F465111

General Info

Members Datasets Scaffolds Average Seq Length
572 349 480 457

Family's Representative Sequence

Representative Sequence 3300046518|Ga0495631_0021118|Ga0495631_0021118_637_2073
Length 478
Sequence VLRQGFPSLDRPLYRLAMKTLVDPSNALAQGLATVRSQFKVPAAFPPNVLAAADAAAKRVPTEHVDRTAVPFVTLDPATSTDLDQAFAIEAAGSDLLLRYAIADVAWFVDDGDAIDLEAWTRGTTLYLPDGKAGLYPPVLAEGAASLLPDGPRPAIIFTVRVAPDGSVKLDGAERALILSRTKLAYDSVRDSDLPPDFAELARRIIAAEDARGASRVDPPEQEVSEQADGTFDLHFRPRLEAEDRNAAMSLATNLAIADALQAHHTGLFRVMPAPDDRAILRLRNTARALKLDWPAAVALKDYEKGLDPNDPRQAAFMLAIRRAGGGASYQPYRDGVVPWHAPMAATYAQATAPLRRLADRYVVRATLAIANGQPAPDVVVQAFEKLPGVMAHADAIGGQIDRAVIDLGEAVMLKDRVGEIFGAVVTDLDDRGARIQLSDLPVVARVDAHGVEPGDTIRVRLATADPEHRAISFARVN

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
4 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
5 2512875024 Mesorhizobium loti R88b Isolate Nodule
6 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
7 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
8 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
9 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
10 2599185354 Sphingomonas sp. NFR15 Isolate Rhizoplane
11 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
12 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
13 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
14 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
15 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
16 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
17 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
18 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
19 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
20 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
21 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
22 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
23 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
24 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
25 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
26 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
27 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
28 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
29 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
30 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
31 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
32 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
33 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
34 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
35 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
36 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
37 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
38 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
39 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
40 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
41 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
42 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
43 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
44 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
45 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
46 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
47 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
48 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
49 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
50 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
51 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
52 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
53 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
54 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
55 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
56 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
57 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
58 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
59 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
60 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
61 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
62 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
63 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
64 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
65 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
66 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
67 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
68 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
69 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
70 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
71 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
72 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
73 2977971508 Mesorhizobium sp. M2A.F.Ca.ET.039.01.1.1 Isolate Nodule
74 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
75 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
76 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
77 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
78 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
79 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
80 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
81 3004167301 Mesorhizobium loti 582 Isolate Unclassified
82 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
83 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
84 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
85 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
86 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
87 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
88 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
89 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
90 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
91 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
92 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
93 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
94 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
95 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
96 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
97 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
98 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
99 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
100 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
101 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
102 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
103 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
104 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
105 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
106 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
107 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
108 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
109 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
110 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
111 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
112 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
113 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
114 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
115 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
116 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
117 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
118 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
119 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
120 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
121 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
122 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
123 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
124 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
125 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
126 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
129 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
130 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
131 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
132 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
133 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
134 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
135 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
136 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
137 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
138 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
139 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
140 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
141 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
142 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
143 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
144 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
147 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
148 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
149 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
150 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
151 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
152 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
153 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
155 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
156 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
157 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
158 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
159 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
160 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
161 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
162 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
163 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
164 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
165 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
166 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
167 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
168 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
169 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
170 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
171 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
172 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
173 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
174 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
175 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
176 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
177 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
178 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
179 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
180 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
181 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
182 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
183 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
184 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
186 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
187 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
188 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
189 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
190 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
191 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
192 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
194 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
195 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
196 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
197 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
198 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
199 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
239 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
246 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
248 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
249 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
250 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
251 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
252 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
253 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
254 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
255 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
256 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
257 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
258 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
259 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
260 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
261 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
262 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
263 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
264 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
267 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
268 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
269 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
270 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
275 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
276 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
277 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
278 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
281 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
284 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
285 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
286 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
287 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
288 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
289 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
290 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
291 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
292 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
293 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
294 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
297 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
298 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
299 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
300 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
301 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
302 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
303 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
304 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
305 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
306 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
307 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
308 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
309 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
310 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
311 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
312 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
313 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
314 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
315 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
316 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
317 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
318 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
319 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
321 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
322 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
323 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
324 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
325 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
328 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
329 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
330 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
331 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
332 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
335 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
336 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
337 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
338 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
339 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
340 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
341 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
342 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
343 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
344 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
345 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
346 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
347 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
348 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
349 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.92
Metatranscriptomes 0
Isolates 16.08

