0530841 3300049742 Bacteria 1049
329 Ga0501083_0000947 3300049744 Bacteria 19180
330 Ga0501083_0013730 3300049744 Bacteria 5665
331 Ga0501035_0000145 3300049822 Bacteria 86013
332 Ga0501035_0002494 3300049822 Bacteria 17985
333 Ga0501035_0083911 3300049822 Bacteria 2810
334 Ga0501035_0468199 3300049822 Bacteria 1041
335 Ga0501044_0002483 3300049823 Bacteria 21039
336 Ga0501044_0016900 3300049823 Bacteria 7826
337 Ga0501045_0003152 3300049824 Bacteria 11279
338 nmdc:mga0rr50_50311_c1 3300050513 Bacteria 3087
339 Ga0495601_0020345 3300053077 Bacteria 4053
340 Ga0495601_0164030 3300053077 Bacteria 1452
341 Ga0495612_0023260 3300053078 Bacteria 2486
342 Ga0495612_0031058 3300053078 Bacteria 2153
343 Ga0495612_0040750 3300053078 Bacteria 1893
344 Ga0495655_0096079 3300053083 Bacteria 871
345 Ga0495595_0063713 3300053084 Bacteria 1731
346 Ga0500651_0002411 3300053093 Bacteria 9867
347 Ga0500651_0204985 3300053093 Bacteria 1162
348 Ga0500566_0000394 3300053094 Bacteria 24254
349 Ga0500640_001550 3300053095 Bacteria 7061
350 Ga0500554_035741 3300053102 Bacteria 1496
351 Ga0500572_000156 3300053111 Bacteria 23706
352 Ga0500591_007133 3300053115 Bacteria 5133
353 Ga0500594_0032558 3300053118 Bacteria 1381
354 Ga0500595_004355 3300053119 Bacteria 6370
355 Ga0500595_008031 3300053119 Bacteria 4331
356 Ga0500595_019403 3300053119 Bacteria 2468
357 Ga0500595_083337 3300053119 Bacteria 933
358 Ga0500614_001247 3300053123 Bacteria 6179
359 Ga0500642_0075337 3300053130 Bacteria 1541
360 Ga0500642_0085298 3300053130 Bacteria 1455
361 Ga0500568_0005790 3300053139 Bacteria 6313
362 Ga0500568_0056408 3300053139 Bacteria 1531
363 Ga0500585_060174 3300053144 Bacteria 1366
364 Ga0500590_045922 3300053148 Bacteria 2235
365 Ga0500603_000254 3300053150 Bacteria 14076
366 Ga0500603_001083 3300053150 Bacteria 6405
367 Ga0500622_0140407 3300053156 Bacteria 1152
368 Ga0500630_000834 3300053159 Bacteria 14264
369 Ga0500638_048213 3300053162 Bacteria 2061
370 Ga0500639_001931 3300053163 Bacteria 10361
371 Ga0500636_0200457 3300053177 Bacteria 1056
372 Ga0500637_0000090 3300053178 Bacteria 32448
373 Ga0500637_0041530 3300053178 Bacteria 2599
374 Ga0500570_137545 3300053724 Bacteria 908
375 Ga0500596_001030 3300053735 Bacteria 5600
376 Ga0500601_005499 3300053737 Bacteria 1387
377 Ga0501084_0034424 3300054114 Bacteria 4236
378 Ga0500661_000273 3300055283 Bacteria 9361
379 Ga0501082_0002728 3300060353 Bacteria 15429
380 2507511343 2507262055 Bacteria 8048963
381 2508545141 2508501009 Bacteria 7784016
382 2509146671 2508501128 Bacteria 8613869
383 2511401077 2511231028 Bacteria 8046582
384 2513624173 2513237092 Bacteria 8341956
385 2513641143 2513237094 Bacteria 8789602
386 2513648596 2513237095 Bacteria 8976980
387 2513656052 2513237096 Bacteria 8722461
388 2513717859 2513237104 Bacteria 10034502
389 2513862856 2513237137 Bacteria 9558895
390 2513874924 2513237139 Bacteria 8737671
391 2513920940 2513237145 Bacteria 8979722
392 2514010353 2513237161 Bacteria 8871253
393 2515625073 2515154112 Bacteria 8294334
394 2517101081 2517093001 Bacteria 9002274
395 2517895873 2517572143 Bacteria 9484767
396 2524439976 2524023205 Bacteria 8918781
397 2524534751 2524023228 Bacteria 10118060
