F465114

General Info

Members Datasets Scaffolds Average Seq Length
572 240 1144 609

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0116691|Ga0496104_0116691_501_2447
Length 648
Sequence MNIDRASLIPALKNIATRLRIDSVRATSEAGSGHPTSCMSMAELTAALFFAEMRFDPKDXXXXESDRFVLSKGHAAPILYSAWAEAGAFDRSELLKLRTIGSDLEGHPTPRLNFVDVATGSLGQGICAAIGTALNARRIKSDYRTYVVMGDGESAEGSVWEAADVAAIDKLDSLCAITDVNALGQSRPTMFEHDMGQFERRWKAFGWHAIVIDGHDLGQILDALAEARATKGQPTMILARTIKGKGVASVEGHQGWHGRAFKKGEELDQALAELEKQFVPVPDGGPAANLAGQIPKPASKPRGVDNPRPVAAPSYKLGDLVATREAYGTALAKLAEADPRVVALDADVKNSTFSDRFEKVAPERFYQNFIAEQVMVGAAMGLAARGAIPFPSTFACFLSRAADFVRMAAISNVGIKIAGSHAGVSIGEDGPSQMALEDLAMYRAEPNYTVLYPSDAVSAERLLALMAYHPGPAYMRTSRPKTPVIYGNDDTFTIGGLKVLRESANDVATVIGAGITLFEALKAYDQLRAAGTAIRVIDLYSVQPVDSAALVAAGRATGGRLITVEDHYAAGGIGDAVAAAVADAGYTVHRLAVREIARSGKPEELVERYGISAAHIVAAVQSLKKLIVSGRGVRGRRPSAASSASAAT