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.76
Nodule 12.06
Rhizoplane 3.85
Rhizosphere 63.29
Stem 0
Stem Tuber 0
Unclassified 8.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1000861 3300001915 Bacteria 9153
2 JGI24752J21851_1000133 3300001976 Bacteria 10158
3 JGI24740J21852_10001217 3300001979 Bacteria 11646
4 JGI24739J22299_10009466 3300001989 Bacteria 3631
5 JGI24737J22298_10002594 3300001990 Bacteria 6400
6 JGI24737J22298_10006050 3300001990 Bacteria 4150
7 JGI24735J21928_10000508 3300002067 Bacteria 13774
8 JGI24735J21928_10003821 3300002067 Bacteria 5100
9 JGI24735J21928_10004413 3300002067 Unclassified 4734
10 JGI24735J21928_10004630 3300002067 Bacteria 4604
11 JGI24735J21928_10014952 3300002067 Bacteria 2425
12 JGI24735J21928_10020489 3300002067 Bacteria 2025
13 JGI24735J21928_10025720 3300002067 Bacteria 1775
14 JGI24738J21930_10001125 3300002075 Bacteria 7561
15 JGI24738J21930_10001127 3300002075 Bacteria 7552
16 JGI24744J21845_10007656 3300002077 Bacteria 2232
17 JGI25157J39369_1001188 3300002741 Bacteria 11043
18 JGI25165J46597_1000032 3300003214 Bacteria 294371
19 JGI25165J46597_1000192 3300003214 Bacteria 91136
20 JGI25165J46597_1000289 3300003214 Bacteria 63916
21 JGI25153J46596_10000006 3300003215 Bacteria 447760
22 JGI25153J46596_10005615 3300003215 Bacteria 6557
23 rootH2_10100697 3300003320 Bacteria 1945
24 Ga0055525_1000040 3300003759 Bacteria 286933
25 Ga0055542_1000612 3300003762 Bacteria 30367
26 Ga0055542_1000650 3300003762 Bacteria 28683
27 Ga0055529_1000007 3300003763 Bacteria 403604
28 Ga0055526_1006177 3300003771 Bacteria 6589
29 Ga0055537_1000161 3300003773 Bacteria 50226
30 Ga0055524_1000110 3300003775 Bacteria 99255
31 Ga0065165_1003008 3300005262 Bacteria 12748
32 Ga0065165_1023131 3300005262 Bacteria 2114
33 Ga0070658_10000791 3300005327 Bacteria 27107
34 Ga0070658_10020415 3300005327 Bacteria 5309
35 Ga0070658_10031935 3300005327 Bacteria 4232
36 Ga0070676_10000537 3300005328 Bacteria 18319
37 Ga0070670_100000047 3300005331 Bacteria 136625
38 Ga0070677_10000498 3300005333 Bacteria 13530
39 Ga0068869_100000246 3300005334 Bacteria 28654
40 Ga0068868_100002777 3300005338 Bacteria 12127
41 Ga0068868_100037849 3300005338 Bacteria 3742
42 Ga0070660_100000066 3300005339 Bacteria 61587
43 Ga0070660_100003530 3300005339 Bacteria 10785
44 Ga0070661_100011445 3300005344 Bacteria 6180
45 Ga0070668_100000240 3300005347 Bacteria 36015
46 Ga0070668_100004002 3300005347 Bacteria 10907
47 Ga0070669_100000162 3300005353 Bacteria 58781
48 Ga0070675_100008502 3300005354 Bacteria 7968
49 Ga0070671_100007595 3300005355 Bacteria 8670
50 Ga0070671_100009144 3300005355 Bacteria 7954
51 Ga0070674_100000259 3300005356 Bacteria 26306
52 Ga0070674_100002476 3300005356 Bacteria 10222
53 Ga0070673_100000010 3300005364 Bacteria 153851
54 Ga0070659_100082745 3300005366 Bacteria 2564
55 Ga0070667_100007692 3300005367 Bacteria 8936
56 Ga0070667_100008853 3300005367 Bacteria 8332
57 Ga0070667_100013924 3300005367 Bacteria 6650
58 Ga0070663_100002188 3300005455 Bacteria 10923
59 Ga0070678_100000015 3300005456 Bacteria 53574
60 Ga0070678_100011223 3300005456 Bacteria 5516
61 Ga0070662_100063482 3300005457 Bacteria 2702
62 Ga0070662_100106832 3300005457 Bacteria 2127
63 Ga0068867_100000019 3300005459 Bacteria 97503
64 Ga0068867_100013035 3300005459 Bacteria 5883
65 Ga0068853_100007619 3300005539 Bacteria 8674
66 Ga0068853_100036886 3300005539 Bacteria 4158
67 Ga0070672_100027763 3300005543 Bacteria 4225
68 Ga0070672_100153247 3300005543 Bacteria 1908
69 Ga0070696_100002429 3300005546 Bacteria 12345
70 Ga0070665_100000044 3300005548 Bacteria 276702
71 Ga0070665_100001688 3300005548 Bacteria 25443
72 Ga0070665_100007138 3300005548 Bacteria 11360
73 Ga0068855_100000123 3300005563 Bacteria 97174
74 Ga0068855_100000739 3300005563 Bacteria 40147
75 Ga0068855_100012866 3300005563 Bacteria 10096
76 Ga0068855_100066816 3300005563 Bacteria 4191
77 Ga0068855_100081946 3300005563 Bacteria 3740
78 Ga0070664_100021508 3300005564 Bacteria 5317
79 Ga0070664_100043576 3300005564 Bacteria 3786
80 Ga0070664_100073868 3300005564 Plasmid 2926
81 Ga0068857_100013297 3300005577 Bacteria 7170
82 Ga0068857_100055975 3300005577 Bacteria 3499
83 Ga0068854_100000281 3300005578 Bacteria 34053
84 Ga0068856_100009906 3300005614 Bacteria 9256
85 Ga0068856_100011474 3300005614 Bacteria 8600
86 Ga0068856_100204012 3300005614 Bacteria 1992
87 Ga0068852_100001320 3300005616 Bacteria 16608
88 Ga0068852_100227715 3300005616 Bacteria 1776
89 Ga0068859_100000221 3300005617 Bacteria 56589
90 Ga0068859_100011473 3300005617 Bacteria 8908
91 Ga0068859_100045656 3300005617 Bacteria 4401
92 Ga0068864_100000051 3300005618 Bacteria 136621
93 Ga0068864_100000249 3300005618 Bacteria 48024
94 Ga0068864_100000721 3300005618 Bacteria 27640
95 Ga0068864_100108609 3300005618 Bacteria 2469
96 Ga0068864_100133723 3300005618 Bacteria 2231
97 Ga0068866_10093046 3300005718 Bacteria 1646
98 Ga0068861_100000036 3300005719 Bacteria 60355
99 Ga0068861_100045590 3300005719 Bacteria 3302
100 Ga0068863_100000001 3300005841 Bacteria 581116
101 Ga0068863_100001380 3300005841 Bacteria 24090
102 Ga0068863_100001426 3300005841 Bacteria 23685
103 Ga0068863_100001640 3300005841 Bacteria 22143
104 Ga0068863_100001823 3300005841 Bacteria 21161
105 Ga0068858_100000919 3300005842 Bacteria 30552
106 Ga0068858_100001556 3300005842 Bacteria 23523
107 Ga0068858_100032615 3300005842 Bacteria 4836
108 Ga0068860_100001066 3300005843 Bacteria 30262
109 Ga0068860_100019244 3300005843 Bacteria 6628
110 Ga0068860_100047482 3300005843 Bacteria 4092
111 Ga0068862_100000032 3300005844 Bacteria 179887
112 Ga0068862_100000036 3300005844 Bacteria 173453
113 Ga0068862_100014225 3300005844 Bacteria 6598
114 Ga0068862_100026331 3300005844 Bacteria 4888
115 Ga0075365_10006923 3300006038 Bacteria 6296
116 Ga0075368_10016372 3300006042 Bacteria 2763
117 Ga0075363_100001571 3300006048 Bacteria 8766
118 Ga0075364_10026849 3300006051 Bacteria 3676
119 Ga0075362_10000026 3300006177 Bacteria 58544
120 Ga0075367_10012695 3300006178 Bacteria 4504
121 Ga0075369_10001071 3300006186 Bacteria 9180
122 Ga0075366_10001190 3300006195 Bacteria 12905
123 Ga0097621_100003147 3300006237 Bacteria 11329
124 Ga0075370_10000035 3300006353 Bacteria 42607
125 Ga0075370_10031223 3300006353 Bacteria 2974
126 Ga0068871_100002643 3300006358 Bacteria 12240
127 Ga0068871_100047090 3300006358 Bacteria 3476
128 Ga0075433_10034371 3300006852 Bacteria 4354
129 Ga0068865_100000058 3300006881 Bacteria 60005
130 Ga0097620_100000221 3300006931 Bacteria 56589
131 Ga0097620_100011473 3300006931 Bacteria 8908
132 Ga0097620_100045656 3300006931 Bacteria 4401
133 Ga0105250_10017629 3300009092 Bacteria 2901
134 Ga0105240_10015565 3300009093 Bacteria 10336
135 Ga0105240_10028946 3300009093 Bacteria 7226
136 Ga0105240_10065298 3300009093 Bacteria 4518
137 Ga0105240_10157160 3300009093 Bacteria 2703
138 Ga0105240_10357671 3300009093 Bacteria 1655
139 Ga0105245_10000908 3300009098 Bacteria 26913
140 Ga0105245_10002399 3300009098 Bacteria 16933
141 Ga0105243_10000296 3300009148 Bacteria 55065
142 Ga0105243_10000814 3300009148 Bacteria 29743
143 Ga0105241_10066520 3300009174 Bacteria 2787
144 Ga0105242_10000215 3300009176 Bacteria 45186
145 Ga0105248_10000407 3300009177 Bacteria 49981
146 Ga0105248_10000502 3300009177 Bacteria 44596
147 Ga0105237_10000550 3300009545 Bacteria 52627
148 Ga0105238_10144366 3300009551 Bacteria 2357
149 Ga0105249_10000017 3300009553 Bacteria 277115
150 Ga0105239_10000984 3300010375 Bacteria 39982
151 Ga0105239_10006948 3300010375 Bacteria 13051
152 Ga0105239_10061420 3300010375 Bacteria 4124
153 Ga0105239_10087536 3300010375 Bacteria 3434
154 Ga0105239_10144545 3300010375 Bacteria 2652
155 Ga0157373_10012273 3300013100 Bacteria 6299
156 Ga0157373_10148725 3300013100 Bacteria 1648
157 Ga0157371_10000024 3300013102 Bacteria 281202
158 Ga0157370_10000176 3300013104 Bacteria 79656
159 Ga0157374_10000714 3300013296 Bacteria 29089
160 Ga0157374_10020470 3300013296 Bacteria 5869
161 Ga0157374_10115630 3300013296 Bacteria 2584
162 Ga0157378_10001057 3300013297 Bacteria 25216
163 Ga0157378_10148719 3300013297 Bacteria 2181
164 Ga0163162_10009196 3300013306 Bacteria 9618
165 Ga0163162_10037041 3300013306 Bacteria 4865
166 Ga0157372_10011269 3300013307 Bacteria 9510
167 Ga0157372_10109684 3300013307 Bacteria 3161
168 Ga0157372_10165668 3300013307 Bacteria 2556
169 Ga0157375_10000769 3300013308 Bacteria 28108
170 Ga0163163_10000164 3300014325 Bacteria 69244
171 Ga0163163_10016577 3300014325 Bacteria 6852
172 Ga0157380_10000332 3300014326 Bacteria 28459
173 Ga0182008_10013862 3300014497 Bacteria 4232
174 Ga0182008_10014593 3300014497 Bacteria 4109
175 Ga0157379_10007033 3300014968 Bacteria 9724
176 Ga0157379_10008896 3300014968 Bacteria 8753
177 Ga0157376_10000061 3300014969 Bacteria 91247
178 Ga0163161_10024315 3300017792 Bacteria 4279
179 Ga0209563_100019 3300025230 Bacteria 697828
180 Ga0207427_100436 3300025231 Bacteria 23280
181 Ga0209437_101995 3300025233 Bacteria 4193
182 Ga0209026_1000002 3300025250 Bacteria 1136158
183 Ga0209026_1001628 3300025250 Bacteria 9553
184 Ga0209148_1000026 3300025254 Bacteria 629213
185 Ga0209148_1000038 3300025254 Bacteria 493744
186 Ga0209148_1000114 3300025254 Bacteria 192073
187 Ga0209759_1000062 3300025256 Bacteria 197996
188 Ga0209233_1000027 3300025261 Bacteria 652089
189 Ga0209233_1000066 3300025261 Bacteria 381218
190 Ga0209233_1000291 3300025261 Bacteria 64111
191 Ga0209233_1012367 3300025261 Bacteria 2478
192 Ga0209565_1000030 3300025263 Bacteria 325058
193 Ga0209565_1000298 3300025263 Bacteria 47155
194 Ga0209455_1000005 3300025272 Bacteria 1416756
195 Ga0209455_1000068 3300025272 Bacteria 310024
196 Ga0209673_1000925 3300025273 Bacteria 37051
197 Ga0209673_1005559 3300025273 Bacteria 6305
198 Ga0209564_1006748 3300025295 Bacteria 6090
199 Ga0209564_1007375 3300025295 Bacteria 5693
200 Ga0209758_1000001 3300025297 Bacteria 1981790
201 Ga0209758_1004317 3300025297 Bacteria 11964
202 Ga0209758_1005567 3300025297 Bacteria 9592
203 Ga0209758_1042527 3300025297 Bacteria 1684
204 Ga0209050_1003559 3300025298 Bacteria 11340
205 Ga0209050_1005259 3300025298 Bacteria 8245
206 Ga0209256_1000046 3300025299 Bacteria 325040
207 Ga0209257_1001591 3300025304 Bacteria 26038
208 Ga0207656_10002429 3300025321 Bacteria 6275
209 Ga0207656_10015810 3300025321 Bacteria 2927
210 Ga0207682_10000763 3300025893 Bacteria 14850
211 Ga0207688_10033187 3300025901 Bacteria 2854
212 Ga0207647_10000068 3300025904 Bacteria 81240
213 Ga0207647_10007855 3300025904 Bacteria 7674
214 Ga0207647_10014244 3300025904 Bacteria 5487
215 Ga0207647_10032876 3300025904 Bacteria 3327
216 Ga0207705_10000254 3300025909 Bacteria 52174
217 Ga0207705_10000776 3300025909 Bacteria 26275
218 Ga0207654_10004795 3300025911 Bacteria 6848
219 Ga0207654_10055574 3300025911 Bacteria 2292
220 Ga0207695_10013440 3300025913 Bacteria 9765
221 Ga0207695_10040469 3300025913 Bacteria 4996
222 Ga0207695_10048707 3300025913 Bacteria 4474
223 Ga0207671_10001471 3300025914 Bacteria 27202
224 Ga0207671_10140213 3300025914 Bacteria 1862
225 Ga0207657_10001048 3300025919 Bacteria 29307
226 Ga0207657_10012108 3300025919 Bacteria 8524
227 Ga0207657_10050301 3300025919 Bacteria 3627
228 Ga0207649_10003686 3300025920 Bacteria 8361
229 Ga0207649_10035830 3300025920 Bacteria 2984
230 Ga0207652_10194872 3300025921 Bacteria 1823
231 Ga0207681_10000003 3300025923 Bacteria 713245
232 Ga0207694_10023954 3300025924 Bacteria 4636
233 Ga0207694_10127346 3300025924 Bacteria 2039
234 Ga0207694_10129285 3300025924 Bacteria 2024
235 Ga0207650_10000038 3300025925 Bacteria 206081
236 Ga0207659_10005419 3300025926 Bacteria 7732