398 2528856805 2528768022 Bacteria 10457665
399 2617348507 2617270735 Bacteria 9163226
400 2617375060 2617270741 Bacteria 8201522
401 2671122673 2667528175 Bacteria 7532676
402 2728749599 2728368998 Bacteria 8720350
403 2745075160 2744054633 Bacteria 8678936
404 2793061704 2791355196 Bacteria 7323613
405 2793069693 2791355197 Bacteria 8420563
406 2805916488 2802429603 Bacteria 8777136
407 2818243478 2816332527 Bacteria 8933356
408 2824607656 2824600985 Bacteria 8488197
409 2824616810 2824609381 Bacteria 8672835
410 2824619571 2824617872 Bacteria 8814715
411 2824629007 2824626560 Bacteria 8813858
412 2824641329 2824635225 Bacteria 8785348
413 2824652600 2824644064 Bacteria 8743947
414 2824658897 2824653114 Bacteria 8493680
415 2824671177 2824661429 Bacteria 9877870
416 2824679031 2824671348 Bacteria 8369588
417 2824687729 2824679649 Bacteria 8248951
418 2824695622 2824687955 Bacteria 8360029
419 2824700098 2824696289 Bacteria 8335049
420 2824714278 2824704595 Bacteria 9667483
421 2824723149 2824714736 Bacteria 8717648
422 2824732508 2824723954 Bacteria 8758240
423 2824753485 2824746037 Bacteria 7911610
424 2824754147 2824753945 Bacteria 9787441
425 2824771654 2824763712 Bacteria 9792355
426 2824780553 2824773399 Bacteria 8360218
427 2838129006 2838122688 Bacteria 8803140
428 2841948283 2841941048 Bacteria 8688029
429 2841957221 2841949485 Bacteria 8680857
430 2841961495 2841957949 Bacteria 8652217
431 2841970135 2841966195 Bacteria 8673214
432 2841977220 2841974524 Bacteria 8931498
433 2841985648 2841983080 Bacteria 8395090
434 2842042385 2842038055 Bacteria 8002051
435 2842050428 2842045827 Bacteria 8006841
436 2847939120 2847930680 Bacteria 9342022
437 2847943935 2847939898 Bacteria 8606328
438 2857512597 2857509624 Bacteria 7472071
439 2874594562 2874590934 Bacteria 8299676
440 2874613916 2874612657 Bacteria 8252029
441 2874625557 2874620515 Bacteria 8290088
442 2874633759 2874628541 Bacteria 8630250
443 2874649610 2874645413 Bacteria 8214782
444 2876773694 2876771140 Bacteria 8287509
445 2876820685 2876818435 Bacteria 8274608
446 2879076887 2879074833 Bacteria 8279565
447 2879084592 2879083081 Bacteria 8587928
448 2879101154 2879099564 Bacteria 10442239
449 2879130325 2879127579 Bacteria 8294491
450 2879146841 2879142872 Bacteria 8267021
451 2881367361 2881364244 Bacteria 7710352
452 2881668739 2881665667 Bacteria 8175609
453 2885366565 2885366525 Bacteria 8326213
454 2885377254 2885374607 Bacteria 8927485
455 2885413506 2885409591 Bacteria 9235467
456 2888386867 2888378607 Bacteria 9652610
457 2888389590 2888388044 Bacteria 7304136
458 2888421505 2888419890 Bacteria 7857137
459 2903731355 2903727486 Bacteria 8281579
460 2903756031 2903748898 Bacteria 9972761
461 2904673503 2904666416 Bacteria 8226587
462 2904707010
463 2904719478 2904711408 Bacteria 9771557
464 2906603815 2906602504 Bacteria 8295279
465 2906615658
466 2906635034 2906626472 Bacteria 8826946
467 2906635553 2906635258 Bacteria 8601019
468 2906646093 2906643746 Bacteria 8722424
469 2906665095 2906660503 Bacteria 8595048
470 2908745526 2908739725 Bacteria 8628932
471 2908777546 2908775508 Bacteria 8092255
472 2922377021
473 2922398177 2922393267 Bacteria 8285685