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
54 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
55 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
56 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
57 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
75 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
76 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
120 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
121 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
124 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
125 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
130 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
131 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
132 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
133 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
134 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
135 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
136 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
137 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
138 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
139 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
140 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
141 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
142 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
143 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
144 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
145 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
146 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
147 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
148 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
149 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
150 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
151 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
152 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
153 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
156 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
157 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
162 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
167 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
168 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
169 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
170 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
173 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
174 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
175 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
176 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
177 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
178 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
179 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
183 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
184 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
185 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
186 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
187 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
188 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
215 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
216 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
217 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
221 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
222 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
223 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
224 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
225 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
226 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
227 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
228 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
229 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
230 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
231 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
232 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
233 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
234 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
235 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
236 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
237 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
238 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
239 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
240 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 3.85
Rhizosphere 95.98
Stem 0
Stem Tuber 0
Unclassified 4.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0116691 3300048907 Bacteria 2562
2 JGI25406J46586_10006003 3300003203 Bacteria 5616
3 Ga0065712_10067834 3300005290 Bacteria 27167
4 Ga0065712_10070961 3300005290 Bacteria 5568
5 Ga0065712_10074135 3300005290 Bacteria 4176
6 Ga0065712_10083486 3300005290 Bacteria 2833
7 Ga0065712_10084791 3300005290 Unclassified 2740
8 Ga0065715_10003600 3300005293 Bacteria 4866
9 Ga0065715_10110379 3300005293 Bacteria 2611
10 Ga0065715_10120661 3300005293 Unclassified 2251
11 Ga0065707_10087845 3300005295 Bacteria 4865
12 Ga0070676_10029831 3300005328 Bacteria 3105
13 Ga0070683_100027315 3300005329 Bacteria 5146
14 Ga0070690_100043879 3300005330 Bacteria 2837
15 Ga0070670_100022076 3300005331 Bacteria 5478
16 Ga0070670_100046348 3300005331 Bacteria 3738
17 Ga0070680_100026707 3300005336 Bacteria 4618
18 Ga0070689_100041143 3300005340 Bacteria 3547
19 Ga0070668_100033399 3300005347 Bacteria 3918
20 Ga0070669_100007867 3300005353 Bacteria 7620
21 Ga0070669_100039120 3300005353 Bacteria 3445
22 Ga0070675_100001943 3300005354 Bacteria 15297
23 Ga0070675_100007694 3300005354 Bacteria 8341
24 Ga0070671_100005817 3300005355 Bacteria 9821
25 Ga0070671_100035268 3300005355 Bacteria 4144
26 Ga0070674_100003306 3300005356 Bacteria 9023
27 Ga0070674_100016175 3300005356 Bacteria 4675
28 Ga0070673_100001036 3300005364 Bacteria 15753
29 Ga0070673_100001842 3300005364 Bacteria 12677
30 Ga0070673_100091726 3300005364 Bacteria 2484
31 Ga0070688_100004265 3300005365 Bacteria 7432
32 Ga0070688_100051000 3300005365 Bacteria 2580
33 Ga0070667_100107618 3300005367 Bacteria 2414
34 Ga0070703_10000065 3300005406 Bacteria 53851
35 Ga0070714_100028553 3300005435 Bacteria 4631
36 Ga0070713_100026100 3300005436 Bacteria 4581
37 Ga0070711_100021617 3300005439 Bacteria 4163
38 Ga0070705_100000071 3300005440 Bacteria 54477
39 Ga0070705_100005738 3300005440 Bacteria 6063
40 Ga0070700_100007372 3300005441 Bacteria 5934
41 Ga0070678_100024935 3300005456 Bacteria 4013
42 Ga0070681_10077374 3300005458 Bacteria 3285
43 Ga0070681_10187546 3300005458 Bacteria 1988
44 Ga0068867_100005323 3300005459 Bacteria 9094
45 Ga0070706_100000086 3300005467 Bacteria 108867
46 Ga0070707_100000244 3300005468 Bacteria 54267
47 Ga0070707_100060168 3300005468 Bacteria 3643
48 Ga0070707_100192256 3300005468 Bacteria 1990
49 Ga0070698_100009797 3300005471 Bacteria 10243
50 Ga0070698_100009874 3300005471 Bacteria 10205
51 Ga0070698_100045303 3300005471 Bacteria 4502
52 Ga0070699_100000018 3300005518 Bacteria 190128
53 Ga0070699_100005432 3300005518 Bacteria 11175
54 Ga0070679_100050253 3300005530 Bacteria 4153
55 Ga0070684_100054189 3300005535 Unclassified 3494
56 Ga0070672_100006328 3300005543 Bacteria 7945
57 Ga0070672_100012787 3300005543 Bacteria 5909
58 Ga0070672_100012933 3300005543 Bacteria 5882
59 Ga0070686_100004415 3300005544 Bacteria 7761
60 Ga0070686_100025408 3300005544 Bacteria 3564
61 Ga0070696_100000020 3300005546 Bacteria 71302
62 Ga0070665_100014808 3300005548 Bacteria 7829
63 Ga0070665_100134642 3300005548 Bacteria 2473