237 Ga0207687_10000565 3300025927 Bacteria 24994
238 Ga0207687_10002266 3300025927 Bacteria 13102
239 Ga0207644_10000025 3300025931 Bacteria 152401
240 Ga0207644_10039060 3300025931 Bacteria 3348
241 Ga0207690_10001257 3300025932 Bacteria 16039
242 Ga0207690_10050082 3300025932 Bacteria 2787
243 Ga0207706_10064271 3300025933 Bacteria 3231
244 Ga0207686_10000358 3300025934 Bacteria 32571
245 Ga0207709_10000050 3300025935 Bacteria 234391
246 Ga0207709_10000179 3300025935 Bacteria 84625
247 Ga0207669_10000035 3300025937 Bacteria 81855
248 Ga0207669_10019274 3300025937 Bacteria 3548
249 Ga0207669_10040134 3300025937 Bacteria 2712
250 Ga0207704_10000051 3300025938 Bacteria 81152
251 Ga0207691_10196742 3300025940 Bacteria 1756
252 Ga0207711_10000042 3300025941 Bacteria 158782
253 Ga0207711_10000607 3300025941 Bacteria 36172
254 Ga0207689_10002014 3300025942 Bacteria 19203
255 Ga0207689_10011908 3300025942 Bacteria 7453
256 Ga0207679_10025927 3300025945 Bacteria 4037
257 Ga0207679_10102720 3300025945 Bacteria 2239
258 Ga0207679_10272355 3300025945 Unclassified 1448
259 Ga0207667_10000010 3300025949 Bacteria 477432
260 Ga0207667_10000167 3300025949 Bacteria 97188
261 Ga0207667_10000397 3300025949 Bacteria 58824
262 Ga0207667_10059862 3300025949 Bacteria 3987
263 Ga0207667_10068995 3300025949 Bacteria 3680
264 Ga0207667_10087401 3300025949 Bacteria 3224
265 Ga0207651_10000005 3300025960 Bacteria 246132
266 Ga0207651_10007712 3300025960 Bacteria 5753
267 Ga0207712_10000012 3300025961 Bacteria 392363
268 Ga0207668_10000111 3300025972 Bacteria 58689
269 Ga0207668_10000129 3300025972 Bacteria 53619
270 Ga0207668_10007638 3300025972 Bacteria 6436
271 Ga0207640_10000340 3300025981 Bacteria 30855
272 Ga0207640_10012239 3300025981 Bacteria 4883
273 Ga0207640_10035127 3300025981 Bacteria 3134
274 Ga0207658_10001592 3300025986 Bacteria 17502
275 Ga0207658_10001750 3300025986 Bacteria 16338
276 Ga0207658_10012454 3300025986 Bacteria 5810
277 Ga0207658_10012685 3300025986 Bacteria 5756
278 Ga0207677_10000128 3300026023 Bacteria 62112
279 Ga0207677_10022726 3300026023 Bacteria 3860
280 Ga0207703_10000187 3300026035 Bacteria 72699
281 Ga0207703_10002526 3300026035 Bacteria 15808
282 Ga0207703_10006187 3300026035 Bacteria 9579
283 Ga0207639_10000642 3300026041 Bacteria 24089
284 Ga0207639_10005746 3300026041 Bacteria 8400
285 Ga0207639_10046468 3300026041 Bacteria 3276
286 Ga0207678_10000685 3300026067 Bacteria 31000
287 Ga0207678_10009632 3300026067 Bacteria 8495
288 Ga0207702_10001521 3300026078 Bacteria 22939
289 Ga0207702_10005587 3300026078 Bacteria 10975
290 Ga0207702_10011029 3300026078 Bacteria 7541
291 Ga0207702_10067038 3300026078 Bacteria 3079
292 Ga0207702_10179285 3300026078 Bacteria 1950
293 Ga0207641_10000001 3300026088 Bacteria 1180841
294 Ga0207641_10000415 3300026088 Bacteria 49760
295 Ga0207641_10001271 3300026088 Bacteria 25108
296 Ga0207641_10001586 3300026088 Bacteria 22194
297 Ga0207648_10000068 3300026089 Bacteria 97469
298 Ga0207648_10014998 3300026089 Bacteria 7137
299 Ga0207676_10000034 3300026095 Bacteria 206058
300 Ga0207676_10000388 3300026095 Bacteria 37359
301 Ga0207676_10000456 3300026095 Bacteria 34458
302 Ga0207676_10017410 3300026095 Bacteria 5207
303 Ga0207676_10053626 3300026095 Bacteria 3156
304 Ga0207674_10001013 3300026116 Bacteria 36709
305 Ga0207674_10004383 3300026116 Bacteria 17012
306 Ga0207674_10020980 3300026116 Bacteria 7046
307 Ga0207674_10100406 3300026116 Bacteria 2875
308 Ga0207675_100000154 3300026118 Bacteria 60483
309 Ga0207675_100007062 3300026118 Bacteria 10611
310 Ga0207683_10000823 3300026121 Bacteria 28462
311 Ga0207683_10008251 3300026121 Bacteria 8908
312 Ga0207683_10072551 3300026121 Bacteria 3045
313 Ga0207698_10000373 3300026142 Bacteria 26175
314 Ga0268266_10000002 3300028379 Bacteria 3059047
315 Ga0268266_10000584 3300028379 Bacteria 50438
316 Ga0268266_10004591 3300028379 Bacteria 13183
317 Ga0268265_10000052 3300028380 Bacteria 174254
318 Ga0268265_10000081 3300028380 Bacteria 120869
319 Ga0268265_10007193 3300028380 Bacteria 7521
320 Ga0268265_10016584 3300028380 Bacteria 5064
321 Ga0268265_10044914 3300028380 Bacteria 3293
322 Ga0268264_10000710 3300028381 Bacteria 38345
323 Ga0268264_10000830 3300028381 Bacteria 33152
324 Ga0268264_10003045 3300028381 Bacteria 14529
325 Ga0268264_10028537 3300028381 Bacteria 4565
326 Ga0268264_10108618 3300028381 Bacteria 2426
327 Ga0307517_10032174 3300028786 Bacteria 6073
328 Ga0307517_10059337 3300028786 Bacteria 3666
329 Ga0307513_10094177 3300031456 Bacteria 3041
330 Ga0307513_10109136 3300031456 Bacteria 2765
331 Ga0307408_100031614 3300031548 Bacteria 3687
332 Ga0307408_100081696 3300031548 Bacteria 2417
333 Ga0307508_10002973 3300031616 Bacteria 17498
334 Ga0307405_10002901 3300031731 Bacteria 7722
335 Ga0307413_10002762 3300031824 Bacteria 7224
336 Ga0307413_10018437 3300031824 Bacteria 3662
337 Ga0307410_10010005 3300031852 Bacteria 5351
338 Ga0307410_10031488 3300031852 Bacteria 3404
339 Ga0307412_10056076 3300031911 Bacteria 2624
340 Ga0307409_100001293 3300031995 Bacteria 12132
341 Ga0307409_100005087 3300031995 Bacteria 7501
342 Ga0307409_100082379 3300031995 Bacteria 2604
343 Ga0307416_100016572 3300032002 Bacteria 5127
344 Ga0307414_10017063 3300032004 Bacteria 4433
345 Ga0307411_10050731 3300032005 Bacteria 2703
346 Ga0307415_100038644 3300032126 Bacteria 3147
347 Ga0307510_10007699 3300033180 Bacteria 12843
348 Ga0395899_0000863 3300037312 Bacteria 28863
349 Ga0395899_0004699 3300037312 Bacteria 10658
350 Ga0395900_0001809 3300037418 Bacteria 24476
351 Ga0395900_0016584 3300037418 Bacteria 7514
352 Ga0395900_0067360 3300037418 Bacteria 3678
353 Ga0395900_0158052 3300037418 Bacteria 2314
354 Ga0395900_0158862 3300037418 Bacteria 2307
355 Ga0395900_0285686 3300037418 Bacteria 1640
356 Ga0395898_0002594 3300037466 Bacteria 21113
357 Ga0395905_0004463 3300037471 Bacteria 14524
358 Ga0395905_0015623 3300037471 Bacteria 7214
359 Ga0395905_0017270 3300037471 Bacteria 6854
360 Ga0395905_0022926 3300037471 Bacteria 5900
361 Ga0395905_0094482 3300037471 Bacteria 2805
362 Ga0395901_0004659 3300038443 Bacteria 13826
363 Ga0395901_0220341 3300038443 Bacteria 1983
364 Ga0451802_0277189 3300041460 Bacteria 4241
365 Ga0439431_0018686 3300041997 Bacteria 1642
366 Ga0439458_0000758 3300042157 Bacteria 8268
367 Ga0439464_0000578 3300042439 Bacteria 7656
368 Ga0466972_0031235 3300044658 Bacteria 2620
369 Ga0466972_0041204 3300044658 Bacteria 2249
370 Ga0466963_0032859 3300044694 Bacteria 3363
371 Ga0466967_0066965 3300045976 Bacteria 3202
372 Ga0495638_0000714 3300046460 Bacteria 35808
373 Ga0495650_0000058 3300046471 Bacteria 302308
374 Ga0495650_0034907 3300046471 Bacteria 2219
375 Ga0495585_0008874 3300046492 Bacteria 6067
376 Ga0495596_0024572 3300046500 Bacteria 2439
377 Ga0495583_0000219 3300046506 Bacteria 96346
378 Ga0495583_0000286 3300046506 Bacteria 80417
379 Ga0495583_0001958 3300046506 Bacteria 18923
380 Ga0495583_0010965 3300046506 Bacteria 5232
381 Ga0495583_0037558 3300046506 Bacteria 2295
382 Ga0495606_0000916 3300046507 Bacteria 43642
383 Ga0495606_0024934 3300046507 Bacteria 4295
384 Ga0495631_0021118 3300046518 Bacteria 3034
385 Ga0495643_0010204 3300046522 Bacteria 5787
386 Ga0495648_0000108 3300046524 Bacteria 102335
387 Ga0495648_0047041 3300046524 Bacteria 2670
388 Ga0495633_0001093 3300046558 Bacteria 21900
389 Ga0495668_0000085 3300046616 Bacteria 153045
390 Ga0495668_0021008 3300046616 Bacteria 3749
391 Ga0495668_0036461 3300046616 Bacteria 2755
392 Ga0495611_0039343 3300046648 Bacteria 2105
393 Ga0495625_0001409 3300046660 Bacteria 29392
394 Ga0495625_0001893 3300046660 Bacteria 23672
395 Ga0495625_0009275 3300046660 Bacteria 8252
396 Ga0495625_0026954 3300046660 Bacteria 4333
397 Ga0495625_0036198 3300046660 Bacteria 3630
398 Ga0495625_0043269 3300046660 Bacteria 3267
399 Ga0495661_0042996 3300046665 Bacteria 2781
400 Ga0495669_0000099 3300046684 Bacteria 54004
401 Ga0495670_0000056 3300046691 Bacteria 55007
402 Ga0495670_0001772 3300046691 Bacteria 10610
403 Ga0495670_0027967 3300046691 Bacteria 2795
404 Ga0495600_0005871 3300046809 Bacteria 7426
405 Ga0495683_0009106 3300047323 Bacteria 5289
406 Ga0495683_0077830 3300047323 Bacteria 1621
407 Ga0495687_000251 3300047443 Bacteria 72743
408 Ga0495687_001580 3300047443 Bacteria 20632
409 Ga0495677_0002352 3300047445 Bacteria 7427
410 Ga0495677_0004446 3300047445 Bacteria 5384
411 Ga0495673_0025452 3300047469 Bacteria 2840
412 Ga0495681_0023470 3300047470 Bacteria 3275
413 Ga0495686_0000650 3300047472 Bacteria 47482
414 Ga0495686_0065721 3300047472 Bacteria 2242
415 Ga0496102_0005444 3300048905 Bacteria 10795
416 Ga0496102_0008248 3300048905 Bacteria 8921
417 Ga0496102_0146848 3300048905 Bacteria 2214
418 Ga0496102_0269544 3300048905 Bacteria 1605
419 Ga0496103_0001675 3300048906 Bacteria 14493
420 Ga0496103_0061281 3300048906 Bacteria 2339
421 Ga0496104_0064616 3300048907 Bacteria 3471
422 Ga0496105_0004106 3300048908 Bacteria 10913
423 Ga0496108_0001167 3300048911 Bacteria 20498
424 Ga0496109_0042296 3300048912 Bacteria 4126
425 Ga0496110_0062641 3300048913 Bacteria 3285
426 Ga0496110_0205933 3300048913 Bacteria 1788
427 Ga0496111_0136594 3300048914 Bacteria 1816
428 Ga0496112_0008520 3300048915 Bacteria 9187
429 Ga0496113_0043822 3300048916 Bacteria 3313
430 Ga0496113_0154464 3300048916 Bacteria 1812
431 Ga0496114_0005557 3300048917 Bacteria 9880
432 Ga0496115_0000129 3300048918 Bacteria 68502
433 Ga0496115_0055694 3300048918 Bacteria 3177
434 Ga0496116_0014258 3300048919 Bacteria 6357
435 Ga0496117_0004869 3300048920 Bacteria 14494
436 Ga0496118_0001014 3300048921 Bacteria 43665
437 Ga0496119_0030112 3300048922 Bacteria 3666
438 Ga0496119_0079550 3300048922 Bacteria 1893
439 Ga0496120_0071626 3300048923 Bacteria 1902
440 Ga0496121_0000335 3300048924 Bacteria 98310
441 Ga0496121_0000933 3300048924 Bacteria 52895
442 Ga0496121_0003394 3300048924 Bacteria 22787
443 Ga0496121_0035335 3300048924 Bacteria 4481
444 Ga0496122_0028685 3300048925 Bacteria 4714
445 Ga0496124_0005267 3300048927 Bacteria 14636
446 Ga0496125_0001642 3300048928 Bacteria 31516
447 Ga0496125_0095816 3300048928 Bacteria 2206
448 Ga0496125_0103916 3300048928 Bacteria 2083
449 Ga0496126_0000578 3300048929 Bacteria 70012
450 Ga0495682_0008237 3300049460 Bacteria 4116
451 Ga0501034_0046570 3300049571 Bacteria 4381
452 Ga0501038_0136832 3300049574 Bacteria 2006
453 Ga0501076_0075560 3300049592 Bacteria 2701
454 Ga0501080_0120150 3300049742 Bacteria 2436
455 Ga0501080_0222444 3300049742 Bacteria 1727
456 Ga0501241_002579 3300049758 Bacteria 3489
457 nmdc:mga03n38_759_c1 3300050490 Bacteria 8538
458 nmdc:mga00v17_14521_c1 3300050491 Bacteria 4398
459 nmdc:mga0k408_30_c1 3300050493 Bacteria 89511
460 nmdc:mga07m45_14_c1 3300050496 Bacteria 154035
461 nmdc:mga0n895_138979_c1 3300050512 Bacteria 2456
462 nmdc:mga0sz30_923_c1 3300050516 Bacteria 10575
463 Ga0500610_0000079 3300053079 Bacteria 29187
464 Ga0500643_004833 3300053087 Bacteria 5953
465 Ga0500643_012283 3300053087 Bacteria 3072
466 Ga0500583_0099187 3300053092 Bacteria 1425
467 Ga0500566_0022593 3300053094 Bacteria 3695
468 Ga0500555_000197 3300053103 Bacteria 27950
469 Ga0500595_003862 3300053119 Bacteria 6881
470 Ga0500595_009550 3300053119 Bacteria 3910
471 Ga0500642_0028166 3300053130 Bacteria 2314
472 Ga0500658_0000843 3300053134 Bacteria 12609
473 Ga0500568_0007351 3300053139 Bacteria 5414
474 Ga0500590_006972 3300053148 Bacteria 5543
475 Ga0500604_0000017 3300053151 Bacteria 82010
476 Ga0500616_0003228 3300053153 Bacteria 12636
477 Ga0500636_0016401 3300053177 Bacteria 4369
478 Ga0500645_000037 3300053730 Bacteria 112944
479 Ga0500645_012600 3300053730 Bacteria 2731
480 Ga0500596_000584 3300053735 Bacteria 6982

