F465059

General Info

Members Datasets Scaffolds Average Seq Length
572 341 548 151

Family's Representative Sequence

Representative Sequence 3300009094|Ga0111539_10001638|Ga0111539_1000163815
Length 166
Sequence LHIAALAAMQLATWRLRMSDRIEKTVELKAPVSRVWRALTDHREFGTWFRVRLEGPFVPGQASRGHITYPGYEHVRWEAVVVKMEPERLFCFTWHPNAIDPGDYSNEPPTLVEFTLQEIPTGTLLRVVESGFERLPPQRRHQAFRSNEGGWGAQMENIARHVEQAP

Samples

Sample ID Description Type Environment
1 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
2 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
3 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
4 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
5 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
6 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
7 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
8 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
9 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
10 2643221599 Rhizobium sp. Root708 Isolate Unclassified
11 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
12 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
13 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
14 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
15 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
16 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
17 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
18 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
19 2996887358 Rhizobium sp. R711 Isolate Nodule
20 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
21 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
22 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
23 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
24 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
25 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
26 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
27 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
28 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
29 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
30 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
31 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
32 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
33 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
34 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
35 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
36 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
37 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
38 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
39 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
40 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
41 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
45 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
46 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
57 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
58 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
59 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
60 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
61 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
62 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
63 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
64 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
65 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
69 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
70 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
71 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
72 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
73 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
90 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
108 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
109 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
111 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
112 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
113 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
114 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
115 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
116 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300009763 Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix Metagenome Nodule