64 Ga0070704_100013288 3300005549 Bacteria 5107
65 Ga0070704_100013312 3300005549 Bacteria 5102
66 Ga0070704_100017850 3300005549 Bacteria 4526
67 Ga0070704_100053968 3300005549 Bacteria 2843
68 Ga0068855_100018152 3300005563 Bacteria 8452
69 Ga0070664_100008176 3300005564 Bacteria 8456
70 Ga0068857_100083409 3300005577 Bacteria 2855
71 Ga0068859_100045896 3300005617 Bacteria 4389
72 Ga0068859_100164064 3300005617 Bacteria 2301
73 Ga0068864_100019558 3300005618 Bacteria 5664
74 Ga0068864_100043218 3300005618 Bacteria 3858
75 Ga0068866_10011138 3300005718 Bacteria 3879
76 Ga0068863_100037641 3300005841 Bacteria 4605
77 Ga0068863_100045142 3300005841 Bacteria 4182
78 Ga0068858_100002099 3300005842 Bacteria 20232
79 Ga0068858_100037209 3300005842 Bacteria 4512
80 Ga0068862_100009264 3300005844 Bacteria 8152
81 Ga0081539_10000012 3300005985 Bacteria 440369
82 Ga0081539_10000291 3300005985 Bacteria 113769
83 Ga0081539_10003521 3300005985 Bacteria 19070
84 Ga0081539_10004484 3300005985 Bacteria 15365
85 Ga0081539_10012948 3300005985 Bacteria 6344
86 Ga0070715_10004427 3300006163 Bacteria 4609
87 Ga0097621_100004266 3300006237 Bacteria 9931
88 Ga0068871_100001623 3300006358 Bacteria 15155
89 Ga0068871_100007794 3300006358 Bacteria 7666
90 Ga0075428_100000338 3300006844 Bacteria 46466
91 Ga0075428_100000449 3300006844 Bacteria 41113
92 Ga0075428_100000862 3300006844 Bacteria 31924
93 Ga0075428_100001853 3300006844 Bacteria 22653
94 Ga0075428_100003401 3300006844 Bacteria 17401
95 Ga0075428_100004323 3300006844 Bacteria 15656
96 Ga0075428_100005671 3300006844 Bacteria 13876
97 Ga0075428_100005747 3300006844 Bacteria 13780
98 Ga0075428_100011882 3300006844 Bacteria 9682
99 Ga0075430_100000198 3300006846 Bacteria 40771
100 Ga0075430_100000794 3300006846 Bacteria 24497
101 Ga0075430_100001840 3300006846 Bacteria 17361
102 Ga0075430_100003909 3300006846 Bacteria 12564
103 Ga0075430_100004379 3300006846 Bacteria 11918
104 Ga0075430_100018975 3300006846 Bacteria 5851
105 Ga0075430_100022923 3300006846 Bacteria 5311
106 Ga0075430_100044272 3300006846 Bacteria 3765
107 Ga0075431_100013194 3300006847 Bacteria 8346
108 Ga0075431_100015158 3300006847 Bacteria 7809
109 Ga0075431_100025304 3300006847 Bacteria 6085
110 Ga0075431_100041005 3300006847 Bacteria 4773
111 Ga0075431_100056660 3300006847 Bacteria 4041
112 Ga0075431_100066822 3300006847 Bacteria 3712
113 Ga0075431_100117498 3300006847 Bacteria 2744
114 Ga0075431_100121021 3300006847 Unclassified 2701
115 Ga0075433_10000442 3300006852 Bacteria 26798
116 Ga0075433_10000818 3300006852 Bacteria 21663
117 Ga0075433_10001988 3300006852 Bacteria 15384
118 Ga0075433_10011585 3300006852 Bacteria 7102
119 Ga0075433_10013747 3300006852 Bacteria 6594
120 Ga0075433_10019644 3300006852 Bacteria 5634
121 Ga0075433_10066324 3300006852 Bacteria 3167
122 Ga0075433_10132687 3300006852 Bacteria 2213
123 Ga0075434_100002740 3300006871 Bacteria 15574
124 Ga0075434_100004387 3300006871 Bacteria 12709
125 Ga0075434_100007108 3300006871 Bacteria 10339
126 Ga0075434_100012231 3300006871 Bacteria 8132
127 Ga0075434_100012385 3300006871 Bacteria 8083
128 Ga0075434_100012956 3300006871 Bacteria 7920
129 Ga0075434_100030359 3300006871 Bacteria 5321
130 Ga0075434_100033325 3300006871 Bacteria 5083
131 Ga0075434_100107297 3300006871 Bacteria 2803
132 Ga0075429_100014842 3300006880 Bacteria 6753
133 Ga0075429_100014859 3300006880 Bacteria 6751
134 Ga0075429_100028028 3300006880 Bacteria 4887
135 Ga0075429_100077135 3300006880 Unclassified 2903
136 Ga0075429_100144355 3300006880 Bacteria 2083
137 Ga0068865_100118737 3300006881 Bacteria 1963
138 Ga0075436_100010793 3300006914 Bacteria 6267
139 Ga0075436_100014194 3300006914 Bacteria 5453
140 Ga0097620_100045896 3300006931 Bacteria 4389
141 Ga0097620_100164055 3300006931 Bacteria 2301
142 Ga0075435_100000663 3300007076 Bacteria 21212
143 Ga0075435_100001449 3300007076 Bacteria 15228
144 Ga0075435_100009932 3300007076 Bacteria 6931
145 Ga0075435_100024677 3300007076 Bacteria 4669
146 Ga0075435_100031809 3300007076 Bacteria 4161
147 Ga0075435_100033383 3300007076 Bacteria 4069
148 Ga0105240_10003574 3300009093 Bacteria 24119
149 Ga0105240_10048072 3300009093 Bacteria 5394
150 Ga0105240_10050264 3300009093 Bacteria 5258
151 Ga0111539_10000212 3300009094 Bacteria 69431
152 Ga0111539_10000507 3300009094 Bacteria 49442
153 Ga0111539_10000966 3300009094 Bacteria 37738
154 Ga0111539_10001433 3300009094 Bacteria 31824
155 Ga0111539_10001470 3300009094 Bacteria 31495
156 Ga0111539_10001647 3300009094 Bacteria 29819
157 Ga0111539_10001692 3300009094 Bacteria 29428
158 Ga0111539_10003630 3300009094 Bacteria 20329
159 Ga0111539_10005873 3300009094 Bacteria 15849
160 Ga0111539_10042848 3300009094 Bacteria 5431
161 Ga0111539_10086836 3300009094 Bacteria 3675
162 Ga0111539_10105288 3300009094 Bacteria 3310
163 Ga0111539_10111657 3300009094 Unclassified 3207
164 Ga0111539_10197874 3300009094 Bacteria 2344
165 Ga0105245_10077646 3300009098 Bacteria 3028
166 Ga0105247_10010321 3300009101 Bacteria 5650
167 Ga0105247_10016050 3300009101 Bacteria 4487
168 Ga0114129_10000047 3300009147 Bacteria 104957
169 Ga0114129_10000380 3300009147 Bacteria 51486
170 Ga0114129_10001294 3300009147 Bacteria 33348
171 Ga0114129_10001635 3300009147 Bacteria 30431
172 Ga0114129_10002141 3300009147 Bacteria 27226
173 Ga0114129_10002569 3300009147 Bacteria 25222
174 Ga0114129_10002715 3300009147 Bacteria 24647
175 Ga0114129_10006090 3300009147 Bacteria 17102
176 Ga0114129_10006886 3300009147 Bacteria 16165
177 Ga0114129_10007729 3300009147 Bacteria 15296
178 Ga0114129_10009873 3300009147 Bacteria 13608
179 Ga0114129_10010372 3300009147 Bacteria 13288
180 Ga0114129_10012425 3300009147 Bacteria 12123
181 Ga0114129_10013435 3300009147 Bacteria 11670
182 Ga0114129_10017722 3300009147 Bacteria 10141
183 Ga0114129_10021764 3300009147 Bacteria 9101
184 Ga0114129_10042291 3300009147 Bacteria 6416
185 Ga0114129_10052607 3300009147 Bacteria 5716
186 Ga0114129_10102026 3300009147 Bacteria 3968
187 Ga0114129_10130723 3300009147 Bacteria 3448
188 Ga0114129_10286478 3300009147 Bacteria 2199
189 Ga0105243_10020845 3300009148 Bacteria 4974
190 Ga0105243_10091086 3300009148 Bacteria 2511
191 Ga0105242_10009175 3300009176 Bacteria 7594
192 Ga0105248_10009460 3300009177 Bacteria 10725
193 Ga0105248_10041719 3300009177 Bacteria 5145
194 Ga0105248_10066873 3300009177 Bacteria 4035
195 Ga0105248_10095695 3300009177 Bacteria 3343
196 Ga0105248_10102051 3300009177 Bacteria 3233
197 Ga0105249_10001101 3300009553 Bacteria 24048
198 Ga0105249_10140333 3300009553 Bacteria 2317
199 Ga0105239_10259406 3300010375 Bacteria 1953
200 Ga0105246_10103421 3300011119 Bacteria 2078
201 Ga0157374_10121757 3300013296 Bacteria 2518
202 Ga0157378_10002161 3300013297 Bacteria 17469
203 Ga0163162_10028660 3300013306 Bacteria 5511
204 Ga0157375_10020574 3300013308 Bacteria 6031
205 Ga0163163_10000071 3300014325 Bacteria 112778
206 Ga0163163_10030907 3300014325 Bacteria 5164
207 Ga0163163_10046828 3300014325 Bacteria 4248
208 Ga0157380_10002810 3300014326 Bacteria 11835
209 Ga0157380_10044828 3300014326 Bacteria 3467
210 Ga0157380_10055722 3300014326 Unclassified 3141
211 Ga0157380_10081946 3300014326 Bacteria 2640
212 Ga0157379_10012534 3300014968 Bacteria 7404
213 Ga0157379_10034238 3300014968 Bacteria 4527
214 Ga0157379_10055938 3300014968 Bacteria 3526
215 Ga0157376_10026098 3300014969 Bacteria 4612
216 Ga0157376_10030360 3300014969 Bacteria 4316
217 Ga0157376_10035023 3300014969 Bacteria 4058
218 Ga0157376_10043469 3300014969 Bacteria 3687
219 Ga0157376_10078627 3300014969 Bacteria 2825
220 Ga0207697_10000485 3300025315 Bacteria 22453