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048914 Ga0496111_0136594 Ga0496111_0136594_293_1519 391
2 3300005347 Ga0070668_100004002 Ga0070668_1000040025 397
3 3300025972 Ga0207668_10007638 Ga0207668_100076384 397
4 3300044694 Ga0466963_0032859 Ga0466963_0032859_1754_3148 397
5 3300031456 Ga0307513_10109136 Ga0307513_101091361 398
6 3300026116 Ga0207674_10001013 Ga0207674_1000101334 399
7 3300005617 Ga0068859_100011473 Ga0068859_1000114732 400
8 3300005841 Ga0068863_100001823 Ga0068863_1000018237 400
9 3300006931 Ga0097620_100011473 Ga0097620_1000114732 400
10 3300026095 Ga0207676_10017410 Ga0207676_100174105 400
11 3300028786 Ga0307517_10032174 Ga0307517_100321742 402
12 3300046471 Ga0495650_0034907 Ga0495650_0034907_202_1587 402
13 3300005367 Ga0070667_100008853 Ga0070667_1000088533 405
14 3300005564 Ga0070664_100021508 Ga0070664_1000215083 405
15 3300006358 Ga0068871_100047090 Ga0068871_1000470902 405
16 3300013296 Ga0157374_10115630 Ga0157374_101156302 405
17 3300014325 Ga0163163_10016577 Ga0163163_100165775 405
18 3300014497 Ga0182008_10013862 Ga0182008_100138623 405
19 3300025321 Ga0207656_10015810 Ga0207656_100158103 405
20 3300025945 Ga0207679_10102720 Ga0207679_101027202 405
21 3300048905 Ga0496102_0005444 Ga0496102_0005444_6606_7994 405
22 3300048906 Ga0496103_0061281 Ga0496103_0061281_566_1954 405
23 3300005355 Ga0070671_100009144 Ga0070671_1000091443 406
24 3300014968 Ga0157379_10008896 Ga0157379_100088965 406
25 3300025920 Ga0207649_10035830 Ga0207649_100358302 406
26 3300025931 Ga0207644_10039060 Ga0207644_100390602 406
27 3300048911 Ga0496108_0001167 Ga0496108_0001167_18293_19681 406
28 3300048912 Ga0496109_0042296 Ga0496109_0042296_1265_2653 406
29 3300048913 Ga0496110_0062641 Ga0496110_0062641_1426_2814 406
30 3300048913 Ga0496110_0205933 Ga0496110_0205933_25_1251 408
31 3300003771 Ga0055526_1006177 Ga0055526_10061776 409
32 3300025295 Ga0209564_1006748 Ga0209564_10067486 409
33 3300025297 Ga0209758_1042527 Ga0209758_10425272 409
34 3300048922 Ga0496119_0079550 Ga0496119_0079550_635_1867 409
35 3300025263 Ga0209565_1000298 Ga0209565_100029822 410
36 3300025273 Ga0209673_1005559 Ga0209673_10055595 410
37 3300025295 Ga0209564_1007375 Ga0209564_10073752 410
38 3300025298 Ga0209050_1005259 Ga0209050_10052595 410
39 3300005841 Ga0068863_100001426 Ga0068863_10000142614 411
40 3300005844 Ga0068862_100000032 Ga0068862_100000032107 411
41 3300026088 Ga0207641_10001271 Ga0207641_1000127114 411
42 3300028380 Ga0268265_10000081 Ga0268265_100000813 411
43 3300006048 Ga0075363_100001571 Ga0075363_1000015715 414
44 3300006051 Ga0075364_10026849 Ga0075364_100268495 414
45 3300006177 Ga0075362_10000026 Ga0075362_1000002611 414
46 3300006186 Ga0075369_10001071 Ga0075369_100010716 414
47 3300006195 Ga0075366_10001190 Ga0075366_100011904 414
48 3300050490 nmdc:mga03n38_759_c1 nmdc:mga03n38_759_c1_255_1640 414
49 3300050491 nmdc:mga00v17_14521_c1 nmdc:mga00v17_14521_c1_1860_3245 414
50 3300050493 nmdc:mga0k408_30_c1 nmdc:mga0k408_30_c1_41198_42583 414
51 3300050516 nmdc:mga0sz30_923_c1 nmdc:mga0sz30_923_c1_3559_4944 414
52 3300005719 Ga0068861_100000036 Ga0068861_10000003647 415
53 3300013297 Ga0157378_10148719 Ga0157378_101487192 415
54 3300026118 Ga0207675_100000154 Ga0207675_10000015447 415
55 3300046660 Ga0495625_0026954 Ga0495625_0026954_1949_3337 416
56 3300048924 Ga0496121_0000335 Ga0496121_0000335_48404_49792 417
57 3300047472 Ga0495686_0065721 Ga0495686_0065721_108_1490 418
58 3300046506 Ga0495583_0000286 Ga0495583_0000286_55762_57147 419
59 3300046665 Ga0495661_0042996 Ga0495661_0042996_566_1951 419
60 3300049460 Ga0495682_0008237 Ga0495682_0008237_1352_2737 419
61 3300053103 Ga0500555_000197 Ga0500555_000197_8458_9843 419
62 3300048924 Ga0496121_0003394 Ga0496121_0003394_5337_6731 420
63 3300048924 Ga0496121_0035335 Ga0496121_0035335_1338_2723 420
64 3300041460 Ga0451802_0277189 Ga0451802_0277189_666_2051 421
65 3300005331 Ga0070670_100000047 Ga0070670_10000004717 422
66 3300005367 Ga0070667_100007692 Ga0070667_1000076927 422
67 3300005617 Ga0068859_100045656 Ga0068859_1000456563 422
68 3300005618 Ga0068864_100000051 Ga0068864_10000005116 422
69 3300005719 Ga0068861_100045590 Ga0068861_1000455902 422
70 3300005844 Ga0068862_100000036 Ga0068862_10000003617 422
71 3300006353 Ga0075370_10000035 Ga0075370_100000357 422
72 3300006931 Ga0097620_100045656 Ga0097620_1000456563 422
73 3300009177 Ga0105248_10000407 Ga0105248_1000040715 422
74 3300009553 Ga0105249_10000017 Ga0105249_10000017171 422
75 3300014326 Ga0157380_10000332 Ga0157380_100003328 422
76 3300017792 Ga0163161_10024315 Ga0163161_100243153 422
77 3300025925 Ga0207650_10000038 Ga0207650_1000003879 422
78 3300025941 Ga0207711_10000607 Ga0207711_1000060717 422
79 3300025961 Ga0207712_10000012 Ga0207712_10000012178 422
80 3300025986 Ga0207658_10001592 Ga0207658_100015924 422
81 3300026095 Ga0207676_10000034 Ga0207676_10000034104 422
82 3300026118 Ga0207675_100007062 Ga0207675_1000070624 422
83 3300028380 Ga0268265_10000052 Ga0268265_1000005216 422
84 3300047445 Ga0495677_0004446 Ga0495677_0004446_3390_4775 422
85 3300050496 nmdc:mga07m45_14_c1 nmdc:mga07m45_14_c1_103665_105050 422
86 3300005353 Ga0070669_100000162 Ga0070669_10000016214 423
87 3300025923 Ga0207681_10000003 Ga0207681_10000003621 423
88 3300037471 Ga0395905_0094482 Ga0395905_0094482_225_1610 423
89 3300005844 Ga0068862_100026331 Ga0068862_1000263316 424
90 3300028380 Ga0268265_10016584 Ga0268265_100165842 424
91 3300042439 Ga0439464_0000578 Ga0439464_0000578_2154_3539 424
92 3300046506 Ga0495583_0001958 Ga0495583_0001958_8850_10235 424
93 3300046524 Ga0495648_0047041 Ga0495648_0047041_358_1743 424
94 3300046616 Ga0495668_0021008 Ga0495668_0021008_195_1580 424
95 3300046660 Ga0495625_0009275 Ga0495625_0009275_6214_7599 424
96 3300026116 Ga0207674_10100406 Ga0207674_101004062 427
97 3300002067 JGI24735J21928_10025720 JGI24735J21928_100257201 428
98 3300009093 Ga0105240_10157160 Ga0105240_101571603 428
99 3300049742 Ga0501080_0222444 Ga0501080_0222444_44_1471 428
100 iso_pu_bacteria 2503198000 2503202867 428
101 iso_pu_bacteria 2510065059 2510317797 428
102 iso_pu_bacteria 2513237164 2514032777 428
103 iso_pu_bacteria 2756170246 2756676083 428
104 iso_pu_bacteria 2844002411 2844007019 428
105 iso_pu_bacteria 2871451962 2871458802 428
106 iso_pu_bacteria 2871466892 2871467144 428
107 iso_pu_bacteria 2906378014 2906381687 428
108 iso_pu_bacteria 3004167301 3004170429 428
109 3300001976 JGI24752J21851_1000133 JGI24752J21851_10001335 429
110 3300001979 JGI24740J21852_10001217 JGI24740J21852_100012172 429
111 3300001990 JGI24737J22298_10006050 JGI24737J22298_100060502 429
112 3300002067 JGI24735J21928_10004413 JGI24735J21928_100044133 429
113 3300003762 Ga0055542_1000612 Ga0055542_100061227 429
114 3300005327 Ga0070658_10031935 Ga0070658_100319355 429
115 3300005333 Ga0070677_10000498 Ga0070677_1000049812 429
116 3300005457 Ga0070662_100106832 Ga0070662_1001068321 429
117 3300005459 Ga0068867_100013035 Ga0068867_1000130352 429
118 3300005543 Ga0070672_100153247 Ga0070672_1001532472 429
119 3300005546 Ga0070696_100002429 Ga0070696_1000024294 429
120 3300005548 Ga0070665_100001688 Ga0070665_10000168812 429
121 3300005563 Ga0068855_100000739 Ga0068855_10000073927 429
122 3300005563 Ga0068855_100012866 Ga0068855_1000128666 429
123 3300005564 Ga0070664_100073868 Ga0070664_1000738682 429
124 3300005577 Ga0068857_100055975 Ga0068857_1000559752 429
125 3300005614 Ga0068856_100204012 Ga0068856_1002040122 429
126 3300005616 Ga0068852_100227715 Ga0068852_1002277151 429
127 3300005617 Ga0068859_100000221 Ga0068859_10000022150 429
128 3300005618 Ga0068864_100000721 Ga0068864_1000007212 429
129 3300005841 Ga0068863_100001640 Ga0068863_1000016403 429
130 3300005842 Ga0068858_100000919 Ga0068858_1000009196 429
131 3300005842 Ga0068858_100032615 Ga0068858_1000326155 429
132 3300005843 Ga0068860_100001066 Ga0068860_10000106623 429
133 3300005843 Ga0068860_100047482 Ga0068860_1000474826 429
134 3300006038 Ga0075365_10006923 Ga0075365_100069235 429
135 3300006042 Ga0075368_10016372 Ga0075368_100163722 429
136 3300006178 Ga0075367_10012695 Ga0075367_100126955 429
137 3300006852 Ga0075433_10034371 Ga0075433_100343714 429
138 3300006931 Ga0097620_100000221 Ga0097620_10000022150 429
139 3300009092 Ga0105250_10017629 Ga0105250_100176293 429
140 3300009093 Ga0105240_10015565 Ga0105240_100155653 429