474 2922432351
475 2929619151 2929615660 Bacteria 9193770
476 2929628354 2929624759 Bacteria 9339455
477 2932791281 2932784394 Bacteria 9704911
478 2932801947 2932801729 Bacteria 7987968
479 2932817691 2932809354 Bacteria 9135765
480 2932826975 2932818245 Bacteria 9955613
481 2932833150 2932828146 Bacteria 9745859
482 2933581073 2933577622 Bacteria 9116884
483 2935612328 2935608549 Bacteria 8203142
484 2935620567 2935616580 Bacteria 9032984
485 2935630818 2935630451 Bacteria 8169952
486 2935639654 2935638405 Bacteria 10015038
487 2935650170 2935648319 Bacteria 8801166
488 2935658317 2935656913 Bacteria 8965014
489 2935667508 2935665750 Bacteria 9571747
490 2935682927 2935675223 Bacteria 9928132
491 2935687594 2935684952 Bacteria 9590419
492 2935696435 2935694250 Bacteria 9291695
493 2935705248 2935703347 Bacteria 10242284
494 2935719054 2935713505 Bacteria 9608509
495 2935728706 2935722832 Bacteria 9608746
496 2935736698 2935732158 Bacteria 9706831
497 2935746300 2935741537 Bacteria 9707219
498 2935753560 2935750917 Bacteria 9590372
499 2935767752 2935760218 Bacteria 9817913
500 2935770510 2935769743 Bacteria 7878163
501 2935782469 2935777560 Bacteria 8077691
502 2935786437 2935785616 Bacteria 7962367
503 2935794492 2935793552 Bacteria 8012592
504 2935806994 2935801545 Bacteria 9301974
505 2935814088 2935810662 Bacteria 9401221
506 2935823816 2935819856 Bacteria 8261050
507 2935829137 2935827899 Bacteria 10038562
508 2935845329 2935837841 Bacteria 9454360
509 2935854454 2935847175 Bacteria 8228321
510 2935858375 2935855204 Bacteria 9035059
511 2935872311 2935864058 Bacteria 9784707
512 2935877342 2935873716 Bacteria 9632195
513 2935886134 2935883170 Bacteria 7964738
514 2935913455 2935908558 Bacteria 8568796
515 2935923351 2935916978 Bacteria 9113783
516 2935931228 2935926038 Bacteria 8601059
517 2935935510 2935934488 Bacteria 8602579
518 2935947076 2935942939 Bacteria 8599779
519 2935953829 2935951376 Bacteria 8602333
520 2935961531 2935959822 Bacteria 7869783
521 2935968855 2935967501 Bacteria 8603075
522 2935982481 2935975950 Bacteria 8347125
523 2935985949 2935984226 Bacteria 8302647
524 2935995039 2935992306 Bacteria 9802711
525 2936006132 2936002035 Bacteria 9362176
526 2936013271 2936011229 Bacteria 8801034
527 2936021642 2936019824 Bacteria 8804134
528 2936030564 2936028420 Bacteria 8965941
529 2936039643 2936037263 Bacteria 9446081
530 2936047836 2936046547 Bacteria 8903709
531 2936057838 2936055302 Bacteria 8785755
532 2940559473 2940556831 Bacteria 9590747
533 2941507470 2941507105 Bacteria 8166816
534 2941515897 2941515067 Bacteria 8166720
535 2941523395 2941523033 Bacteria 8169134
536 2941545700 2941538514 Bacteria 9402094
537 3005476687 3005474847 Bacteria 9259049
538 3005511221 3005506211 Bacteria 6943378
539 3005592085 3005587118 Bacteria 7794411
540 3005596200 3005594810 Bacteria 8716512
541 3005712136 3005710791 Bacteria 7622528
542 3005719371 3005718088 Bacteria 8283608
543 8006934792 8006933436 Bacteria 10410654
544 8006974760 8006973647 Bacteria 10679141
545 8016516888 8016511872 Bacteria 9921665
546 8016524481 8016522445 Bacteria 8156687
547 8016538041 8016530956 Bacteria 8155261