221 Ga0207653_10000096 3300025885 Bacteria 63350
222 Ga0207710_10014029 3300025900 Bacteria 3375
223 Ga0207688_10002387 3300025901 Bacteria 10110
224 Ga0207645_10001127 3300025907 Bacteria 22111
225 Ga0207684_10000214 3300025910 Bacteria 89452
226 Ga0207695_10134492 3300025913 Bacteria 2427
227 Ga0207695_10153111 3300025913 Bacteria 2243
228 Ga0207652_10016546 3300025921 Bacteria 6023
229 Ga0207646_10000044 3300025922 Bacteria 183369
230 Ga0207646_10045858 3300025922 Bacteria 3923
231 Ga0207681_10007785 3300025923 Bacteria 6562
232 Ga0207681_10038058 3300025923 Bacteria 3184
233 Ga0207681_10075437 3300025923 Bacteria 2365
234 Ga0207681_10089107 3300025923 Unclassified 2199
235 Ga0207650_10006782 3300025925 Bacteria 7808
236 Ga0207650_10011073 3300025925 Bacteria 6201
237 Ga0207650_10058831 3300025925 Unclassified 2863
238 Ga0207650_10128655 3300025925 Unclassified 1979
239 Ga0207659_10000233 3300025926 Bacteria 34013
240 Ga0207659_10035946 3300025926 Bacteria 3428
241 Ga0207659_10134199 3300025926 Bacteria 1915
242 Ga0207644_10054122 3300025931 Bacteria 2889
243 Ga0207706_10028564 3300025933 Unclassified 4981
244 Ga0207706_10044472 3300025933 Bacteria 3936
245 Ga0207706_10049389 3300025933 Archaea 3717
246 Ga0207686_10009800 3300025934 Bacteria 5205
247 Ga0207686_10033815 3300025934 Bacteria 3054
248 Ga0207709_10027994 3300025935 Bacteria 3254
249 Ga0207669_10023434 3300025937 Bacteria 3298
250 Ga0207669_10038340 3300025937 Bacteria 2758
251 Ga0207669_10040774 3300025937 Bacteria 2697
252 Ga0207704_10054147 3300025938 Bacteria 2444
253 Ga0207691_10002703 3300025940 Bacteria 17338
254 Ga0207691_10013635 3300025940 Bacteria 7768
255 Ga0207691_10014343 3300025940 Bacteria 7554
256 Ga0207691_10034365 3300025940 Bacteria 4715
257 Ga0207711_10007457 3300025941 Bacteria 9152
258 Ga0207711_10029586 3300025941 Bacteria 4622
259 Ga0207711_10031617 3300025941 Bacteria 4469
260 Ga0207689_10025644 3300025942 Bacteria 4940
261 Ga0207689_10040565 3300025942 Bacteria 3853
262 Ga0207661_10049469 3300025944 Bacteria 3346
263 Ga0207661_10071846 3300025944 Bacteria 2830
264 Ga0207679_10015790 3300025945 Bacteria 5001
265 Ga0207679_10069847 3300025945 Unclassified 2645
266 Ga0207651_10004511 3300025960 Bacteria 7029
267 Ga0207712_10005151 3300025961 Bacteria 8269
268 Ga0207677_10004307 3300026023 Bacteria 7623
269 Ga0207703_10014081 3300026035 Bacteria 6233
270 Ga0207703_10016206 3300026035 Bacteria 5809
271 Ga0207639_10051427 3300026041 Bacteria 3134
272 Ga0207678_10053760 3300026067 Bacteria 3469
273 Ga0207708_10001748 3300026075 Bacteria 16054
274 Ga0207708_10093836 3300026075 Bacteria 2316
275 Ga0207708_10103242 3300026075 Unclassified 2208
276 Ga0207641_10007307 3300026088 Bacteria 9204
277 Ga0207648_10009704 3300026089 Bacteria 9205
278 Ga0207648_10033283 3300026089 Bacteria 4547
279 Ga0207676_10004468 3300026095 Bacteria 9889
280 Ga0207676_10028822 3300026095 Bacteria 4152
281 Ga0207676_10065048 3300026095 Bacteria 2903
282 Ga0207683_10008828 3300026121 Bacteria 8596
283 Ga0207683_10029283 3300026121 Bacteria 4766
284 Ga0207428_10000319 3300027907 Bacteria 62926
285 Ga0207428_10001054 3300027907 Bacteria 30266
286 Ga0207428_10003312 3300027907 Bacteria 15666
287 Ga0207428_10003762 3300027907 Bacteria 14568
288 Ga0207428_10004918 3300027907 Bacteria 12594
289 Ga0207428_10008335 3300027907 Bacteria 9364
290 Ga0207428_10019413 3300027907 Bacteria 5797
291 Ga0207428_10062305 3300027907 Bacteria 2950
292 Ga0268266_10010862 3300028379 Bacteria 7932
293 Ga0268266_10045733 3300028379 Bacteria 3745
294 Ga0268266_10084127 3300028379 Bacteria 2778
295 Ga0268266_10134568 3300028379 Bacteria 2213
296 Ga0268265_10050252 3300028380 Bacteria 3140
297 Ga0265337_1000067 3300028556 Bacteria 48544
298 Ga0265326_10012010 3300028558 Bacteria 2550
299 Ga0265323_10000052 3300028653 Bacteria 63341
300 Ga0265338_10000025 3300028800 Bacteria 296972
301 Ga0265338_10000242 3300028800 Bacteria 101378
302 Ga0265338_10001160 3300028800 Bacteria 43556
303 Ga0265338_10003083 3300028800 Bacteria 23913
304 Ga0265338_10004415 3300028800 Bacteria 19017
305 Ga0265338_10005104 3300028800 Bacteria 17318
306 Ga0265338_10006692 3300028800 Bacteria 14569
307 Ga0265338_10007193 3300028800 Bacteria 13921
308 Ga0265338_10008324 3300028800 Bacteria 12617
309 Ga0265338_10058596 3300028800 Bacteria 3398
310 Ga0265320_10001039 3300031240 Bacteria 20598
311 Ga0265320_10041859 3300031240 Bacteria 2275
312 Ga0265325_10033388 3300031241 Bacteria 2743
313 Ga0265339_10000229 3300031249 Bacteria 45404
314 Ga0265316_10002363 3300031344 Bacteria 19648
315 Ga0265316_10030185 3300031344 Bacteria 4447
316 Ga0265316_10038666 3300031344 Bacteria 3841
317 Ga0265316_10039455 3300031344 Bacteria 3792
318 Ga0307408_100028322 3300031548 Bacteria 3870
319 Ga0307408_100032895 3300031548 Bacteria 3618
320 Ga0265314_10009026 3300031711 Bacteria 8476
321 Ga0265314_10036671 3300031711 Bacteria 3560
322 Ga0265314_10074054 3300031711 Bacteria 2269
323 Ga0265342_10024332 3300031712 Bacteria 3824
324 Ga0265342_10053584 3300031712 Bacteria 2400
325 Ga0307405_10013542 3300031731 Bacteria 4354
326 Ga0307405_10038322 3300031731 Bacteria 2888
327 Ga0307413_10009556 3300031824 Bacteria 4649
328 Ga0307413_10014570 3300031824 Bacteria 3999
329 Ga0307413_10020308 3300031824 Bacteria 3530
330 Ga0307410_10062226 3300031852 Bacteria 2556
331 Ga0307406_10003443 3300031901 Bacteria 8613
332 Ga0307407_10000594 3300031903 Bacteria 11505
333 Ga0307407_10002881 3300031903 Bacteria 6873
334 Ga0307412_10020749 3300031911 Bacteria 4003
335 Ga0307412_10023293 3300031911 Bacteria 3808
336 Ga0307412_10025416 3300031911 Bacteria 3669
337 Ga0307412_10036481 3300031911 Bacteria 3150
338 Ga0307409_100004132 3300031995 Bacteria 8077
339 Ga0307409_100015410 3300031995 Bacteria 5018
340 Ga0307409_100027340 3300031995 Bacteria 4041
341 Ga0307416_100001749 3300032002 Bacteria 12020
342 Ga0307416_100005239 3300032002 Bacteria 7932
343 Ga0307416_100017193 3300032002 Bacteria 5051
344 Ga0307416_100020772 3300032002 Bacteria 4695
345 Ga0307416_100057242 3300032002 Bacteria 3152
346 Ga0307411_10004812 3300032005 Bacteria 6544
347 Ga0307411_10062730 3300032005 Bacteria 2480
348 Ga0307411_10076571 3300032005 Bacteria 2287
349 Ga0307415_100000792 3300032126 Bacteria 14346
350 Ga0373959_0000634 3300034820 Bacteria 6093
351 Ga0373938_0001200 3300034957 Bacteria 4174
352 Ga0373929_0000935 3300035085 Bacteria 5679
353 Ga0373940_0000767 3300035088 Bacteria 5255
354 Ga0373952_0000240 3300035092 Bacteria 8860
355 Ga0373932_0001010 3300035112 Bacteria 8135
356 Ga0373939_0000888 3300035114 Bacteria 7427
357 Ga0373941_0000212 3300035115 Bacteria 11130
358 Ga0373956_0002802 3300035119 Bacteria 7046
359 Ga0373943_0002350 3300035170 Bacteria 8589
360 Ga0373955_0008388 3300035172 Bacteria 4799
361 Ga0373955_0017927 3300035172 Eukaryota 3511
362 Ga0373942_0001017 3300035207 Bacteria 7640
363 Ga0373962_0001423 3300035242 Bacteria 5639
364 Ga0373924_0005537 3300035410 Bacteria 4479
365 Ga0373931_0000515 3300035691 Bacteria 15817
366 Ga0373933_0002127 3300035724 Bacteria 11380
367 Ga0373947_0001870 3300035725 Bacteria 12839
368 Ga0373937_0000890 3300036401 Bacteria 25608
369 Ga0373937_0082612 3300036401 Bacteria 2973
370 Ga0373937_0168898 3300036401 Bacteria 2052
371 Ga0373937_0181089 3300036401 Bacteria 1979
372 Ga0373925_0003038 3300037068 Bacteria 13202
373 Ga0395905_0084051 3300037471 Bacteria 2982
374 Ga0439464_0000253 3300042439 Bacteria 9897
375 Ga0451577_0069533 3300042876 Bacteria 3140
376 Ga0451576_0036780 3300045051 Bacteria 5187
377 Ga0451576_0095414 3300045051 Bacteria 3093
378 Ga0451576_0095769 3300045051 Bacteria 3087
379 Ga0495592_0043907 3300046454 Bacteria 3342