141 3300009093 Ga0105240_10028946 Ga0105240_100289463 429
142 3300009177 Ga0105248_10000502 Ga0105248_1000050217 429
143 3300009545 Ga0105237_10000550 Ga0105237_1000055031 429
144 3300009551 Ga0105238_10144366 Ga0105238_101443662 429
145 3300010375 Ga0105239_10000984 Ga0105239_100009846 429
146 3300010375 Ga0105239_10061420 Ga0105239_100614203 429
147 3300013100 Ga0157373_10012273 Ga0157373_100122735 429
148 3300013306 Ga0163162_10037041 Ga0163162_100370412 429
149 3300014325 Ga0163163_10000164 Ga0163163_1000016418 429
150 3300014497 Ga0182008_10014593 Ga0182008_100145933 429
151 3300014968 Ga0157379_10007033 Ga0157379_100070336 429
152 3300025254 Ga0209148_1000038 Ga0209148_1000038314 429
153 3300025261 Ga0209233_1012367 Ga0209233_10123673 429
154 3300025272 Ga0209455_1000068 Ga0209455_1000068112 429
155 3300025893 Ga0207682_10000763 Ga0207682_100007637 429
156 3300025904 Ga0207647_10014244 Ga0207647_100142445 429
157 3300025913 Ga0207695_10013440 Ga0207695_1001344010 429
158 3300025913 Ga0207695_10040469 Ga0207695_100404697 429
159 3300025914 Ga0207671_10140213 Ga0207671_101402131 429
160 3300025921 Ga0207652_10194872 Ga0207652_101948722 429
161 3300025924 Ga0207694_10129285 Ga0207694_101292852 429
162 3300025932 Ga0207690_10050082 Ga0207690_100500822 429
163 3300025933 Ga0207706_10064271 Ga0207706_100642714 429
164 3300025937 Ga0207669_10040134 Ga0207669_100401341 429
165 3300025941 Ga0207711_10000042 Ga0207711_10000042138 429
166 3300025942 Ga0207689_10011908 Ga0207689_100119083 429
167 3300025945 Ga0207679_10272355 Ga0207679_102723551 429
168 3300025949 Ga0207667_10000397 Ga0207667_100003976 429
169 3300025949 Ga0207667_10087401 Ga0207667_100874011 429
170 3300025960 Ga0207651_10007712 Ga0207651_100077125 429
171 3300025972 Ga0207668_10000129 Ga0207668_100001292 429
172 3300025981 Ga0207640_10035127 Ga0207640_100351271 429
173 3300025986 Ga0207658_10001750 Ga0207658_1000175010 429
174 3300025986 Ga0207658_10012685 Ga0207658_100126854 429
175 3300026035 Ga0207703_10002526 Ga0207703_100025268 429
176 3300026035 Ga0207703_10006187 Ga0207703_100061872 429
177 3300026078 Ga0207702_10067038 Ga0207702_100670381 429
178 3300026078 Ga0207702_10179285 Ga0207702_101792851 429
179 3300026088 Ga0207641_10000415 Ga0207641_1000041530 429
180 3300026089 Ga0207648_10014998 Ga0207648_100149983 429
181 3300026095 Ga0207676_10000456 Ga0207676_1000045619 429
182 3300028379 Ga0268266_10000584 Ga0268266_100005843 429
183 3300028380 Ga0268265_10044914 Ga0268265_100449142 429
184 3300028381 Ga0268264_10000710 Ga0268264_1000071023 429
185 3300028381 Ga0268264_10028537 Ga0268264_100285372 429
186 3300028381 Ga0268264_10108618 Ga0268264_101086181 429
187 3300031548 Ga0307408_100031614 Ga0307408_1000316143 429
188 3300031548 Ga0307408_100081696 Ga0307408_1000816962 429
189 3300031731 Ga0307405_10002901 Ga0307405_100029018 429
190 3300031824 Ga0307413_10002762 Ga0307413_100027626 429
191 3300031852 Ga0307410_10010005 Ga0307410_100100053 429
192 3300031911 Ga0307412_10056076 Ga0307412_100560762 429
193 3300031995 Ga0307409_100005087 Ga0307409_1000050875 429
194 3300032002 Ga0307416_100016572 Ga0307416_1000165725 429
195 3300032004 Ga0307414_10017063 Ga0307414_100170635 429
196 3300032126 Ga0307415_100038644 Ga0307415_1000386443 429
197 3300037418 Ga0395900_0067360 Ga0395900_0067360_1366_2748 429
198 3300037471 Ga0395905_0015623 Ga0395905_0015623_4299_5681 429
199 3300045976 Ga0466967_0066965 Ga0466967_0066965_400_1782 429
200 3300046691 Ga0495670_0000056 Ga0495670_0000056_40987_42369 429
201 3300048905 Ga0496102_0146848 Ga0496102_0146848_878_2167 429
202 3300048905 Ga0496102_0269544 Ga0496102_0269544_58_1440 429
203 3300048915 Ga0496112_0008520 Ga0496112_0008520_4701_6083 429
204 3300048916 Ga0496113_0043822 Ga0496113_0043822_310_1692 429
205 3300048928 Ga0496125_0095816 Ga0496125_0095816_391_1773 429
206 3300049571 Ga0501034_0046570 Ga0501034_0046570_628_2022 429
207 3300049574 Ga0501038_0136832 Ga0501038_0136832_274_1656 429
208 3300049758 Ga0501241_002579 Ga0501241_002579_1306_2688 429
209 3300050512 nmdc:mga0n895_138979_c1 nmdc:mga0n895_138979_c1_16_1401 429
210 3300053094 Ga0500566_0022593 Ga0500566_0022593_47_1429 429
211 3300053119 Ga0500595_003862 Ga0500595_003862_3585_4970 429
212 3300053139 Ga0500568_0007351 Ga0500568_0007351_2984_4366 429
213 3300053151 Ga0500604_0000017 Ga0500604_0000017_16485_17867 429
214 3300053153 Ga0500616_0003228 Ga0500616_0003228_10196_11578 429
215 iso_pu_bacteria 2508501123 2509115407 429
216 iso_pu_bacteria 2512875016 2512930362 429
217 iso_pu_bacteria 2512875024 2512958081 429
218 iso_pu_bacteria 2588253730 2588515977 429
219 iso_pu_bacteria 2643221614 2644086762 429
220 iso_pu_bacteria 2643221661 2644341716 429
221 iso_pu_bacteria 2643221666 2644368003 429
222 iso_pu_bacteria 2856320880 2856324803 429
223 iso_pu_bacteria 2869278585 2869281205 429
224 iso_pu_bacteria 2874139085 2874141191 429
225 iso_pu_bacteria 2874168670 2874170826 429
226 iso_pu_bacteria 2876363079 2876368297 429
227 iso_pu_bacteria 2878738818 2878742912 429
228 iso_pu_bacteria 2903448605 2903452314 429
229 iso_pu_bacteria 2903521522 2903527293 429
230 iso_pu_bacteria 2903528002 2903530357 429
231 iso_pu_bacteria 2924762789 2924765156 429
232 iso_pu_bacteria 2924776078 2924780712 429
233 iso_pu_bacteria 2937848649 2937854312 429
234 iso_pu_bacteria 2937877337 2937879785 429
235 iso_pu_bacteria 2937972304 2937974705 429
236 iso_pu_bacteria 2958034702 2958037168 429
237 iso_pu_bacteria 2958041894 2958046880 429
238 iso_pu_bacteria 2958064165 2958067394 429
239 iso_pu_bacteria 2958084443 2958086963 429
240 iso_pu_bacteria 2958144490 2958147297 429
241 iso_pu_bacteria 2963644680 2963648870 429
242 iso_pu_bacteria 2968016561 2968020015 429
243 iso_pu_bacteria 2968083720 2968084094 429
244 iso_pu_bacteria 2970469710 2970473336 429
245 iso_pu_bacteria 2970593180 2970595809 429
246 iso_pu_bacteria 2977922695 2977926722 429
247 iso_pu_bacteria 2987666974 2987667801 429
248 iso_pu_bacteria 2996348954 2996351474 429
249 iso_pu_bacteria 3000135777 3000138845 429
250 iso_pu_bacteria 3004211236 3004215061 429
251 iso_pu_bacteria 3004218560 3004222348 429
252 iso_pu_bacteria 3004275668 3004278174 429
253 iso_pu_bacteria 3004289098 3004295633 429
254 iso_pu_bacteria 3004334049 3004339946 429
255 iso_pu_bacteria 637000159 637073356 429
256 3300001915 JGI24741J21665_1000861 JGI24741J21665_10008611 430
257 3300001989 JGI24739J22299_10009466 JGI24739J22299_100094665 430
258 3300001990 JGI24737J22298_10002594 JGI24737J22298_100025942 430
259 3300002067 JGI24735J21928_10000508 JGI24735J21928_1000050812 430
260 3300002067 JGI24735J21928_10003821 JGI24735J21928_100038213 430
261 3300002067 JGI24735J21928_10004630 JGI24735J21928_100046304 430
262 3300002067 JGI24735J21928_10014952 JGI24735J21928_100149522 430
263 3300002067 JGI24735J21928_10020489 JGI24735J21928_100204892 430
264 3300002075 JGI24738J21930_10001125 JGI24738J21930_100011253 430
265 3300002075 JGI24738J21930_10001127 JGI24738J21930_100011273 430
266 3300002077 JGI24744J21845_10007656 JGI24744J21845_100076563 430
267 3300002741 JGI25157J39369_1001188 JGI25157J39369_10011882 430
268 3300003214 JGI25165J46597_1000032 JGI25165J46597_1000032131 430
269 3300003214 JGI25165J46597_1000192 JGI25165J46597_100019238 430
270 3300003214 JGI25165J46597_1000289 JGI25165J46597_100028911 430
271 3300003215 JGI25153J46596_10000006 JGI25153J46596_1000000668 430
272 3300003215 JGI25153J46596_10005615 JGI25153J46596_100056153 430
273 3300003320 rootH2_10100697 rootH2_101006972 430
274 3300003759 Ga0055525_1000040 Ga0055525_100004034 430
275 3300003762 Ga0055542_1000650 Ga0055542_100065024 430
276 3300003763 Ga0055529_1000007 Ga0055529_1000007355 430
277 3300003773 Ga0055537_1000161 Ga0055537_100016111 430
278 3300003775 Ga0055524_1000110 Ga0055524_100011070 430
279 3300005262 Ga0065165_1003008 Ga0065165_10030088 430
280 3300005262 Ga0065165_1023131 Ga0065165_10231311 430
281 3300005327 Ga0070658_10000791 Ga0070658_1000079119 430
282 3300005327 Ga0070658_10020415 Ga0070658_100204152 430
283 3300005328 Ga0070676_10000537 Ga0070676_1000053714 430
284 3300005334 Ga0068869_100000246 Ga0068869_10000024625 430
285 3300005338 Ga0068868_100002777 Ga0068868_1000027778 430
286 3300005338 Ga0068868_100037849 Ga0068868_1000378492 430
287 3300005339 Ga0070660_100000066 Ga0070660_10000006652 430