548 8016542315 8016539877 Bacteria 8155419
549 8016550964 8016548790 Bacteria 8155074
550 8016559373 8016557553 Bacteria 8154380
551 8016580395 8016575299 Bacteria 8154085
552 8016588768 8016583857 Bacteria 10421953
553 8016597313 8016595262 Bacteria 8149947
554 8016604944 8016603502 Bacteria 8731218
555 8016620064 8016613128 Bacteria 8794220
556 8016637700 8016630954 Bacteria 9217207
557 8017059683 8017057580 Bacteria 10023680
558 8019537708 8019530166 Bacteria 8155624
559 8019539340 8019538911 Bacteria 7872763
560 8019551306 8019547302 Bacteria 7996444
561 8019563861 8019555841 Bacteria 9642137
562 8019573932 8019565922 Bacteria 9639779
563 8019597209 8019586578 Bacteria 10212056
564 8019614053 8019608314 Bacteria 10042931
565 8019624586 8019619141 Bacteria 9218857
566 8019637448 8019629233 Bacteria 8687553
567 8019642162 8019638758 Bacteria 9062356
568 8019650358 8019648815 Bacteria 10014479
569 8019665384 8019659431 Bacteria 8577854
570 8019674929 8019668869 Bacteria 8791617
571 8019681166 8019678201 Bacteria 8863603
572 8019694536 8019687851 Bacteria 8712826
573 8055749591 8055742211 Bacteria 9226248
574 Ga0105245_10160732
575 JGI24739J22299_10050646
576 JGI24735J21928_10110101
577 JGI25406J46586_10000042
578 JGI25153J46596_10014824
579 Ga0070683_100022840
580 Ga0070683_100027061
581 Ga0070690_100202293
582 Ga0070690_100340444
583 Ga0070666_10212266
584 Ga0070680_100020496
585 Ga0070680_100153092
586 Ga0070689_100069797
587 Ga0070689_100247013
588 Ga0070687_100315436
589 Ga0070661_100305337
590 Ga0070671_100044481
591 Ga0070671_100446400
592 Ga0070671_100797809
593 Ga0070673_100107274
594 Ga0070688_100024352
595 Ga0070709_10150998
596 Ga0070714_100070360
597 Ga0070713_100226289
598 Ga0070713_100325217
599 Ga0070713_100464757
600 Ga0070701_10109353
601 Ga0070663_100228282
602 Ga0070678_100015942
603 Ga0070681_10035109
604 Ga0070681_10050878
605 Ga0070681_10077166
606 Ga0070681_10176640
607 Ga0070706_100608863
608 Ga0070679_100074241
609 Ga0070679_100752768
610 Ga0070684_100002394
611 Ga0070684_100020934
612 Ga0070684_100182940
613 Ga0070684_100447159
614 Ga0068853_100033735
615 Ga0068853_100139030
616 Ga0068853_100356031
617 Ga0070686_100627235
618 Ga0068855_100029090
619 Ga0068855_100111323
620 Ga0068855_100348152
621 Ga0068855_100648047
622 Ga0068857_100076323
623 Ga0068857_100100459
624 Ga0068857_100135571
625 Ga0068857_100158685
626 Ga0068854_100006442
627 Ga0068854_100148964
628 Ga0068856_100026411
629 Ga0068856_100028835
630 Ga0068856_100111364
631 Ga0068856_100627456
632 Ga0068852_100037219
633 Ga0068852_100574675
634 Ga0068866_10224155
635 Ga0068851_10034075
636 Ga0068858_100583205
637 Ga0068860_100156595
638 Ga0081455_10083191
639 Ga0081540_1004136
640 Ga0081540_1026941
641 Ga0081539_10000099
642 Ga0070717_10054401
643 Ga0070717_10546376
644 Ga0075369_10189812
645 Ga0075435_100088607
646 Ga0075435_100679899
647 Ga0099795_10097845
648 Ga0105240_10044018
649 Ga0105240_10050592
650 Ga0105240_10258859
651 Ga0105240_10314480
652 Ga0105247_10019179
653 Ga0105243_10172452
654 Ga0105241_10008764
655 Ga0105241_10068734
656 Ga0105248_10017131
657 Ga0105248_10460191
658 Ga0105248_10616288
659 Ga0105237_10068311
660 Ga0105237_10192135