120 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
121 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
122 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
123 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
124 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
125 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
126 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
138 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
140 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
141 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
145 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
196 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
201 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
202 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
203 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
204 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
207 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
208 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
209 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
210 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
211 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
212 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
213 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
214 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
215 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
226 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
232 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
233 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
234 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
235 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
238 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
239 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
240 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
247 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
248 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
249 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
250 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
251 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
252 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
253 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
254 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
255 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
256 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
257 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
258 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
259 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
260 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
272 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
273 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
274 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
275 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
293 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
294 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
295 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
296 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
306 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
307 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
309 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
310 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
311 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
312 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
313 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
314 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
317 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
319 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
320 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
321 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
322 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
323 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
324 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
325 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
326 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
327 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
328 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
329 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
330 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
331 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
332 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
333 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
334 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
335 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
336 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
338 8005258706 Rhizobium sp. R693 Isolate Nodule
339 8005321885 Rhizobium sp. R72 Isolate Nodule
340 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
341 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.28
Metatranscriptomes 0.52
Isolates 4.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.42
Nodule 2.1
Rhizoplane 6.29
Rhizosphere 83.04
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10071177 3300001979 Unclassified 931
2 JGI24739J22299_10006377 3300001989 Bacteria 4455
3 JGI24737J22298_10036113 3300001990 Unclassified 1527
4 JGI25152J39213_1012654 3300002773 Bacteria 1796
5 JGI25160J50197_1031397 3300003354 Bacteria 1369
6 Ga0055526_1011463 3300003771 Bacteria 3988
7 Ga0055528_1004541 3300003790 Bacteria 6656
8 Ga0055540_1067993 3300003792 Bacteria 700
9 Ga0070676_10950167 3300005328 Unclassified 643
10 Ga0070683_101027547 3300005329 Bacteria 791
11 Ga0070690_100022068 3300005330 Bacteria 3892
12 Ga0070677_10016340 3300005333 Bacteria 2641
13 Ga0070666_10000962 3300005335 Bacteria 17567
14 Ga0068868_100022375 3300005338 Bacteria 4770
15 Ga0068868_100865246 3300005338 Bacteria 819
16 Ga0070689_100251693 3300005340 Unclassified 1458
17 Ga0070691_10454315 3300005341 Unclassified 732
18 Ga0070661_100208293 3300005344 Bacteria 1496
19 Ga0070661_100304511 3300005344 Bacteria 1241
20 Ga0070669_100091756 3300005353 Bacteria 2278
21 Ga0070671_100074455 3300005355 Bacteria 2837
22 Ga0070671_100114706 3300005355 Bacteria 2264
23 Ga0070671_100307391 3300005355 Unclassified 1350
24 Ga0070674_100035121 3300005356 Bacteria 3355
25 Ga0070673_100236897 3300005364 Bacteria 1585
26 Ga0070673_101321896 3300005364 Unclassified 677
27 Ga0070659_100433262 3300005366 Bacteria 1113
28 Ga0070659_100893356 3300005366 Bacteria 776
29 Ga0070667_100073864 3300005367 Bacteria 2908
30 Ga0070667_100142935 3300005367 Bacteria 2097
31 Ga0070709_10002678 3300005434 Bacteria 9610
32 Ga0070713_100004406 3300005436 Bacteria 9453
33 Ga0070713_102058284 3300005436 Unclassified 554
34 Ga0070710_10079154 3300005437 Bacteria 1914
35 Ga0070710_11245644 3300005437 Bacteria 551
36 Ga0070711_100011036 3300005439 Bacteria 5604
37 Ga0070711_100025508 3300005439 Bacteria 3869
38 Ga0070705_100248063 3300005440 Bacteria 1248
39 Ga0070705_100332453 3300005440 Bacteria 1101
40 Ga0070694_100265539 3300005444 Bacteria 1303
41 Ga0070708_100809391 3300005445 Bacteria 881
42 Ga0070663_100013612 3300005455 Bacteria 5192
43 Ga0070678_100001882 3300005456 Bacteria 11328
44 Ga0070662_100050121 3300005457 Bacteria 3012
45 Ga0070662_100845552 3300005457 Bacteria 779
46 Ga0070681_10000738 3300005458 Bacteria 27069
47 Ga0070681_11911975 3300005458 Unclassified 521
48 Ga0068867_100046831 3300005459 Bacteria 3177
49 Ga0068867_100747382 3300005459 Bacteria 867
50 Ga0070706_100523251 3300005467 Bacteria 1103
51 Ga0070706_101558844 3300005467 Unclassified 603
52 Ga0070698_100584211 3300005471 Bacteria 1057
53 Ga0070699_100101141 3300005518 Bacteria 2526
54 Ga0070699_100462088 3300005518 Bacteria 1151
55 Ga0070679_100858161 3300005530 Bacteria 851
56 Ga0070684_100601499 3300005535 Unclassified 1022
57 Ga0070697_100226244 3300005536 Bacteria 1595
58 Ga0068853_100001212 3300005539 Bacteria 18395
59 Ga0070672_100004419 3300005543 Bacteria 9199
60 Ga0070686_100100765 3300005544 Bacteria 1951
61 Ga0070686_101398640 3300005544 Unclassified 587
62 Ga0070695_100001122 3300005545 Bacteria 14667
63 Ga0070695_100444144 3300005545 Bacteria 992
64 Ga0070695_100569520 3300005545 Bacteria 885
65 Ga0070696_100081554 3300005546 Bacteria 2292
66 Ga0070696_100198021 3300005546 Bacteria 1498