288 3300005339 Ga0070660_100003530 Ga0070660_1000035304 430
289 3300005344 Ga0070661_100011445 Ga0070661_1000114455 430
290 3300005347 Ga0070668_100000240 Ga0070668_10000024026 430
291 3300005354 Ga0070675_100008502 Ga0070675_10000850211 430
292 3300005355 Ga0070671_100007595 Ga0070671_10000759511 430
293 3300005356 Ga0070674_100000259 Ga0070674_10000025922 430
294 3300005356 Ga0070674_100002476 Ga0070674_1000024761 430
295 3300005364 Ga0070673_100000010 Ga0070673_100000010111 430
296 3300005366 Ga0070659_100082745 Ga0070659_1000827452 430
297 3300005367 Ga0070667_100013924 Ga0070667_1000139247 430
298 3300005455 Ga0070663_100002188 Ga0070663_10000218811 430
299 3300005456 Ga0070678_100000015 Ga0070678_10000001513 430
300 3300005456 Ga0070678_100011223 Ga0070678_1000112232 430
301 3300005457 Ga0070662_100063482 Ga0070662_1000634821 430
302 3300005459 Ga0068867_100000019 Ga0068867_10000001954 430
303 3300005539 Ga0068853_100007619 Ga0068853_10000761911 430
304 3300005539 Ga0068853_100036886 Ga0068853_1000368863 430
305 3300005543 Ga0070672_100027763 Ga0070672_1000277635 430
306 3300005548 Ga0070665_100000044 Ga0070665_100000044288 430
307 3300005548 Ga0070665_100007138 Ga0070665_1000071388 430
308 3300005563 Ga0068855_100000123 Ga0068855_10000012352 430
309 3300005563 Ga0068855_100066816 Ga0068855_1000668164 430
310 3300005563 Ga0068855_100081946 Ga0068855_1000819467 430
311 3300005564 Ga0070664_100043576 Ga0070664_1000435764 430
312 3300005577 Ga0068857_100013297 Ga0068857_1000132974 430
313 3300005578 Ga0068854_100000281 Ga0068854_10000028112 430
314 3300005614 Ga0068856_100009906 Ga0068856_1000099065 430
315 3300005614 Ga0068856_100011474 Ga0068856_1000114744 430
316 3300005616 Ga0068852_100001320 Ga0068852_1000013206 430
317 3300005618 Ga0068864_100000249 Ga0068864_10000024912 430
318 3300005618 Ga0068864_100108609 Ga0068864_1001086092 430
319 3300005618 Ga0068864_100133723 Ga0068864_1001337232 430
320 3300005718 Ga0068866_10093046 Ga0068866_100930461 430
321 3300005841 Ga0068863_100000001 Ga0068863_100000001594 430
322 3300005841 Ga0068863_100001380 Ga0068863_10000138024 430
323 3300005842 Ga0068858_100001556 Ga0068858_1000015569 430
324 3300005843 Ga0068860_100019244 Ga0068860_1000192446 430
325 3300005844 Ga0068862_100014225 Ga0068862_1000142256 430
326 3300006237 Ga0097621_100003147 Ga0097621_10000314711 430
327 3300006353 Ga0075370_10031223 Ga0075370_100312236 430
328 3300006358 Ga0068871_100002643 Ga0068871_1000026439 430
329 3300006881 Ga0068865_100000058 Ga0068865_10000005821 430
330 3300009093 Ga0105240_10065298 Ga0105240_100652982 430
331 3300009093 Ga0105240_10357671 Ga0105240_103576711 430
332 3300009098 Ga0105245_10000908 Ga0105245_100009088 430
333 3300009098 Ga0105245_10002399 Ga0105245_100023999 430
334 3300009148 Ga0105243_10000296 Ga0105243_1000029650 430
335 3300009148 Ga0105243_10000814 Ga0105243_1000081421 430
336 3300009174 Ga0105241_10066520 Ga0105241_100665203 430
337 3300009176 Ga0105242_10000215 Ga0105242_1000021523 430
338 3300010375 Ga0105239_10006948 Ga0105239_100069485 430
339 3300010375 Ga0105239_10087536 Ga0105239_100875362 430
340 3300010375 Ga0105239_10144545 Ga0105239_101445451 430
341 3300013100 Ga0157373_10148725 Ga0157373_101487251 430
342 3300013102 Ga0157371_10000024 Ga0157371_1000002496 430
343 3300013104 Ga0157370_10000176 Ga0157370_1000017658 430
344 3300013296 Ga0157374_10000714 Ga0157374_100007149 430
345 3300013296 Ga0157374_10020470 Ga0157374_100204702 430
346 3300013297 Ga0157378_10001057 Ga0157378_100010576 430
347 3300013306 Ga0163162_10009196 Ga0163162_100091964 430
348 3300013307 Ga0157372_10011269 Ga0157372_100112697 430
349 3300013307 Ga0157372_10109684 Ga0157372_101096842 430
350 3300013307 Ga0157372_10165668 Ga0157372_101656682 430
351 3300013308 Ga0157375_10000769 Ga0157375_100007692 430
352 3300014969 Ga0157376_10000061 Ga0157376_1000006197 430
353 3300025230 Ga0209563_100019 Ga0209563_100019242 430
354 3300025231 Ga0207427_100436 Ga0207427_10043612 430
355 3300025233 Ga0209437_101995 Ga0209437_1019953 430
356 3300025250 Ga0209026_1000002 Ga0209026_1000002198 430
357 3300025250 Ga0209026_1001628 Ga0209026_10016282 430
358 3300025254 Ga0209148_1000026 Ga0209148_100002634 430
359 3300025254 Ga0209148_1000114 Ga0209148_100011456 430
360 3300025256 Ga0209759_1000062 Ga0209759_1000062119 430
361 3300025261 Ga0209233_1000027 Ga0209233_1000027202 430
362 3300025261 Ga0209233_1000066 Ga0209233_1000066133 430
363 3300025261 Ga0209233_1000291 Ga0209233_100029165 430
364 3300025263 Ga0209565_1000030 Ga0209565_100003093 430
365 3300025272 Ga0209455_1000005 Ga0209455_1000005781 430
366 3300025273 Ga0209673_1000925 Ga0209673_100092518 430
367 3300025297 Ga0209758_1000001 Ga0209758_10000011757 430
368 3300025297 Ga0209758_1004317 Ga0209758_10043174 430
369 3300025297 Ga0209758_1005567 Ga0209758_100556712 430
370 3300025298 Ga0209050_1003559 Ga0209050_10035599 430
371 3300025299 Ga0209256_1000046 Ga0209256_1000046192 430
372 3300025304 Ga0209257_1001591 Ga0209257_10015918 430
373 3300025321 Ga0207656_10002429 Ga0207656_100024294 430
374 3300025901 Ga0207688_10033187 Ga0207688_100331872 430
375 3300025904 Ga0207647_10000068 Ga0207647_1000006829 430
376 3300025904 Ga0207647_10007855 Ga0207647_100078555 430
377 3300025904 Ga0207647_10032876 Ga0207647_100328762 430
378 3300025909 Ga0207705_10000254 Ga0207705_100002542 430
379 3300025909 Ga0207705_10000776 Ga0207705_100007764 430
380 3300025911 Ga0207654_10004795 Ga0207654_100047954 430
381 3300025911 Ga0207654_10055574 Ga0207654_100555741 430
382 3300025913 Ga0207695_10048707 Ga0207695_100487072 430
383 3300025914 Ga0207671_10001471 Ga0207671_1000147121 430
384 3300025919 Ga0207657_10001048 Ga0207657_1000104811 430
385 3300025919 Ga0207657_10012108 Ga0207657_1001210812 430
386 3300025919 Ga0207657_10050301 Ga0207657_100503013 430
387 3300025920 Ga0207649_10003686 Ga0207649_100036865 430
388 3300025924 Ga0207694_10023954 Ga0207694_100239544 430
389 3300025924 Ga0207694_10127346 Ga0207694_101273462 430
390 3300025926 Ga0207659_10005419 Ga0207659_100054192 430
391 3300025927 Ga0207687_10000565 Ga0207687_100005655 430
392 3300025927 Ga0207687_10002266 Ga0207687_100022667 430
393 3300025931 Ga0207644_10000025 Ga0207644_1000002556 430
394 3300025932 Ga0207690_10001257 Ga0207690_100012575 430
395 3300025934 Ga0207686_10000358 Ga0207686_1000035812 430
396 3300025935 Ga0207709_10000050 Ga0207709_1000005037 430
397 3300025935 Ga0207709_10000179 Ga0207709_1000017953 430
398 3300025937 Ga0207669_10000035 Ga0207669_100000356 430
399 3300025937 Ga0207669_10019274 Ga0207669_100192741 430
400 3300025938 Ga0207704_10000051 Ga0207704_1000005131 430
401 3300025940 Ga0207691_10196742 Ga0207691_101967422 430
402 3300025942 Ga0207689_10002014 Ga0207689_100020145 430
403 3300025945 Ga0207679_10025927 Ga0207679_100259274 430
404 3300025949 Ga0207667_10000010 Ga0207667_1000001058 430
405 3300025949 Ga0207667_10000167 Ga0207667_1000016751 430
406 3300025949 Ga0207667_10059862 Ga0207667_100598622 430
407 3300025949 Ga0207667_10068995 Ga0207667_100689953 430
408 3300025960 Ga0207651_10000005 Ga0207651_10000005214 430
409 3300025972 Ga0207668_10000111 Ga0207668_1000011130 430
410 3300025981 Ga0207640_10000340 Ga0207640_100003408 430
411 3300025981 Ga0207640_10012239 Ga0207640_100122393 430
412 3300025986 Ga0207658_10012454 Ga0207658_100124543 430
413 3300026023 Ga0207677_10000128 Ga0207677_1000012820 430
414 3300026023 Ga0207677_10022726 Ga0207677_100227263 430
415 3300026035 Ga0207703_10000187 Ga0207703_1000018748 430
416 3300026041 Ga0207639_10000642 Ga0207639_1000064216 430
417 3300026041 Ga0207639_10005746 Ga0207639_100057462 430
418 3300026041 Ga0207639_10046468 Ga0207639_100464685 430
419 3300026067 Ga0207678_10000685 Ga0207678_1000068528 430
420 3300026067 Ga0207678_10009632 Ga0207678_100096322 430
421 3300026078 Ga0207702_10001521 Ga0207702_1000152113 430
422 3300026078 Ga0207702_10005587 Ga0207702_1000558710 430
423 3300026078 Ga0207702_10011029 Ga0207702_100110293 430
424 3300026088 Ga0207641_10000001 Ga0207641_10000001929 430
425 3300026088 Ga0207641_10001586 Ga0207641_1000158615 430
426 3300026089 Ga0207648_10000068 Ga0207648_1000006854 430
427 3300026095 Ga0207676_10000388 Ga0207676_1000038812 430
428 3300026095 Ga0207676_10053626 Ga0207676_100536262 430
429 3300026116 Ga0207674_10004383 Ga0207674_100043834 430