380 Ga0495592_0117470 3300046454 Bacteria 1875
381 Ga0495629_0060135 3300046459 Bacteria 2656
382 Ga0495638_0007003 3300046460 Bacteria 8132
383 Ga0495608_0004888 3300046511 Bacteria 9591
384 Ga0495628_0061847 3300046516 Bacteria 2936
385 Ga0495630_0000047 3300046517 Bacteria 98136
386 Ga0495630_0011908 3300046517 Bacteria 6305
387 Ga0495643_0004056 3300046522 Bacteria 10439
388 Ga0495640_0048488 3300046533 Bacteria 2935
389 Ga0495598_0005004 3300046537 Bacteria 2909
390 Ga0495645_0002418 3300046543 Bacteria 12674
391 Ga0495622_0009288 3300046557 Bacteria 4550
392 Ga0495647_0027496 3300046681 Bacteria 2091
393 Ga0495658_0024809 3300046683 Bacteria 3199
394 Ga0495669_0002576 3300046684 Bacteria 7409
395 Ga0495669_0041418 3300046684 Bacteria 2045
396 Ga0495613_0000270 3300046689 Bacteria 48533
397 Ga0495674_0041984 3300047319 Bacteria 4083
398 Ga0495676_0016670 3300047321 Bacteria 6508
399 Ga0495684_0000011 3300047471 Bacteria 195144
400 Ga0495684_0033805 3300047471 Bacteria 3923
401 Ga0496100_0047999 3300048903 Bacteria 2754
402 Ga0496102_0024493 3300048905 Bacteria 5366
403 Ga0496104_0008279 3300048907 Bacteria 9234
404 Ga0496104_0023865 3300048907 Bacteria 5625
405 Ga0496104_0095416 3300048907 Bacteria 2845
406 Ga0496107_0050387 3300048910 Bacteria 3002
407 Ga0496108_0018992 3300048911 Bacteria 5637
408 Ga0496108_0073758 3300048911 Bacteria 2881
409 Ga0496108_0089349 3300048911 Bacteria 2618
410 Ga0496109_0007165 3300048912 Bacteria 9423
411 Ga0496109_0086741 3300048912 Unclassified 2891
412 Ga0496110_0015343 3300048913 Bacteria 6374
413 Ga0496110_0070789 3300048913 Bacteria 3091
414 Ga0496111_0056400 3300048914 Bacteria 2842
415 Ga0496112_0004474 3300048915 Bacteria 11855
416 Ga0496112_0006367 3300048915 Bacteria 10363
417 Ga0496112_0012195 3300048915 Bacteria 7888
418 Ga0496112_0099357 3300048915 Unclassified 2880
419 Ga0496114_0002246 3300048917 Bacteria 14722
420 Ga0496114_0073341 3300048917 Bacteria 2880
421 Ga0496114_0086711 3300048917 Bacteria 2654
422 Ga0501031_0015518 3300049568 Bacteria 4944
423 Ga0501033_0001306 3300049570 Bacteria 22147
424 Ga0501034_0034614 3300049571 Bacteria 5121
425 Ga0501036_0016178 3300049572 Bacteria 6229
426 Ga0501036_0022441 3300049572 Bacteria 5309
427 Ga0501036_0077485 3300049572 Bacteria 2813
428 Ga0501037_0009067 3300049573 Bacteria 7291
429 Ga0501038_0036821 3300049574 Bacteria 4293
430 Ga0501039_0016223 3300049575 Bacteria 5708
431 Ga0501039_0021261 3300049575 Bacteria 4979
432 Ga0501040_0103854 3300049576 Bacteria 1984
433 Ga0501041_0016720 3300049577 Unclassified 4365
434 Ga0501041_0019543 3300049577 Bacteria 4046
435 Ga0501041_0044000 3300049577 Bacteria 2714
436 Ga0501042_0002311 3300049578 Bacteria 11660
437 Ga0501043_0056129 3300049579 Bacteria 3093
438 Ga0501046_0003480 3300049580 Bacteria 14440
439 Ga0501046_0078562 3300049580 Bacteria 2552
440 Ga0501047_0008112 3300049581 Bacteria 9908
441 Ga0501047_0053239 3300049581 Bacteria 3912
442 Ga0501048_0000268 3300049582 Bacteria 34914
443 Ga0501048_0010114 3300049582 Bacteria 7054
444 Ga0501048_0036509 3300049582 Unclassified 3532
445 Ga0501048_0065402 3300049582 Unclassified 2571
446 Ga0501067_0003301 3300049583 Bacteria 8875
447 Ga0501068_0026603 3300049584 Bacteria 3410
448 Ga0501069_0005187 3300049585 Bacteria 6769
449 Ga0501070_0012243 3300049586 Bacteria 7238
450 Ga0501070_0024809 3300049586 Bacteria 5028
451 Ga0501071_0001555 3300049587 Bacteria 13411
452 Ga0501071_0063059 3300049587 Unclassified 2687
453 Ga0501071_0101618 3300049587 Bacteria 2120
454 Ga0501072_0014625 3300049588 Bacteria 6016
455 Ga0501072_0038711 3300049588 Bacteria 3743
456 Ga0501072_0047361 3300049588 Bacteria 3386
457 Ga0501072_0071942 3300049588 Bacteria 2732
458 Ga0501072_0122532 3300049588 Bacteria 2071
459 Ga0501074_0002589 3300049590 Bacteria 12634
460 Ga0501074_0022181 3300049590 Bacteria 4613
461 Ga0501074_0113269 3300049590 Bacteria 1941
462 Ga0501075_0009479 3300049591 Bacteria 6814
463 Ga0501075_0102006 3300049591 Bacteria 2179
464 Ga0501076_0006081 3300049592 Bacteria 8729
465 Ga0501076_0042443 3300049592 Bacteria 3581
466 Ga0501076_0058753 3300049592 Bacteria 3057
467 Ga0501076_0104248 3300049592 Bacteria 2288
468 Ga0501077_0052770 3300049593 Bacteria 2581
469 Ga0501225_0017594 3300049705 Bacteria 1984
470 Ga0501079_0011981 3300049741 Bacteria 6619
471 Ga0501079_0015670 3300049741 Bacteria 5789
472 Ga0501079_0020666 3300049741 Bacteria 5032
473 Ga0501079_0044782 3300049741 Bacteria 3414
474 Ga0501079_0050377 3300049741 Bacteria 3214
475 Ga0501079_0055250 3300049741 Bacteria 3064
476 Ga0501079_0058484 3300049741 Bacteria 2974
477 Ga0501081_0014531 3300049743 Bacteria 5194
478 Ga0501083_0004400 3300049744 Bacteria 9930
479 Ga0501083_0060491 3300049744 Bacteria 2530
480 Ga0501035_0066668 3300049822 Bacteria 3194
481 Ga0501044_0005022 3300049823 Bacteria 14777
482 Ga0501044_0012388 3300049823 Bacteria 9231
483 Ga0501045_0025861 3300049824 Bacteria 4220
484 Ga0501045_0025887 3300049824 Bacteria 4218
485 Ga0501045_0109939 3300049824 Bacteria 2043
486 nmdc:mga05p37_1535_c1 3300050507 Bacteria 26839
487 nmdc:mga05p37_15615_c1 3300050507 Bacteria 9125
488 nmdc:mga05p37_20928_c1 3300050507 Bacteria 7917
489 nmdc:mga05p37_3461_c1 3300050507 Bacteria 18434
490 nmdc:mga05p37_3618_c1 3300050507 Bacteria 18067
491 nmdc:mga05p37_44425_c1 3300050507 Bacteria 5466
492 nmdc:mga05p37_447_c1 3300050507 Bacteria 44801
493 nmdc:mga05p37_5355_c1 3300050507 Bacteria 15081
494 nmdc:mga05p37_63363_c1 3300050507 Bacteria 4549
495 nmdc:mga05p37_644_c1 3300050507 Bacteria 38645
496 nmdc:mga05p37_7383_c1 3300050507 Bacteria 12965
497 nmdc:mga05p37_75970_c1 3300050507 Bacteria 4136
498 nmdc:mga05p37_864_c1 3300050507 Bacteria 34088
499 nmdc:mga05p37_9709_c1 3300050507 Bacteria 11411
500 nmdc:mga09592_14231_c1 3300050508 Bacteria 6494
501 nmdc:mga09592_184291_c1 3300050508 Bacteria 1806
502 nmdc:mga09592_70680_c1 3300050508 Unclassified 2962
503 nmdc:mga09592_79347_c1 3300050508 Bacteria 2794
504 nmdc:mga09592_84087_c1 3300050508 Unclassified 2713
505 nmdc:mga0qj67_11586_c1 3300050509 Bacteria 6613
506 nmdc:mga0qj67_17803_c1 3300050509 Bacteria 5405
507 nmdc:mga0qj67_2070_c1 3300050509 Bacteria 14319
508 nmdc:mga06r32_114681_c1 3300050510 Bacteria 2653
509 nmdc:mga06r32_160736_c1 3300050510 Unclassified 2229
510 nmdc:mga06r32_16920_c1 3300050510 Bacteria 6653
511 nmdc:mga06r32_21907_c1 3300050510 Bacteria 5900
512 nmdc:mga06r32_3246_c1 3300050510 Bacteria 14550
513 nmdc:mga06r32_4158_c1 3300050510 Bacteria 12964
514 nmdc:mga08y16_1387_c1 3300050511 Bacteria 24239
515 nmdc:mga08y16_13945_c1 3300050511 Bacteria 8460
516 nmdc:mga08y16_16848_c1 3300050511 Bacteria 7693
517 nmdc:mga08y16_17525_c1 3300050511 Bacteria 3703
518 nmdc:mga08y16_1842_c1 3300050511 Bacteria 21509
519 nmdc:mga08y16_25083_c1 3300050511 Bacteria 6289
520 nmdc:mga08y16_2625_c1 3300050511 Bacteria 18475
521 nmdc:mga08y16_4157_c1 3300050511 Bacteria 15109
522 nmdc:mga08y16_458_c1 3300050511 Bacteria 38004
523 nmdc:mga08y16_4781_c1 3300050511 Bacteria 14131
524 nmdc:mga08y16_5165_c1 3300050511 Bacteria 13634
525 nmdc:mga08y16_5832_c1 3300050511 Bacteria 12905
526 nmdc:mga08y16_77312_c1 3300050511 Bacteria 3470
527 nmdc:mga08y16_8286_c1 3300050511 Bacteria 10875
528 nmdc:mga08y16_8698_c1 3300050511 Bacteria 10647
529 nmdc:mga0n895_109657_c1 3300050512 Bacteria 2775
530 nmdc:mga0n895_4129_c1 3300050512 Bacteria 11838
531 nmdc:mga0n895_47145_c1 3300050512 Bacteria 4213
532 nmdc:mga0n895_59165_c1 3300050512 Bacteria 3781
533 nmdc:mga0n895_7444_c1 3300050512 Bacteria 9395
534 nmdc:mga0n895_8970_c1 3300050512 Bacteria 8718
535 nmdc:mga0n895_96187_c1 3300050512 Bacteria 2966