67 Ga0070696_100228251 3300005546 Bacteria 1400
68 Ga0070693_100260896 3300005547 Bacteria 1152
69 Ga0070665_100006732 3300005548 Bacteria 11682
70 Ga0070665_100040389 3300005548 Bacteria 4690
71 Ga0070665_101417716 3300005548 Unclassified 704
72 Ga0068855_100157265 3300005563 Unclassified 2582
73 Ga0068855_100969582 3300005563 Bacteria 895
74 Ga0070664_100125381 3300005564 Bacteria 2252
75 Ga0070664_100230791 3300005564 Unclassified 1659
76 Ga0068857_100042715 3300005577 Bacteria 4022
77 Ga0068857_100118693 3300005577 Bacteria 2381
78 Ga0068854_100010069 3300005578 Bacteria 6123
79 Ga0068854_100382419 3300005578 Bacteria 1160
80 Ga0068856_100061025 3300005614 Bacteria 3724
81 Ga0068852_100776428 3300005616 Bacteria 971
82 Ga0068852_100793475 3300005616 Bacteria 961
83 Ga0068859_101079688 3300005617 Bacteria 883
84 Ga0068866_10064790 3300005718 Bacteria 1909
85 Ga0068861_101385785 3300005719 Bacteria 686
86 Ga0068851_10648177 3300005834 Unclassified 646
87 Ga0068870_10372571 3300005840 Bacteria 922
88 Ga0068863_100113370 3300005841 Bacteria 2582
89 Ga0068863_100154209 3300005841 Bacteria 2199
90 Ga0068858_100322543 3300005842 Bacteria 1476
91 Ga0068860_100561455 3300005843 Bacteria 1144
92 Ga0068860_101388031 3300005843 Bacteria 724
93 Ga0081455_10000058 3300005937 Bacteria 119171
94 Ga0081455_10007344 3300005937 Bacteria 11619
95 Ga0081455_10103275 3300005937 Bacteria 2283
96 Ga0081455_10140763 3300005937 Bacteria 1874
97 Ga0081455_10592141 3300005937 Bacteria 725
98 Ga0081455_10757664 3300005937 Bacteria 613
99 Ga0081540_1014811 3300005983 Bacteria 4969
100 Ga0081540_1142939 3300005983 Bacteria 957
101 Ga0075365_10002801 3300006038 Bacteria 8729
102 Ga0075365_10003928 3300006038 Bacteria 7783
103 Ga0075368_10025213 3300006042 Bacteria 2281
104 Ga0075363_100105906 3300006048 Bacteria 1560
105 Ga0075364_10991509 3300006051 Unclassified 571
106 Ga0070715_10000714 3300006163 Bacteria 8928
107 Ga0070716_100000449 3300006173 Bacteria 17023
108 Ga0070716_101121380 3300006173 Unclassified 628
109 Ga0070712_100045298 3300006175 Bacteria 3037
110 Ga0070712_100053492 3300006175 Bacteria 2819
111 Ga0075367_10003265 3300006178 Bacteria 7676
112 Ga0075367_10017321 3300006178 Bacteria 3952
113 Ga0097621_100471631 3300006237 Bacteria 1133
114 Ga0097621_100683175 3300006237 Unclassified 944
115 Ga0075370_10079548 3300006353 Bacteria 1883
116 Ga0068871_100028714 3300006358 Bacteria 4364
117 Ga0068871_100435582 3300006358 Bacteria 1173
118 Ga0075428_100002056 3300006844 Bacteria 21702
119 Ga0075428_100002982 3300006844 Bacteria 18442
120 Ga0075428_100042255 3300006844 Bacteria 5012
121 Ga0075428_100182463 3300006844 Bacteria 2271
122 Ga0075428_101526460 3300006844 Bacteria 699
123 Ga0075428_102671727 3300006844 Bacteria 509
124 Ga0075430_100031326 3300006846 Bacteria 4514
125 Ga0075430_100052103 3300006846 Bacteria 3447
126 Ga0075430_100100928 3300006846 Unclassified 2410
127 Ga0075430_100102549 3300006846 Bacteria 2389
128 Ga0075430_100201744 3300006846 Bacteria 1651
129 Ga0075430_100369915 3300006846 Bacteria 1183
130 Ga0075431_100002077 3300006847 Bacteria 19121
131 Ga0075431_100006590 3300006847 Bacteria 11534
132 Ga0075431_100016829 3300006847 Bacteria 7427
133 Ga0075431_100028315 3300006847 Bacteria 5755
134 Ga0075431_100042943 3300006847 Bacteria 4664
135 Ga0075431_100049592 3300006847 Bacteria 4328
136 Ga0075431_100168676 3300006847 Bacteria 2250
137 Ga0075431_100523210 3300006847 Bacteria 1175
138 Ga0075431_100847326 3300006847 Unclassified 885
139 Ga0075433_10222785 3300006852 Bacteria 1675
140 Ga0075434_100014125 3300006871 Bacteria 7626
141 Ga0075434_100063914 3300006871 Bacteria 3663
142 Ga0075434_101069075 3300006871 Unclassified 820
143 Ga0075429_100021858 3300006880 Bacteria 5545
144 Ga0075429_100130137 3300006880 Bacteria 2201
145 Ga0075429_100172685 3300006880 Bacteria 1893
146 Ga0075429_100410176 3300006880 Bacteria 1186
147 Ga0068865_100005989 3300006881 Bacteria 7408
148 Ga0075436_100350865 3300006914 Bacteria 1063
149 Ga0097620_101079741 3300006931 Bacteria 883
150 Ga0099794_10025383 3300007265 Bacteria 2729
151 Ga0099794_10309009 3300007265 Unclassified 819
152 Ga0099795_10029751 3300007788 Bacteria 1869