661 Ga0105237_10305958
662 Ga0105237_10527902
663 Ga0105238_10001064
664 Ga0105238_10189986
665 Ga0105239_10026044
666 Ga0105239_10064909
667 Ga0157370_10176670
668 Ga0157369_10029605
669 Ga0157369_10168227
670 Ga0157369_10274663
671 Ga0157369_10883745
672 Ga0157378_10170204
673 Ga0157378_10537078
674 Ga0157372_10018081
675 Ga0157372_10087602
676 Ga0157372_10203272
677 Ga0157372_10472127
678 Ga0157372_10513208
679 Ga0157372_10829621
680 Ga0157372_11163610
681 Ga0157375_10130243
682 Ga0209233_1001695
683 Ga0209758_1000761
684 Ga0209758_1002441
685 Ga0207656_10028798
686 Ga0207642_10079766
687 Ga0207680_10284012
688 Ga0207647_10017616
689 Ga0207647_10125826
690 Ga0207699_10066665
691 Ga0207699_10218530
692 Ga0207699_10239506
693 Ga0207643_10120863
694 Ga0207654_10004349
695 Ga0207654_10098018
696 Ga0207707_10003440
697 Ga0207707_10011326
698 Ga0207695_10003805
699 Ga0207695_10066223
700 Ga0207695_10088058
701 Ga0207695_10195404
702 Ga0207671_10289462
703 Ga0207693_10142026
704 Ga0207660_10007858
705 Ga0207660_10052634
706 Ga0207660_10160257
707 Ga0207662_10128924
708 Ga0207657_10046371
709 Ga0207649_10349794
710 Ga0207652_10012932
711 Ga0207694_10000273
712 Ga0207694_10149971
713 Ga0207694_10314119
714 Ga0207700_10412459
715 Ga0207664_10009049
716 Ga0207664_10768779
717 Ga0207644_10046626
718 Ga0207644_10368816
719 Ga0207690_10062812
720 Ga0207709_10053211
721 Ga0207709_10201201
722 Ga0207670_10002365
723 Ga0207711_10039971
724 Ga0207711_10470500
725 Ga0207661_10011036
726 Ga0207661_10013783
727 Ga0207667_10061434
728 Ga0207667_10310636
729 Ga0207651_10138888
730 Ga0207712_10328337
731 Ga0207640_10024299
732 Ga0207640_10048246
733 Ga0207640_10196278
734 Ga0207658_10339476
735 Ga0207658_10649441
736 Ga0207703_10238974
737 Ga0207703_10580561
738 Ga0207639_10026618
739 Ga0207639_10111980
740 Ga0207639_10200536
741 Ga0207678_10190273
742 Ga0207678_10442348
743 Ga0207702_10000003
744 Ga0207702_10250716
745 Ga0207702_11043305
746 Ga0207676_10064466
747 Ga0207674_10017609
748 Ga0207674_10017929
749 Ga0207674_10080352
750 Ga0207674_10081035
751 Ga0207683_10080308
752 Ga0207698_10070159
753 Ga0207698_10226349
754 Ga0207698_10747018
755 Ga0209179_1037038
756 Ga0268265_10331649
757 Ga0268264_10116491
758 Ga0265338_10002710
759 Ga0307509_10166363
760 Ga0265314_10099841
761 Ga0307510_10017344
762 Ga0315911_1000041
763 Ga0373934_0076062
764 Ga0373936_0079887
765 Ga0373953_0160102
766 Ga0373957_0016848
767 Ga0373960_0048765
768 Ga0373943_0066748
769 Ga0373946_0072589
770 Ga0373942_0013108
771 Ga0373924_0023203
772 Ga0373931_0091364
773 Ga0373931_0177609
774 Ga0373935_0010722
775 Ga0373927_0004552
776 Ga0373933_0000348
777 Ga0373947_0089344
778 Ga0373947_0143862
779 Ga0373947_0144547
780 Ga0373937_0024377
781 Ga0373937_0029314
782 Ga0373925_0039919
783 Ga0373925_0084450
784 Ga0395900_0066102
785 Ga0395900_0348145
786 Ga0395898_0110956
787 Ga0395901_0784382
788 Ga0436360_0246302
789 Ga0436361_0841583
790 Ga0436362_0898273
791 Ga0451797_1437678
792 Ga0466966_0153054
793 Ga0495592_0063091
794 Ga0495603_0007644
795 Ga0495580_0022211
796 Ga0495582_0089863
797 Ga0495639_0038161
798 Ga0495639_0040739
799 Ga0495662_0070276
800 Ga0495664_0024455
801 Ga0495664_0029513