536 nmdc:mga0n895_96509_c1 3300050512 Bacteria 2961
537 nmdc:mga0rr50_24306_c1 3300050513 Bacteria 4195
538 nmdc:mga0rr50_27005_c1 3300050513 Bacteria 4014
539 nmdc:mga0rr50_34854_c1 3300050513 Bacteria 3608
540 nmdc:mga0rr50_44350_c1 3300050513 Bacteria 3261
541 nmdc:mga0rr50_507_c1 3300050513 Bacteria 20736
542 nmdc:mga08x19_11815_c1 3300050514 Bacteria 5254
543 nmdc:mga08x19_13275_c1 3300050514 Bacteria 4977
544 nmdc:mga08x19_68130_c1 3300050514 Bacteria 2316
545 nmdc:mga0a205_14112_c2 3300050515 Bacteria 4642
546 nmdc:mga0a205_1430_c1 3300050515 Bacteria 20297
547 nmdc:mga0a205_23219_c1 3300050515 Bacteria 5882
548 nmdc:mga0a205_384_c1 3300050515 Bacteria 33526
549 nmdc:mga0a205_41643_c1 3300050515 Bacteria 4424
550 nmdc:mga0a205_4241_c1 3300050515 Bacteria 12858
551 nmdc:mga0a205_609_c1 3300050515 Bacteria 28473
552 nmdc:mga0a205_6778_c1 3300050515 Bacteria 10358
553 Ga0495601_0011146 3300053077 Bacteria 5370
554 Ga0495601_0052829 3300053077 Bacteria 2567
555 Ga0495595_0031162 3300053084 Bacteria 2395
556 Ga0495619_0020158 3300053085 Bacteria 4244
557 Ga0495619_0041035 3300053085 Bacteria 3026
558 Ga0500641_0004099 3300053096 Bacteria 5147
559 Ga0501084_0041883 3300054114 Bacteria 3830
560 Ga0501084_0120384 3300054114 Bacteria 2207
561 Ga0590071_000006 3300059421 Bacteria 60899
562 Ga0590071_000312 3300059421 Bacteria 14170
563 Ga0590074_000522 3300059423 Bacteria 5734
564 Ga0590075_000110 3300059424 Bacteria 21193
565 Ga0590075_000335 3300059424 Bacteria 13095
566 Ga0590075_006549 3300059424 Bacteria 2760
567 Ga0590077_000034 3300059426 Bacteria 31653
568 Ga0590077_000957 3300059426 Bacteria 7362
569 Ga0501082_0020813 3300060353 Bacteria 5658
570 Ga0530510_0014151 3300061734 Bacteria 5624
571 Ga0530510_0022188 3300061734 Bacteria 4521
572 Ga0530510_0050902 3300061734 Unclassified 2992
573 Ga0496104_0116691
574 JGI25406J46586_10006003
575 Ga0065712_10067834
576 Ga0065712_10070961
577 Ga0065712_10074135
578 Ga0065712_10083486
579 Ga0065712_10084791
580 Ga0065715_10003600
581 Ga0065715_10110379
582 Ga0065715_10120661
583 Ga0065707_10087845
584 Ga0070676_10029831
585 Ga0070683_100027315
586 Ga0070690_100043879
587 Ga0070670_100022076
588 Ga0070670_100046348
589 Ga0070680_100026707
590 Ga0070689_100041143
591 Ga0070668_100033399
592 Ga0070669_100007867
593 Ga0070669_100039120
594 Ga0070675_100001943
595 Ga0070675_100007694
596 Ga0070671_100005817
597 Ga0070671_100035268
598 Ga0070674_100003306
599 Ga0070674_100016175
600 Ga0070673_100001036
601 Ga0070673_100001842
602 Ga0070673_100091726
603 Ga0070688_100004265
604 Ga0070688_100051000
605 Ga0070667_100107618
606 Ga0070703_10000065
607 Ga0070714_100028553
608 Ga0070713_100026100
609 Ga0070711_100021617
610 Ga0070705_100000071
611 Ga0070705_100005738
612 Ga0070700_100007372
613 Ga0070678_100024935
614 Ga0070681_10077374
615 Ga0070681_10187546
616 Ga0068867_100005323
617 Ga0070706_100000086
618 Ga0070707_100000244
619 Ga0070707_100060168
620 Ga0070707_100192256
621 Ga0070698_100009797
622 Ga0070698_100009874
623 Ga0070698_100045303
624 Ga0070699_100000018
625 Ga0070699_100005432
626 Ga0070679_100050253
627 Ga0070684_100054189
628 Ga0070672_100006328
629 Ga0070672_100012787
630 Ga0070672_100012933
631 Ga0070686_100004415
632 Ga0070686_100025408
633 Ga0070696_100000020
634 Ga0070665_100014808
635 Ga0070665_100134642
636 Ga0070704_100013288
637 Ga0070704_100013312
638 Ga0070704_100017850
639 Ga0070704_100053968
640 Ga0068855_100018152
641 Ga0070664_100008176
642 Ga0068857_100083409
643 Ga0068859_100045896
644 Ga0068859_100164064
645 Ga0068864_100019558
646 Ga0068864_100043218
647 Ga0068866_10011138
648 Ga0068863_100037641
649 Ga0068863_100045142
650 Ga0068858_100002099
651 Ga0068858_100037209
652 Ga0068862_100009264
653 Ga0081539_10000012
654 Ga0081539_10000291
655 Ga0081539_10003521
656 Ga0081539_10004484
657 Ga0081539_10012948
658 Ga0070715_10004427
659 Ga0097621_100004266
660 Ga0068871_100001623
661 Ga0068871_100007794
662 Ga0075428_100000338
663 Ga0075428_100000449
664 Ga0075428_100000862
665 Ga0075428_100001853
666 Ga0075428_100003401
667 Ga0075428_100004323
668 Ga0075428_100005671
669 Ga0075428_100005747
670 Ga0075428_100011882
671 Ga0075430_100000198
672 Ga0075430_100000794
673 Ga0075430_100001840
674 Ga0075430_100003909
675 Ga0075430_100004379
676 Ga0075430_100018975
677 Ga0075430_100022923
678 Ga0075430_100044272
679 Ga0075431_100013194
680 Ga0075431_100015158
681 Ga0075431_100025304
682 Ga0075431_100041005
683 Ga0075431_100056660
684 Ga0075431_100066822
685 Ga0075431_100117498
686 Ga0075431_100121021
687 Ga0075433_10000442
688 Ga0075433_10000818
689 Ga0075433_10001988
690 Ga0075433_10011585
691 Ga0075433_10013747
692 Ga0075433_10019644
693 Ga0075433_10066324
694 Ga0075433_10132687
695 Ga0075434_100002740
696 Ga0075434_100004387
697 Ga0075434_100007108
698 Ga0075434_100012231
699 Ga0075434_100012385
700 Ga0075434_100012956
701 Ga0075434_100030359
702 Ga0075434_100033325
703 Ga0075434_100107297
704 Ga0075429_100014842
705 Ga0075429_100014859
706 Ga0075429_100028028
707 Ga0075429_100077135
708 Ga0075429_100144355
709 Ga0068865_100118737
710 Ga0075436_100010793
711 Ga0075436_100014194
712 Ga0097620_100045896
713 Ga0097620_100164055
714 Ga0075435_100000663
715 Ga0075435_100001449
716 Ga0075435_100009932
717 Ga0075435_100024677
718 Ga0075435_100031809
719 Ga0075435_100033383
720 Ga0105240_10003574
721 Ga0105240_10048072
722 Ga0105240_10050264
723 Ga0111539_10000212
724 Ga0111539_10000507
725 Ga0111539_10000966
726 Ga0111539_10001433
727 Ga0111539_10001470
728 Ga0111539_10001647
729 Ga0111539_10001692
730 Ga0111539_10003630
731 Ga0111539_10005873
732 Ga0111539_10042848
733 Ga0111539_10086836
734 Ga0111539_10105288
735 Ga0111539_10111657
736 Ga0111539_10197874
737 Ga0105245_10077646
738 Ga0105247_10010321
739 Ga0105247_10016050
740 Ga0114129_10000047
741 Ga0114129_10000380
742 Ga0114129_10001294
743 Ga0114129_10001635
744 Ga0114129_10002141
745 Ga0114129_10002569
746 Ga0114129_10002715
747 Ga0114129_10006090
748 Ga0114129_10006886
749 Ga0114129_10007729
750 Ga0114129_10009873
751 Ga0114129_10010372
752 Ga0114129_10012425
753 Ga0114129_10013435
754 Ga0114129_10017722
755 Ga0114129_10021764
756 Ga0114129_10042291
757 Ga0114129_10052607
758 Ga0114129_10102026
759 Ga0114129_10130723
760 Ga0114129_10286478
761 Ga0105243_10020845
762 Ga0105243_10091086
763 Ga0105242_10009175
764 Ga0105248_10009460
765 Ga0105248_10041719
766 Ga0105248_10066873
767 Ga0105248_10095695
768 Ga0105248_10102051
769 Ga0105249_10001101
770 Ga0105249_10140333
771 Ga0105239_10259406
772 Ga0105246_10103421
773 Ga0157374_10121757
774 Ga0157378_10002161
775 Ga0163162_10028660
776 Ga0157375_10020574
777 Ga0163163_10000071
778 Ga0163163_10030907
779 Ga0163163_10046828
780 Ga0157380_10002810
781 Ga0157380_10044828
782 Ga0157380_10055722
783 Ga0157380_10081946
784 Ga0157379_10012534
785 Ga0157379_10034238
786 Ga0157379_10055938
787 Ga0157376_10026098
788 Ga0157376_10030360
789 Ga0157376_10035023
790 Ga0157376_10043469
791 Ga0157376_10078627
792 Ga0207697_10000485
793 Ga0207653_10000096
794 Ga0207710_10014029
795 Ga0207688_10002387
796 Ga0207645_10001127
797 Ga0207684_10000214
798 Ga0207695_10134492
799 Ga0207695_10153111
800 Ga0207652_10016546
801 Ga0207646_10000044
802 Ga0207646_10045858
803 Ga0207681_10007785
804 Ga0207681_10038058
805 Ga0207681_10075437
806 Ga0207681_10089107
807 Ga0207650_10006782
808 Ga0207650_10011073
809 Ga0207650_10058831
810 Ga0207650_10128655
811 Ga0207659_10000233
812 Ga0207659_10035946
813 Ga0207659_10134199
814 Ga0207644_10054122
815 Ga0207706_10028564
816 Ga0207706_10044472
817 Ga0207706_10049389
818 Ga0207686_10009800
819 Ga0207686_10033815
820 Ga0207709_10027994
821 Ga0207669_10023434