153 Ga0099795_10289595 3300007788 Bacteria 717
154 Ga0105250_10020527 3300009092 Bacteria 2670
155 Ga0105240_10000406 3300009093 Bacteria 80007
156 Ga0105240_10407983 3300009093 Bacteria 1529
157 Ga0105240_10447965 3300009093 Unclassified 1445
158 Ga0111539_10001638 3300009094 Bacteria 29905
159 Ga0111539_10029477 3300009094 Bacteria 6684
160 Ga0111539_10131177 3300009094 Unclassified 2934
161 Ga0111539_10749568 3300009094 Bacteria 1137
162 Ga0111539_10770570 3300009094 Bacteria 1120
163 Ga0111539_11884412 3300009094 Unclassified 693
164 Ga0105245_10012427 3300009098 Bacteria 7410
165 Ga0105245_10093791 3300009098 Bacteria 2766
166 Ga0105245_10426310 3300009098 Bacteria 1330
167 Ga0105247_10118868 3300009101 Bacteria 1710
168 Ga0105247_11483787 3300009101 Unclassified 552
169 Ga0114129_10001489 3300009147 Bacteria 31706
170 Ga0114129_10004660 3300009147 Bacteria 19362
171 Ga0114129_10041628 3300009147 Bacteria 6471
172 Ga0114129_10477306 3300009147 Bacteria 1632
173 Ga0114129_10808824 3300009147 Bacteria 1195
174 Ga0114129_10893575 3300009147 Bacteria 1126
175 Ga0105243_10632277 3300009148 Bacteria 1035
176 Ga0105243_10791127 3300009148 Bacteria 934
177 Ga0105241_10107114 3300009174 Bacteria 2232
178 Ga0105242_10006693 3300009176 Bacteria 8894
179 Ga0105248_10075639 3300009177 Bacteria 3784
180 Ga0105248_10135025 3300009177 Bacteria 2783
181 Ga0105248_10349716 3300009177 Bacteria 1664
182 Ga0105248_10737052 3300009177 Unclassified 1112
183 Ga0105238_10090370 3300009551 Bacteria 3050
184 Ga0105238_10194360 3300009551 Unclassified 2005
185 Ga0105238_11620403 3300009551 Bacteria 677
186 Ga0105249_10376884 3300009553 Bacteria 1444
187 Ga0123340_1056259 3300009763 Bacteria 1262
188 Ga0123340_1058161 3300009763 Bacteria 1186
189 Ga0123341_1082641 3300009765 Bacteria 1239
190 Ga0123341_1082672 3300009765 Bacteria 1239
191 Ga0123342_1034070 3300009766 Bacteria 2267
192 Ga0105239_10005723 3300010375 Bacteria 14518
193 Ga0105239_11145562 3300010375 Bacteria 896
194 Ga0105239_11196080 3300010375 Unclassified 876
195 Ga0105246_10910273 3300011119 Bacteria 789
196 Ga0157370_10705633 3300013104 Bacteria 921
197 Ga0157369_10599373 3300013105 Bacteria 1137
198 Ga0157374_10112983 3300013296 Unclassified 2614
199 Ga0157374_10336352 3300013296 Bacteria 1498
200 Ga0157374_10876428 3300013296 Bacteria 915
201 Ga0163162_12349182 3300013306 Bacteria 613
202 Ga0157372_10085393 3300013307 Unclassified 3579
203 Ga0157372_12648297 3300013307 Unclassified 575
204 Ga0157375_10184171 3300013308 Bacteria 2241
205 Ga0157375_11575729 3300013308 Unclassified 776
206 Ga0157375_11666893 3300013308 Unclassified 755
207 Ga0157375_12013204 3300013308 Unclassified 687
208 Ga0157375_12128558 3300013308 Bacteria 668
209 Ga0163163_10135016 3300014325 Bacteria 2508
210 Ga0163163_10233078 3300014325 Bacteria 1890
211 Ga0163163_10306114 3300014325 Bacteria 1642
212 Ga0157379_10022250 3300014968 Bacteria 5615
213 Ga0157379_10383580 3300014968 Bacteria 1290
214 Ga0157379_11237378 3300014968 Unclassified 719
215 Ga0157376_10960342 3300014969 Unclassified 875
216 Ga0206354_10229693 3300020081 Bacteria 9840
217 Ga0206353_11805231 3300020082 Bacteria 7432
218 Ga0213872_10001236 3300021361 Bacteria 17247
219 Ga0213876_10295429 3300021384 Bacteria 861
220 Ga0209129_1004672 3300025258 Bacteria 5228
221 Ga0209673_1003809 3300025273 Bacteria 8551
222 Ga0209130_1011356 3300025284 Bacteria 2389
223 Ga0209025_1033874 3300025294 Bacteria 2349
224 Ga0209025_1086326 3300025294 Bacteria 1043
225 Ga0209025_1104260 3300025294 Bacteria 888
226 Ga0209564_1018176 3300025295 Bacteria 2695
227 Ga0209758_1015852 3300025297 Bacteria 3872
228 Ga0209256_1014803 3300025299 Bacteria 2773
229 Ga0207426_1002621 3300025302 Bacteria 11149
230 Ga0209051_1015244 3300025303 Bacteria 3547
231 Ga0207682_10084409 3300025893 Bacteria 1367
232 Ga0207692_10155172 3300025898 Bacteria 1314
233 Ga0207642_10004598 3300025899 Bacteria 4457
234 Ga0207685_10043801 3300025905 Bacteria 1689
235 Ga0207685_10061127 3300025905 Bacteria 1492
236 Ga0207699_10071415 3300025906 Bacteria 2123
237 Ga0207645_10008093 3300025907 Bacteria 7374
238 Ga0207654_10268856 3300025911 Bacteria 1149
239 Ga0207654_10274218 3300025911 Bacteria 1139