430 3300026116 Ga0207674_10020980 Ga0207674_100209804 430
431 3300026121 Ga0207683_10000823 Ga0207683_100008232 430
432 3300026121 Ga0207683_10008251 Ga0207683_100082514 430
433 3300026121 Ga0207683_10072551 Ga0207683_100725513 430
434 3300026142 Ga0207698_10000373 Ga0207698_1000037321 430
435 3300028379 Ga0268266_10000002 Ga0268266_100000022174 430
436 3300028379 Ga0268266_10004591 Ga0268266_100045916 430
437 3300028380 Ga0268265_10007193 Ga0268265_100071932 430
438 3300028381 Ga0268264_10000830 Ga0268264_1000083032 430
439 3300028381 Ga0268264_10003045 Ga0268264_100030456 430
440 3300028786 Ga0307517_10059337 Ga0307517_100593373 430
441 3300031456 Ga0307513_10094177 Ga0307513_100941771 430
442 3300031616 Ga0307508_10002973 Ga0307508_100029733 430
443 3300031824 Ga0307413_10018437 Ga0307413_100184374 430
444 3300031852 Ga0307410_10031488 Ga0307410_100314883 430
445 3300031995 Ga0307409_100001293 Ga0307409_10000129311 430
446 3300031995 Ga0307409_100082379 Ga0307409_1000823792 430
447 3300032005 Ga0307411_10050731 Ga0307411_100507312 430
448 3300033180 Ga0307510_10007699 Ga0307510_100076996 430
449 3300037312 Ga0395899_0000863 Ga0395899_0000863_5812_7197 430
450 3300037312 Ga0395899_0004699 Ga0395899_0004699_4519_5904 430
451 3300037418 Ga0395900_0001809 Ga0395900_0001809_19328_20713 430
452 3300037418 Ga0395900_0016584 Ga0395900_0016584_4351_5736 430
453 3300037418 Ga0395900_0158052 Ga0395900_0158052_269_1657 430
454 3300037418 Ga0395900_0158862 Ga0395900_0158862_616_2004 430
455 3300037418 Ga0395900_0285686 Ga0395900_0285686_147_1532 430
456 3300037466 Ga0395898_0002594 Ga0395898_0002594_17615_19000 430
457 3300037471 Ga0395905_0004463 Ga0395905_0004463_6614_7999 430
458 3300037471 Ga0395905_0017270 Ga0395905_0017270_1944_3329 430
459 3300037471 Ga0395905_0022926 Ga0395905_0022926_2676_4061 430
460 3300038443 Ga0395901_0004659 Ga0395901_0004659_6061_7446 430
461 3300038443 Ga0395901_0220341 Ga0395901_0220341_327_1715 430
462 3300041997 Ga0439431_0018686 Ga0439431_0018686_338_1630 430
463 3300042157 Ga0439458_0000758 Ga0439458_0000758_5108_6493 430
464 3300044658 Ga0466972_0031235 Ga0466972_0031235_23_1414 430
465 3300044658 Ga0466972_0041204 Ga0466972_0041204_377_1765 430
466 3300046460 Ga0495638_0000714 Ga0495638_0000714_16025_17410 430
467 3300046471 Ga0495650_0000058 Ga0495650_0000058_125949_127334 430
468 3300046492 Ga0495585_0008874 Ga0495585_0008874_1664_3049 430
469 3300046500 Ga0495596_0024572 Ga0495596_0024572_673_2058 430
470 3300046506 Ga0495583_0000219 Ga0495583_0000219_68844_70229 430
471 3300046506 Ga0495583_0010965 Ga0495583_0010965_1771_3156 430
472 3300046506 Ga0495583_0037558 Ga0495583_0037558_285_1670 430
473 3300046507 Ga0495606_0000916 Ga0495606_0000916_23262_24647 430
474 3300046507 Ga0495606_0024934 Ga0495606_0024934_905_2290 430
475 3300046518 Ga0495631_0021118 Ga0495631_0021118_637_2073 430
476 3300046522 Ga0495643_0010204 Ga0495643_0010204_2408_3793 430
477 3300046524 Ga0495648_0000108 Ga0495648_0000108_28480_29865 430
478 3300046558 Ga0495633_0001093 Ga0495633_0001093_14821_16257 430
479 3300046616 Ga0495668_0000085 Ga0495668_0000085_88185_89570 430
480 3300046616 Ga0495668_0036461 Ga0495668_0036461_672_2057 430
481 3300046648 Ga0495611_0039343 Ga0495611_0039343_371_1756 430
482 3300046660 Ga0495625_0001409 Ga0495625_0001409_12846_14231 430
483 3300046660 Ga0495625_0001893 Ga0495625_0001893_10918_12303 430
484 3300046660 Ga0495625_0036198 Ga0495625_0036198_1928_3313 430
485 3300046660 Ga0495625_0043269 Ga0495625_0043269_548_1933 430
486 3300046684 Ga0495669_0000099 Ga0495669_0000099_5623_7008 430
487 3300046691 Ga0495670_0001772 Ga0495670_0001772_4764_6149 430
488 3300046691 Ga0495670_0027967 Ga0495670_0027967_690_2126 430
489 3300046809 Ga0495600_0005871 Ga0495600_0005871_3556_4941 430
490 3300047323 Ga0495683_0009106 Ga0495683_0009106_1607_2992 430
491 3300047323 Ga0495683_0077830 Ga0495683_0077830_92_1477 430
492 3300047443 Ga0495687_000251 Ga0495687_000251_34054_35439 430
493 3300047443 Ga0495687_001580 Ga0495687_001580_10219_11604 430
494 3300047445 Ga0495677_0002352 Ga0495677_0002352_5194_6579 430
495 3300047469 Ga0495673_0025452 Ga0495673_0025452_909_2294 430
496 3300047470 Ga0495681_0023470 Ga0495681_0023470_1187_2572 430
497 3300047472 Ga0495686_0000650 Ga0495686_0000650_34356_35741 430
498 3300048905 Ga0496102_0008248 Ga0496102_0008248_5409_6794 430
499 3300048906 Ga0496103_0001675 Ga0496103_0001675_10981_12366 430
500 3300048907 Ga0496104_0064616 Ga0496104_0064616_1741_3126 430
501 3300048908 Ga0496105_0004106 Ga0496105_0004106_346_1731 430
502 3300048916 Ga0496113_0154464 Ga0496113_0154464_109_1494 430
503 3300048917 Ga0496114_0005557 Ga0496114_0005557_8332_9717 430
504 3300048918 Ga0496115_0000129 Ga0496115_0000129_56163_57548 430
505 3300048918 Ga0496115_0055694 Ga0496115_0055694_118_1503 430
506 3300048919 Ga0496116_0014258 Ga0496116_0014258_3829_5214 430
507 3300048920 Ga0496117_0004869 Ga0496117_0004869_10982_12367 430
508 3300048921 Ga0496118_0001014 Ga0496118_0001014_396_1781 430
509 3300048922 Ga0496119_0030112 Ga0496119_0030112_1936_3321 430
510 3300048923 Ga0496120_0071626 Ga0496120_0071626_386_1771 430
511 3300048924 Ga0496121_0000933 Ga0496121_0000933_28866_30251 430
512 3300048925 Ga0496122_0028685 Ga0496122_0028685_2922_4307 430
513 3300048927 Ga0496124_0005267 Ga0496124_0005267_11124_12509 430
514 3300048928 Ga0496125_0001642 Ga0496125_0001642_1091_2476 430
515 3300048928 Ga0496125_0103916 Ga0496125_0103916_114_1505 430
516 3300048929 Ga0496126_0000578 Ga0496126_0000578_57653_59038 430
517 3300049592 Ga0501076_0075560 Ga0501076_0075560_337_1725 430
518 3300049742 Ga0501080_0120150 Ga0501080_0120150_873_2264 430
519 3300053079 Ga0500610_0000079 Ga0500610_0000079_21457_22842 430
520 3300053087 Ga0500643_004833 Ga0500643_004833_4189_5574 430
521 3300053087 Ga0500643_012283 Ga0500643_012283_1154_2539 430
522 3300053092 Ga0500583_0099187 Ga0500583_0099187_109_1401 430
523 3300053119 Ga0500595_009550 Ga0500595_009550_198_1583 430
524 3300053130 Ga0500642_0028166 Ga0500642_0028166_688_2073 430
525 3300053134 Ga0500658_0000843 Ga0500658_0000843_7075_8460 430
526 3300053148 Ga0500590_006972 Ga0500590_006972_211_1596 430
527 3300053177 Ga0500636_0016401 Ga0500636_0016401_419_1804 430
528 3300053730 Ga0500645_000037 Ga0500645_000037_6264_7649 430
529 3300053730 Ga0500645_012600 Ga0500645_012600_377_1762 430
530 3300053735 Ga0500596_000584 Ga0500596_000584_4027_5412 430
531 iso_pu_bacteria 2513237090 2513610025 430
532 iso_pu_bacteria 2599185301 2599938182 430
533 iso_pu_bacteria 2599185354 2600200495 430
534 iso_pu_bacteria 2643221622 2644128462 430
535 iso_pu_bacteria 2751185897 2753763724 430
536 iso_pu_bacteria 2856364286 2856368724 430
537 iso_pu_bacteria 2857349434 2857350393 430
538 iso_pu_bacteria 2869285874 2869291219 430
539 iso_pu_bacteria 2871429161 2871433499 430
540 iso_pu_bacteria 2874146452 2874153100 430
541 iso_pu_bacteria 2874155637 2874160365 430
542 iso_pu_bacteria 2876377896 2876385894 430
543 iso_pu_bacteria 2876413966 2876419391 430
544 iso_pu_bacteria 2878745973 2878751110 430
545 iso_pu_bacteria 2888350351 2888356440 430
546 iso_pu_bacteria 2889010040 2889011354 430
547 iso_pu_bacteria 2889016732 2889016918 430
548 iso_pu_bacteria 2903492973 2903503166 430
549 iso_pu_bacteria 2906308376 2906313051 430
550 iso_pu_bacteria 2906321335 2906325762 430
551 iso_pu_bacteria 2906354277 2906360356 430
552 iso_pu_bacteria 2922130491 2922135619 430
553 iso_pu_bacteria 2937813078 2937820797 430
554 iso_pu_bacteria 2938014810 2938022331 430
555 iso_pu_bacteria 2958100919 2958106172 430
556 iso_pu_bacteria 2958130278 2958135620 430
557 iso_pu_bacteria 2958172287 2958174731 430
558 iso_pu_bacteria 2958179912 2958185111 430
559 iso_pu_bacteria 2961077736 2961083378 430
560 iso_pu_bacteria 2965119406 2965122040 430
561 iso_pu_bacteria 2968117919 2968121334 430
562 iso_pu_bacteria 2977843712 2977849095 430
563 iso_pu_bacteria 2977971508 2977976008 430
564 iso_pu_bacteria 2979710463 2979712201 430
565 iso_pu_bacteria 2979742915 2979746804 430
566 iso_pu_bacteria 2987636660 2987637579 430
567 iso_pu_bacteria 2987652177 2987654424 430
568 iso_pu_bacteria 3004203850 3004206099 430
569 iso_pu_bacteria 8004387939 8004394225 430
570 iso_pu_bacteria 8004640170 8004642018 430
571 iso_pu_bacteria 8004714634 8004719309 430
572 iso_pu_bacteria 8057101203 8057103740 430