822 Ga0207669_10038340
823 Ga0207669_10040774
824 Ga0207704_10054147
825 Ga0207691_10002703
826 Ga0207691_10013635
827 Ga0207691_10014343
828 Ga0207691_10034365
829 Ga0207711_10007457
830 Ga0207711_10029586
831 Ga0207711_10031617
832 Ga0207689_10025644
833 Ga0207689_10040565
834 Ga0207661_10049469
835 Ga0207661_10071846
836 Ga0207679_10015790
837 Ga0207679_10069847
838 Ga0207651_10004511
839 Ga0207712_10005151
840 Ga0207677_10004307
841 Ga0207703_10014081
842 Ga0207703_10016206
843 Ga0207639_10051427
844 Ga0207678_10053760
845 Ga0207708_10001748
846 Ga0207708_10093836
847 Ga0207708_10103242
848 Ga0207641_10007307
849 Ga0207648_10009704
850 Ga0207648_10033283
851 Ga0207676_10004468
852 Ga0207676_10028822
853 Ga0207676_10065048
854 Ga0207683_10008828
855 Ga0207683_10029283
856 Ga0207428_10000319
857 Ga0207428_10001054
858 Ga0207428_10003312
859 Ga0207428_10003762
860 Ga0207428_10004918
861 Ga0207428_10008335
862 Ga0207428_10019413
863 Ga0207428_10062305
864 Ga0268266_10010862
865 Ga0268266_10045733
866 Ga0268266_10084127
867 Ga0268266_10134568
868 Ga0268265_10050252
869 Ga0265337_1000067
870 Ga0265326_10012010
871 Ga0265323_10000052
872 Ga0265338_10000025
873 Ga0265338_10000242
874 Ga0265338_10001160
875 Ga0265338_10003083
876 Ga0265338_10004415
877 Ga0265338_10005104
878 Ga0265338_10006692
879 Ga0265338_10007193
880 Ga0265338_10008324
881 Ga0265338_10058596
882 Ga0265320_10001039
883 Ga0265320_10041859
884 Ga0265325_10033388
885 Ga0265339_10000229
886 Ga0265316_10002363
887 Ga0265316_10030185
888 Ga0265316_10038666
889 Ga0265316_10039455
890 Ga0307408_100028322
891 Ga0307408_100032895
892 Ga0265314_10009026
893 Ga0265314_10036671
894 Ga0265314_10074054
895 Ga0265342_10024332
896 Ga0265342_10053584
897 Ga0307405_10013542
898 Ga0307405_10038322
899 Ga0307413_10009556
900 Ga0307413_10014570
901 Ga0307413_10020308
902 Ga0307410_10062226
903 Ga0307406_10003443
904 Ga0307407_10000594
905 Ga0307407_10002881
906 Ga0307412_10020749
907 Ga0307412_10023293
908 Ga0307412_10025416
909 Ga0307412_10036481
910 Ga0307409_100004132
911 Ga0307409_100015410
912 Ga0307409_100027340
913 Ga0307416_100001749
914 Ga0307416_100005239
915 Ga0307416_100017193
916 Ga0307416_100020772
917 Ga0307416_100057242
918 Ga0307411_10004812
919 Ga0307411_10062730
920 Ga0307411_10076571
921 Ga0307415_100000792
922 Ga0373959_0000634
923 Ga0373938_0001200
924 Ga0373929_0000935
925 Ga0373940_0000767
926 Ga0373952_0000240
927 Ga0373932_0001010
928 Ga0373939_0000888
929 Ga0373941_0000212
930 Ga0373956_0002802
931 Ga0373943_0002350
932 Ga0373955_0008388
933 Ga0373955_0017927
934 Ga0373942_0001017
935 Ga0373962_0001423
936 Ga0373924_0005537
937 Ga0373931_0000515
938 Ga0373933_0002127
939 Ga0373947_0001870
940 Ga0373937_0000890
941 Ga0373937_0082612
942 Ga0373937_0168898
943 Ga0373937_0181089
944 Ga0373925_0003038
945 Ga0395905_0084051
946 Ga0439464_0000253
947 Ga0451577_0069533
948 Ga0451576_0036780
949 Ga0451576_0095414
950 Ga0451576_0095769
951 Ga0495592_0043907
952 Ga0495592_0117470
953 Ga0495629_0060135
954 Ga0495638_0007003
955 Ga0495608_0004888
956 Ga0495628_0061847
957 Ga0495630_0000047
958 Ga0495630_0011908
959 Ga0495643_0004056
960 Ga0495640_0048488
961 Ga0495598_0005004
962 Ga0495645_0002418
963 Ga0495622_0009288
964 Ga0495647_0027496
965 Ga0495658_0024809
966 Ga0495669_0002576
967 Ga0495669_0041418
968 Ga0495613_0000270
969 Ga0495674_0041984
970 Ga0495676_0016670
971 Ga0495684_0000011
972 Ga0495684_0033805
973 Ga0496100_0047999
974 Ga0496102_0024493
975 Ga0496104_0008279
976 Ga0496104_0023865
977 Ga0496104_0095416
978 Ga0496107_0050387
979 Ga0496108_0018992
980 Ga0496108_0073758
981 Ga0496108_0089349
982 Ga0496109_0007165
983 Ga0496109_0086741
984 Ga0496110_0015343
985 Ga0496110_0070789
986 Ga0496111_0056400
987 Ga0496112_0004474
988 Ga0496112_0006367
989 Ga0496112_0012195
990 Ga0496112_0099357
991 Ga0496114_0002246
992 Ga0496114_0073341
993 Ga0496114_0086711
994 Ga0501031_0015518
995 Ga0501033_0001306
996 Ga0501034_0034614
997 Ga0501036_0016178
998 Ga0501036_0022441
999 Ga0501036_0077485
1000 Ga0501037_0009067
1001 Ga0501038_0036821
1002 Ga0501039_0016223
1003 Ga0501039_0021261
1004 Ga0501040_0103854
1005 Ga0501041_0016720
1006 Ga0501041_0019543
1007 Ga0501041_0044000
1008 Ga0501042_0002311
1009 Ga0501043_0056129
1010 Ga0501046_0003480
1011 Ga0501046_0078562
1012 Ga0501047_0008112
1013 Ga0501047_0053239
1014 Ga0501048_0000268
1015 Ga0501048_0010114
1016 Ga0501048_0036509
1017 Ga0501048_0065402
1018 Ga0501067_0003301
1019 Ga0501068_0026603
1020 Ga0501069_0005187
1021 Ga0501070_0012243
1022 Ga0501070_0024809
1023 Ga0501071_0001555
1024 Ga0501071_0063059
1025 Ga0501071_0101618
1026 Ga0501072_0014625
1027 Ga0501072_0038711
1028 Ga0501072_0047361
1029 Ga0501072_0071942
1030 Ga0501072_0122532
1031 Ga0501074_0002589
1032 Ga0501074_0022181
1033 Ga0501074_0113269
1034 Ga0501075_0009479
1035 Ga0501075_0102006
1036 Ga0501076_0006081
1037 Ga0501076_0042443
1038 Ga0501076_0058753
1039 Ga0501076_0104248
1040 Ga0501077_0052770
1041 Ga0501225_0017594
1042 Ga0501079_0011981
1043 Ga0501079_0015670
1044 Ga0501079_0020666
1045 Ga0501079_0044782
1046 Ga0501079_0050377
1047 Ga0501079_0055250
1048 Ga0501079_0058484
1049 Ga0501081_0014531
1050 Ga0501083_0004400
1051 Ga0501083_0060491
1052 Ga0501035_0066668
1053 Ga0501044_0005022
1054 Ga0501044_0012388
1055 Ga0501045_0025861
1056 Ga0501045_0025887
1057 Ga0501045_0109939
1058 nmdc:mga05p37_1535_c1
1059 nmdc:mga05p37_15615_c1
1060 nmdc:mga05p37_20928_c1
1061 nmdc:mga05p37_3461_c1
1062 nmdc:mga05p37_3618_c1
1063 nmdc:mga05p37_44425_c1
1064 nmdc:mga05p37_447_c1
1065 nmdc:mga05p37_5355_c1
1066 nmdc:mga05p37_63363_c1
1067 nmdc:mga05p37_644_c1
1068 nmdc:mga05p37_7383_c1
1069 nmdc:mga05p37_75970_c1
1070 nmdc:mga05p37_864_c1
1071 nmdc:mga05p37_9709_c1
1072 nmdc:mga09592_14231_c1
1073 nmdc:mga09592_184291_c1
1074 nmdc:mga09592_70680_c1
1075 nmdc:mga09592_79347_c1
1076 nmdc:mga09592_84087_c1
1077 nmdc:mga0qj67_11586_c1
1078 nmdc:mga0qj67_17803_c1
1079 nmdc:mga0qj67_2070_c1
1080 nmdc:mga06r32_114681_c1
1081 nmdc:mga06r32_160736_c1
1082 nmdc:mga06r32_16920_c1
1083 nmdc:mga06r32_21907_c1
1084 nmdc:mga06r32_3246_c1
1085 nmdc:mga06r32_4158_c1
1086 nmdc:mga08y16_1387_c1
1087 nmdc:mga08y16_13945_c1
1088 nmdc:mga08y16_16848_c1
1089 nmdc:mga08y16_17525_c1
1090 nmdc:mga08y16_1842_c1
1091 nmdc:mga08y16_25083_c1
1092 nmdc:mga08y16_2625_c1
1093 nmdc:mga08y16_4157_c1
1094 nmdc:mga08y16_458_c1
1095 nmdc:mga08y16_4781_c1
1096 nmdc:mga08y16_5165_c1
1097 nmdc:mga08y16_5832_c1
1098 nmdc:mga08y16_77312_c1
1099 nmdc:mga08y16_8286_c1
1100 nmdc:mga08y16_8698_c1
1101 nmdc:mga0n895_109657_c1
1102 nmdc:mga0n895_4129_c1
1103 nmdc:mga0n895_47145_c1
1104 nmdc:mga0n895_59165_c1
1105 nmdc:mga0n895_7444_c1
1106 nmdc:mga0n895_8970_c1
1107 nmdc:mga0n895_96187_c1
1108 nmdc:mga0n895_96509_c1
1109 nmdc:mga0rr50_24306_c1
1110 nmdc:mga0rr50_27005_c1
1111 nmdc:mga0rr50_34854_c1
1112 nmdc:mga0rr50_44350_c1
1113 nmdc:mga0rr50_507_c1
1114 nmdc:mga08x19_11815_c1
1115 nmdc:mga08x19_13275_c1
1116 nmdc:mga08x19_68130_c1
1117 nmdc:mga0a205_14112_c2
1118 nmdc:mga0a205_1430_c1
1119 nmdc:mga0a205_23219_c1
1120 nmdc:mga0a205_384_c1
1121 nmdc:mga0a205_41643_c1
1122 nmdc:mga0a205_4241_c1
1123 nmdc:mga0a205_609_c1
1124 nmdc:mga0a205_6778_c1
1125 Ga0495601_0011146
1126 Ga0495601_0052829
1127 Ga0495595_0031162
1128 Ga0495619_0020158
1129 Ga0495619_0041035
1130 Ga0500641_0004099
1131 Ga0501084_0041883
1132 Ga0501084_0120384
1133 Ga0590071_000006
1134 Ga0590071_000312
1135 Ga0590074_000522
1136 Ga0590075_000110
1137 Ga0590075_000335
1138 Ga0590075_006549
1139 Ga0590077_000034
1140 Ga0590077_000957
1141 Ga0501082_0020813
1142 Ga0530510_0014151
1143 Ga0530510_0022188
1144 Ga0530510_0050902