240 Ga0207707_10001614 3300025912 Bacteria 20779
241 Ga0207695_10377655 3300025913 Unclassified 1303
242 Ga0207693_10000083 3300025915 Bacteria 84611
243 Ga0207693_10204486 3300025915 Bacteria 1553
244 Ga0207662_10295032 3300025918 Bacteria 1076
245 Ga0207649_10293112 3300025920 Bacteria 1187
246 Ga0207652_10916467 3300025921 Bacteria 774
247 Ga0207681_10221419 3300025923 Bacteria 1464
248 Ga0207681_10431226 3300025923 Bacteria 1070
249 Ga0207694_10134868 3300025924 Bacteria 1982
250 Ga0207694_10149723 3300025924 Bacteria 1879
251 Ga0207687_10026282 3300025927 Unclassified 3896
252 Ga0207687_10028228 3300025927 Bacteria 3770
253 Ga0207700_10286606 3300025928 Bacteria 1418
254 Ga0207664_10146050 3300025929 Bacteria 2006
255 Ga0207644_10043415 3300025931 Bacteria 3190
256 Ga0207644_10137714 3300025931 Bacteria 1876
257 Ga0207644_10248764 3300025931 Bacteria 1418
258 Ga0207690_11417920 3300025932 Bacteria 581
259 Ga0207690_11544576 3300025932 Unclassified 555
260 Ga0207706_10003176 3300025933 Bacteria 15789
261 Ga0207706_10009554 3300025933 Bacteria 8904
262 Ga0207706_11083920 3300025933 Bacteria 670
263 Ga0207686_10132872 3300025934 Bacteria 1709
264 Ga0207709_10624142 3300025935 Bacteria 856
265 Ga0207669_10257157 3300025937 Bacteria 1304
266 Ga0207704_10250025 3300025938 Bacteria 1330
267 Ga0207665_10000587 3300025939 Bacteria 24539
268 Ga0207665_10037791 3300025939 Bacteria 3214
269 Ga0207665_11036317 3300025939 Unclassified 653
270 Ga0207691_10016487 3300025940 Bacteria 7013
271 Ga0207711_10193825 3300025941 Bacteria 1852
272 Ga0207711_10429180 3300025941 Bacteria 1230
273 Ga0207661_10222430 3300025944 Unclassified 1669
274 Ga0207667_10082789 3300025949 Unclassified 3323
275 Ga0207667_10608458 3300025949 Bacteria 1101
276 Ga0207667_11379864 3300025949 Unclassified 679
277 Ga0207651_10246098 3300025960 Bacteria 1460
278 Ga0207651_11031578 3300025960 Unclassified 736
279 Ga0207651_12019629 3300025960 Unclassified 518
280 Ga0207712_11256785 3300025961 Bacteria 661
281 Ga0207668_10087746 3300025972 Bacteria 2276
282 Ga0207668_10351362 3300025972 Bacteria 1233
283 Ga0207640_10288197 3300025981 Bacteria 1293
284 Ga0207640_10551823 3300025981 Bacteria 968
285 Ga0207658_10146136 3300025986 Bacteria 1920
286 Ga0207677_10118489 3300026023 Bacteria 1986
287 Ga0207639_10004188 3300026041 Bacteria 9713
288 Ga0207708_10193947 3300026075 Unclassified 1618
289 Ga0207702_10138353 3300026078 Bacteria 2200
290 Ga0207641_10345799 3300026088 Bacteria 1416
291 Ga0207641_11812181 3300026088 Bacteria 612
292 Ga0207648_10003167 3300026089 Bacteria 17348
293 Ga0207674_10020062 3300026116 Bacteria 7230
294 Ga0207674_10099189 3300026116 Bacteria 2895
295 Ga0207674_10818338 3300026116 Bacteria 899
296 Ga0207675_100004907 3300026118 Bacteria 12886
297 Ga0207675_100658016 3300026118 Unclassified 1054
298 Ga0207683_10002455 3300026121 Bacteria 16158
299 Ga0207698_10743699 3300026142 Bacteria 979
300 Ga0207698_10994972 3300026142 Bacteria 849
301 Ga0209179_1069662 3300027512 Bacteria 769
302 Ga0209971_1004557 3300027682 Bacteria 3288
303 Ga0209998_10005976 3300027717 Bacteria 2532
304 Ga0209813_10009170 3300027866 Bacteria 2522
305 Ga0207428_10004512 3300027907 Bacteria 13205
306 Ga0207428_10067272 3300027907 Unclassified 2821
307 Ga0207428_10386451 3300027907 Bacteria 1026
308 Ga0268266_10019128 3300028379 Bacteria 5832
309 Ga0268264_10520821 3300028381 Bacteria 1162
310 Ga0265316_10447276 3300031344 Unclassified 927
311 Ga0307408_100037588 3300031548 Bacteria 3411
312 Ga0307408_100468991 3300031548 Bacteria 1096
313 Ga0307408_100910328 3300031548 Bacteria 806
314 Ga0307405_10027552 3300031731 Bacteria 3296
315 Ga0307405_10141450 3300031731 Bacteria 1678
316 Ga0307413_10104459 3300031824 Bacteria 1881
317 Ga0307413_10367231 3300031824 Bacteria 1116
318 Ga0307410_10582335 3300031852 Bacteria 931
319 Ga0307406_10160051 3300031901 Bacteria 1617
320 Ga0307412_10095880 3300031911 Unclassified 2087
321 Ga0307409_100008605 3300031995 Bacteria 6208
322 Ga0307416_100076784 3300032002 Bacteria 2802
323 Ga0307416_101482356 3300032002 Bacteria 784
324 Ga0307414_10119131 3300032004 Bacteria 2026
325 Ga0307414_10976249 3300032004 Unclassified 779