802 Ga0495664_0135552
803 Ga0495596_0131864
804 Ga0495606_0001165
805 Ga0495606_0087193
806 Ga0495618_0058621
807 Ga0495628_0353410
808 Ga0495630_0021600
809 Ga0495652_0141788
810 Ga0495652_0206336
811 Ga0495665_0001765
812 Ga0495645_0079829
813 Ga0495622_0140039
814 Ga0495634_0047695
815 Ga0495635_0095648
816 Ga0495635_0261533
817 Ga0495599_0152401
818 Ga0495669_0033793
819 Ga0495624_0034980
820 Ga0495589_0055698
821 Ga0495581_0015207
822 Ga0495604_0060788
823 Ga0495674_0025110
824 Ga0495672_0075515
825 Ga0495680_0440066
826 Ga0495675_0244444
827 Ga0495684_0044321
828 Ga0495686_0230778
829 Ga0495593_0020413
830 Ga0495602_0146068
831 Ga0496107_0032832
832 Ga0496109_0032849
833 Ga0496112_0000092
834 Ga0496112_0368208
835 Ga0496113_0061960
836 Ga0496113_0458071
837 Ga0496117_0269748
838 Ga0496118_0091623
839 Ga0496118_0104807
840 Ga0496119_0072754
841 Ga0496120_0225305
842 Ga0496121_0001543
843 Ga0496121_0002390
844 Ga0496121_0080808
845 Ga0496124_0234488
846 Ga0496125_0040742
847 Ga0496126_0077035
848 Ga0501031_0013983
849 Ga0501031_0116748
850 Ga0501032_0001501
851 Ga0501032_0137725
852 Ga0501033_0000394
853 Ga0501033_0000639
854 Ga0501033_0365296
855 Ga0501034_0000157
856 Ga0501034_0050250
857 Ga0501034_0129753
858 Ga0501036_0000440
859 Ga0501036_0079868
860 Ga0501036_0165307
861 Ga0501036_0398275
862 Ga0501037_0000969
863 Ga0501037_0001723
864 Ga0501037_0131239
865 Ga0501037_0189493
866 Ga0501037_0194661
867 Ga0501038_0000473
868 Ga0501038_0010530
869 Ga0501038_0028444
870 Ga0501038_0124204
871 Ga0501038_0234309
872 Ga0501039_0002012
873 Ga0501039_0079953
874 Ga0501039_0090868
875 Ga0501040_0050301
876 Ga0501042_0045581
877 Ga0501043_0001087
878 Ga0501043_0003168
879 Ga0501043_0047701
880 Ga0501046_0000181
881 Ga0501046_0040280
882 Ga0501046_0041747
883 Ga0501047_0000419
884 Ga0501048_0000057
885 Ga0501048_0012727
886 Ga0501048_0111717
887 Ga0501067_0000507
888 Ga0501068_0004195
889 Ga0501068_0064932
890 Ga0501070_0003003
891 Ga0501070_0340417
892 Ga0501071_0048953
893 Ga0501072_0032143
894 Ga0501073_0000027
895 Ga0501073_0118530
896 Ga0501074_0000081
897 Ga0501077_0029372
898 Ga0501077_0225251
899 Ga0501079_0139416
900 Ga0501080_0000313
901 Ga0501080_0530841
902 Ga0501083_0000947
903 Ga0501083_0013730
904 Ga0501035_0000145
905 Ga0501035_0002494
906 Ga0501035_0083911
907 Ga0501035_0468199
908 Ga0501044_0002483
909 Ga0501044_0016900
910 Ga0501045_0003152
911 nmdc:mga0rr50_50311_c1
912 Ga0495601_0020345
913 Ga0495601_0164030
914 Ga0495612_0023260
915 Ga0495612_0031058
916 Ga0495612_0040750
917 Ga0495655_0096079
918 Ga0495595_0063713
919 Ga0500651_0002411
920 Ga0500651_0204985
921 Ga0500566_0000394
922 Ga0500640_001550
923 Ga0500554_035741
924 Ga0500572_000156
925 Ga0500591_007133
926 Ga0500594_0032558
927 Ga0500595_004355
928 Ga0500595_008031
929 Ga0500595_019403
930 Ga0500595_083337
931 Ga0500614_001247
932 Ga0500642_0075337
933 Ga0500642_0085298
934 Ga0500568_0005790
935 Ga0500568_0056408
936 Ga0500585_060174
937 Ga0500590_045922
938 Ga0500603_000254
939 Ga0500603_001083
940 Ga0500622_0140407
941 Ga0500630_000834
942 Ga0500638_048213
943 Ga0500639_001931
944 Ga0500636_0200457
945 Ga0500637_0000090
946 Ga0500637_0041530