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF18614

RNase_II_C_S1

RNase II-type exonuclease C-terminal S1 domain

420

477

0.96

PF00773

RNB

RNB domain

64

373

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2eif-assembly1.cif.gz_A eukaryotic translation initiation factor 5a from methanococcus jannaschii 0.8837 372 412
3d31-assembly1.cif.gz_A modbc from methanosarcina acetivorans 0.8312 370 415
7dcy-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8172 1 429
7dcy-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8138 1 429
7did-assembly1.cif.gz_A mycoplasma genitalium rnase r in complex with ribose methylated single-stranded rna 0.8136 1 429
ID Description Score Start End Superfamily
2r7dB03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8913 372 429 2.40.50.140
2r7dB03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8634 372 429 2.40.50.140
af_Q0D7X0_220_310_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.84 369 426 2.40.50.140
af_K7LD07_1440_1519_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8283 369 426 2.40.50.140
af_P21499_645_754_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.826 372 430 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A846P9R1-F1-model_v4 RNB domain-containing ribonuclease 0.968 35 120 GO:0003723
GO:0004540
GO:0005829
GO:0006402
AF-A0A0X3WDJ4-F1-model_v4 Ribonuclease II 0.9502 2 429 GO:0000175
GO:0000932
GO:0003723
GO:0006402
AF-A0A520D547-F1-model_v4 deleted 0.9478 2 139
AF-A0A800JD98-F1-model_v4 RNB domain-containing ribonuclease 0.9467 1 133 GO:0000175
GO:0000932
GO:0003723
GO:0006402
AF-A0A3R9XH44-F1-model_v4 deleted 0.9455 1 134

Feature Viewer

pLDDT pTM Quality
94.39 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map