326 Ga0307411_10012283 3300032005 Bacteria 4665
327 Ga0307411_11441235 3300032005 Bacteria 631
328 Ga0307415_100277662 3300032126 Bacteria 1376
329 Ga0307415_102178040 3300032126 Bacteria 542
330 Ga0373926_0067873 3300035083 Bacteria 1307
331 Ga0373940_0062800 3300035088 Bacteria 1066
332 Ga0373949_0086013 3300035090 Bacteria 844
333 Ga0373923_0182297 3300035111 Bacteria 965
334 Ga0373953_0079389 3300035117 Bacteria 1362
335 Ga0373953_0124344 3300035117 Bacteria 1097
336 Ga0373954_0117613 3300035118 Bacteria 1289
337 Ga0373943_0442803 3300035170 Bacteria 754
338 Ga0373955_0015905 3300035172 Bacteria 3692
339 Ga0373955_0119699 3300035172 Bacteria 1530
340 Ga0373961_0195311 3300035241 Bacteria 711
341 Ga0373935_0828266 3300035692 Bacteria 684
342 Ga0373927_0000772 3300035695 Bacteria 24478
343 Ga0373927_0064997 3300035695 Bacteria 2360
344 Ga0373927_0259811 3300035695 Bacteria 1142
345 Ga0373933_0038327 3300035724 Bacteria 2816
346 Ga0373937_0006608 3300036401 Bacteria 10014
347 Ga0373937_0049306 3300036401 Bacteria 3856
348 Ga0373937_0190795 3300036401 Bacteria 1925
349 Ga0373937_0513343 3300036401 Bacteria 1139
350 Ga0373937_1998775 3300036401 Unclassified 526
351 Ga0395899_0005256 3300037312 Bacteria 10064
352 Ga0395899_0008193 3300037312 Bacteria 8051
353 Ga0395900_0009362 3300037418 Bacteria 10044
354 Ga0395900_0376114 3300037418 Bacteria 1389
355 Ga0395898_0095189 3300037466 Bacteria 2861
356 Ga0395898_0357957 3300037466 Bacteria 1391
357 Ga0395905_0168442 3300037471 Bacteria 2058
358 Ga0395905_0724916 3300037471 Bacteria 897
359 Ga0436364_1204884 3300037853 Unclassified 2403
360 Ga0395901_0020564 3300038443 Bacteria 6754
361 Ga0436365_0340625 3300039437 Bacteria 1488
362 Ga0436365_0701502 3300039437 Bacteria 5706
363 Ga0436360_0122890 3300039438 Bacteria 584
364 Ga0436360_0352942 3300039438 Bacteria 934
365 Ga0436360_1031893 3300039438 Bacteria 741
366 Ga0436360_1170569 3300039438 Bacteria 603
367 Ga0436361_1165271 3300039447 Bacteria 12230
368 Ga0436362_0170168 3300039453 Bacteria 760
369 Ga0439465_0130887 3300041413 Bacteria 886
370 Ga0451791_1630542 3300041451 Unclassified 786
371 Ga0451833_1389789 3300041491 Unclassified 634
372 Ga0451849_0967899 3300041505 Bacteria 672
373 Ga0450896_035893 3300042133 Bacteria 762
374 Ga0439435_0075695 3300042436 Unclassified 1003
375 Ga0439460_0243015 3300042461 Bacteria 621
376 Ga0466957_0430041 3300044842 Unclassified 907
377 Ga0466967_1890625 3300045976 Bacteria 594
378 Ga0495592_0012377 3300046454 Bacteria 6479
379 Ga0495592_0541624 3300046454 Unclassified 717
380 Ga0495603_0221315 3300046455 Bacteria 1092
381 Ga0495590_0324923 3300046457 Archaea 582
382 Ga0495651_0402896 3300046462 Bacteria 893
383 Ga0495650_0087307 3300046471 Bacteria 1193
384 Ga0495580_0002317 3300046472 Bacteria 16600
385 Ga0495580_0028129 3300046472 Bacteria 4088
386 Ga0495580_0032532 3300046472 Bacteria 3763
387 Ga0495664_0673948 3300046477 Unclassified 612
388 Ga0495585_0288120 3300046492 Bacteria 810
389 Ga0495585_0374396 3300046492 Bacteria 689
390 Ga0495594_0486821 3300046499 Bacteria 701
391 Ga0495607_0252098 3300046501 Bacteria 849
392 Ga0495583_0125424 3300046506 Bacteria 1077
393 Ga0495606_0294405 3300046507 Bacteria 882
394 Ga0495606_0361544 3300046507 Bacteria 767
395 Ga0495608_0100505 3300046511 Bacteria 1865
396 Ga0495628_0192642 3300046516 Bacteria 1539
397 Ga0495628_0625110 3300046516 Unclassified 767
398 Ga0495586_0506526 3300046535 Bacteria 697
399 Ga0495645_0129976 3300046543 Bacteria 1766
400 Ga0495667_0007136 3300046559 Bacteria 7577
401 Ga0495668_0019219 3300046616 Bacteria 3942
402 Ga0495625_0143701 3300046660 Bacteria 1608
403 Ga0495588_0138881 3300046674 Bacteria 1283
404 Ga0495657_0038547 3300046675 Bacteria 3288
405 Ga0495657_0146608 3300046675 Bacteria 1468
406 Ga0495657_0206296 3300046675 Bacteria 1196
407 Ga0495599_0263458 3300046678 Bacteria 1047
408 Ga0495623_0243639 3300046679 Unclassified 1014
409 Ga0495647_0239224 3300046681 Bacteria 806
410 Ga0495658_0227048 3300046683 Bacteria 1170
411 Ga0495613_0143223 3300046689 Unclassified 1707
412 Ga0495589_0098836 3300046794 Bacteria 1413
413 Ga0495600_0149144 3300046809 Unclassified 1515
414 Ga0495600_0322245 3300046809 Bacteria 972