947 Ga0500570_137545
948 Ga0500596_001030
949 Ga0500601_005499
950 Ga0501084_0034424
951 Ga0500661_000273
952 Ga0501082_0002728
953 2507511343
954 2508545141
955 2509146671
956 2511401077
957 2513624173
958 2513641143
959 2513648596
960 2513656052
961 2513717859
962 2513862856
963 2513874924
964 2513920940
965 2514010353
966 2515625073
967 2517101081
968 2517895873
969 2524439976
970 2524534751
971 2528856805
972 2617348507
973 2617375060
974 2671122673
975 2728749599
976 2745075160
977 2793061704
978 2793069693
979 2805916488
980 2818243478
981 2824607656
982 2824616810
983 2824619571
984 2824629007
985 2824641329
986 2824652600
987 2824658897
988 2824671177
989 2824679031
990 2824687729
991 2824695622
992 2824700098
993 2824714278
994 2824723149
995 2824732508
996 2824753485
997 2824754147
998 2824771654
999 2824780553
1000 2838129006
1001 2841948283
1002 2841957221
1003 2841961495
1004 2841970135
1005 2841977220
1006 2841985648
1007 2842042385
1008 2842050428
1009 2847939120
1010 2847943935
1011 2857512597
1012 2874594562
1013 2874613916
1014 2874625557
1015 2874633759
1016 2874649610
1017 2876773694
1018 2876820685
1019 2879076887
1020 2879084592
1021 2879101154
1022 2879130325
1023 2879146841
1024 2881367361
1025 2881668739
1026 2885366565
1027 2885377254
1028 2885413506
1029 2888386867
1030 2888389590
1031 2888421505
1032 2903731355
1033 2903756031
1034 2904673503
1035 2904707010
1036 2904719478
1037 2906603815
1038 2906615658
1039 2906635034
1040 2906635553
1041 2906646093
1042 2906665095
1043 2908745526
1044 2908777546
1045 2922377021
1046 2922398177
1047 2922432351
1048 2929619151
1049 2929628354
1050 2932791281
1051 2932801947
1052 2932817691
1053 2932826975
1054 2932833150
1055 2933581073
1056 2935612328
1057 2935620567
1058 2935630818
1059 2935639654
1060 2935650170
1061 2935658317
1062 2935667508
1063 2935682927
1064 2935687594
1065 2935696435
1066 2935705248
1067 2935719054
1068 2935728706
1069 2935736698
1070 2935746300
1071 2935753560
1072 2935767752
1073 2935770510
1074 2935782469
1075 2935786437
1076 2935794492
1077 2935806994
1078 2935814088
1079 2935823816
1080 2935829137
1081 2935845329
1082 2935854454
1083 2935858375
1084 2935872311
1085 2935877342
1086 2935886134
1087 2935913455
1088 2935923351
1089 2935931228
1090 2935935510
1091 2935947076
1092 2935953829
1093 2935961531
1094 2935968855
1095 2935982481
1096 2935985949
1097 2935995039
1098 2936006132
1099 2936013271
1100 2936021642
1101 2936030564
1102 2936039643
1103 2936047836
1104 2936057838
1105 2940559473
1106 2941507470
1107 2941515897
1108 2941523395
1109 2941545700
1110 3005476687
1111 3005511221
1112 3005592085
1113 3005596200
1114 3005712136
1115 3005719371
1116 8006934792
1117 8006974760
1118 8016516888
1119 8016524481
1120 8016538041
1121 8016542315
1122 8016550964
1123 8016559373
1124 8016580395
1125 8016588768
1126 8016597313
1127 8016604944
1128 8016620064
1129 8016637700
1130 8017059683
1131 8019537708
1132 8019539340
1133 8019551306
1134 8019563861
1135 8019573932
1136 8019597209
1137 8019614053
1138 8019624586
1139 8019637448
1140 8019642162
1141 8019650358
1142 8019665384
1143 8019674929
1144 8019681166
1145 8019694536
1146 8055749591