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02779

Transket_pyr

Transketolase, pyrimidine binding domain

319

484

0.98

PF00456

Transketolase_N

Transketolase, thiamine diphosphate binding domain

11

278

0.92

PF02780

Transketolase_C

Transketolase, C-terminal domain

495

616

0.91

PF00676

E1_dh

Dehydrogenase E1 component

100

254

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3ooy-assembly1.cif.gz_A crystal structure of human transketolase (tkt) 0.9671 5 610
6rjb-assembly1.cif.gz_A human transketolase variant t382e 0.9663 5 610
4kxw-assembly1.cif.gz_A human transketolase in covalent complex with donor ketose d-xylulose-5-phosphate, crystal 2 0.9631 5 610
6ha3-assembly1.cif.gz_A human transketolase variant e160q in covalent complex with donor ketose d-fructose-6-phosphate 0.9626 5 610
6yak-assembly1.cif.gz_CCC split gene transketolase, active alpha2beta2 heterotetramer 0.9607 11 276
ID Description Score Start End Superfamily
af_Q6PHI8_1_298_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9737 5 286 3.40.50.970
af_P29401_490_623_3.40.50.920 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9721 483 610 3.40.50.920
af_D3ZHE7_301_494_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9688 292 482 3.40.50.970
af_Q58092_3_181_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9596 307 474 3.40.50.970
af_Q58094_1_274_3.40.50.970 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Thiamin diphosphate (ThDP)-binding fold, Pyr/PP domains 0.9588 12 275 3.40.50.970
ID Description Score Start End GO Terms
AF-A0A7V9SK34-F1-model_v4 Transketolase 0.9905 511 611 GO:0004802
GO:0030976
AF-Q8ND81-F1-model_v4 transketolase (EC 2.2.1.1) 0.9876 426 609 GO:0003824
AF-A0A382WRW9-F1-model_v4 Transketolase N-terminal domain-containing protein 0.987 22 216 GO:0004802
GO:0030976
AF-A0A7C5I2T3-F1-model_v4 Transketolase 0.9859 7 271 GO:0004802
GO:0030976
GO:0046872
AF-A0A7X9K0P4-F1-model_v4 deleted 0.9853 11 176

Map