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13861

FLgD_tudor

FlgD Tudor-like domain

116

248

0.99

PF03963

FlgD

Flagellar hook capping protein - N-terminal region

34

108

0.93

PF13860

FlgD_ig

FlgD Ig-like domain

133

209

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
5nfi-assembly1.cif.gz_B the fimbrial anchor protein mfa2 from porphyromonas gingivalis 0.7935 127 183
3osv-assembly1.cif.gz_A the crytsal structure of flgd from p. aeruginosa 0.6948 102 229
3c12-assembly1.cif.gz_A-2 crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly 0.6911 98 229
3osv-assembly1.cif.gz_A the crytsal structure of flgd from p. aeruginosa 0.6761 102 229
3c12-assembly1.cif.gz_A-2 crystal structure of flgd from xanthomonas campestris: insights into the hook capping essential for flagellar assembly 0.6634 98 229
ID Description Score Start End Superfamily
3c12A02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7878 105 195 2.60.40.4070
3osvD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7872 112 195 2.60.40.4070
3c12A02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7636 105 195 2.60.40.4070
3osvD02 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7554 112 195 2.60.40.4070
4qdgB01 Mainly Beta;Sandwich;Immunoglobulin-like; 0.7314 129 183 2.60.40.2100
ID Description Score Start End GO Terms
AF-A0A326L3F5-F1-model_v4 deleted 0.7966 31 228
AF-A0A2I0N9K0-F1-model_v4 Fibronectin type-III domain-containing protein 0.7866 126 198
AF-A0A849M5K1-F1-model_v4 T9SS type A sorting domain-containing protein 0.7824 113 198 GO:0004553
GO:0008061
GO:0009313
AF-A0A1F6GB75-F1-model_v4 Basal-body rod modification protein FlgD 0.7739 38 230 GO:0044781
AF-A0A3A0D5B9-F1-model_v4 T9SS C-terminal target domain-containing protein 0.7702 116 197 GO:0003993
GO:0046872

Map