415 Ga0495600_0533044 3300046809 Unclassified 719
416 Ga0495604_0177444 3300047317 Bacteria 1492
417 Ga0495604_0464404 3300047317 Bacteria 825
418 Ga0495674_0172755 3300047319 Bacteria 1803
419 Ga0495680_0000817 3300047322 Bacteria 34725
420 Ga0495675_0007417 3300047444 Bacteria 6754
421 Ga0495684_0130791 3300047471 Bacteria 1885
422 Ga0495684_0213231 3300047471 Bacteria 1419
423 Ga0495686_0000526 3300047472 Bacteria 55119
424 Ga0495686_0040857 3300047472 Bacteria 2955
425 Ga0495686_0171809 3300047472 Bacteria 1260
426 Ga0495602_0229751 3300048088 Bacteria 1395
427 Ga0495602_0705771 3300048088 Unclassified 684
428 Ga0495602_1053812 3300048088 Unclassified 535
429 Ga0496100_0099797 3300048903 Bacteria 1998
430 Ga0496100_0159739 3300048903 Bacteria 1615
431 Ga0496100_0292265 3300048903 Unclassified 1218
432 Ga0496101_0002781 3300048904 Bacteria 10726
433 Ga0496101_0458546 3300048904 Unclassified 1006
434 Ga0496101_1579229 3300048904 Bacteria 510
435 Ga0496102_0079333 3300048905 Bacteria 3023
436 Ga0496104_0021841 3300048907 Bacteria 5878
437 Ga0496104_0122439 3300048907 Bacteria 2497
438 Ga0496104_0163771 3300048907 Bacteria 2132
439 Ga0496104_0351360 3300048907 Bacteria 1387
440 Ga0496105_0060265 3300048908 Bacteria 3131
441 Ga0496105_0111864 3300048908 Bacteria 2253
442 Ga0496106_0019073 3300048909 Bacteria 5083
443 Ga0496106_0474679 3300048909 Bacteria 1005
444 Ga0496107_0001015 3300048910 Bacteria 16758
445 Ga0496107_0479908 3300048910 Bacteria 923
446 Ga0496107_0531169 3300048910 Bacteria 872
447 Ga0496108_0038274 3300048911 Bacteria 3995
448 Ga0496108_1072265 3300048911 Bacteria 686
449 Ga0496109_0220308 3300048912 Bacteria 1784
450 Ga0496109_0438409 3300048912 Bacteria 1234
451 Ga0496110_0000749 3300048913 Bacteria 22420
452 Ga0496110_1622786 3300048913 Bacteria 557
453 Ga0496111_0262853 3300048914 Bacteria 1280
454 Ga0496112_0005843 3300048915 Bacteria 10714
455 Ga0496112_0138398 3300048915 Bacteria 2404
456 Ga0496112_0685121 3300048915 Bacteria 953
457 Ga0496113_0036857 3300048916 Bacteria 3585
458 Ga0496113_1529551 3300048916 Bacteria 515
459 Ga0496114_0001864 3300048917 Bacteria 15980
460 Ga0496114_0580000 3300048917 Bacteria 990
461 Ga0496115_0098142 3300048918 Unclassified 2399
462 Ga0496115_0131209 3300048918 Bacteria 2065
463 Ga0496122_0058929 3300048925 Bacteria 2838
464 Ga0496124_0043314 3300048927 Bacteria 3869
465 Ga0496125_0092215 3300048928 Bacteria 2266
466 Ga0501031_0032810 3300049568 Unclassified 3386
467 Ga0501031_0038007 3300049568 Bacteria 3142
468 Ga0501032_0000347 3300049569 Bacteria 38712
469 Ga0501033_0001128 3300049570 Bacteria 24173
470 Ga0501033_0017584 3300049570 Bacteria 5401
471 Ga0501033_0019916 3300049570 Bacteria 5071
472 Ga0501036_0000478 3300049572 Bacteria 28581
473 Ga0501036_0005040 3300049572 Bacteria 10688
474 Ga0501036_0077004 3300049572 Bacteria 2822
475 Ga0501037_0000473 3300049573 Bacteria 32620
476 Ga0501037_0092458 3300049573 Bacteria 2188
477 Ga0501037_0874143 3300049573 Unclassified 590
478 Ga0501038_0004697 3300049574 Bacteria 12707
479 Ga0501038_0044079 3300049574 Bacteria 3877
480 Ga0501038_0080123 3300049574 Unclassified 2752
481 Ga0501038_0236005 3300049574 Bacteria 1453
482 Ga0501039_0001356 3300049575 Bacteria 17939
483 Ga0501039_0316871 3300049575 Unclassified 1226
484 Ga0501040_0000822 3300049576 Bacteria 19406
485 Ga0501042_0003268 3300049578 Bacteria 10139
486 Ga0501043_0000887 3300049579 Bacteria 26535
487 Ga0501043_0033954 3300049579 Unclassified 4013
488 Ga0501043_0317866 3300049579 Bacteria 1187
489 Ga0501046_0000045 3300049580 Bacteria 144492
490 Ga0501046_0002039 3300049580 Bacteria 19200
491 Ga0501046_0266000 3300049580 Bacteria 1259
492 Ga0501047_0000694 3300049581 Bacteria 35179
493 Ga0501047_0166338 3300049581 Bacteria 2075
494 Ga0501048_0008242 3300049582 Bacteria 7884
495 Ga0501048_0426148 3300049582 Bacteria 949
496 Ga0501068_0000204 3300049584 Bacteria 28405
497 Ga0501068_1163337 3300049584 Bacteria 511
498 Ga0501070_0132344 3300049586 Bacteria 2060
499 Ga0501071_0526200 3300049587 Bacteria 907
500 Ga0501073_0896528 3300049589 Archaea 611
501 Ga0501075_0031242 3300049591 Bacteria 3952
502 Ga0501076_0186867 3300049592 Bacteria 1690
503 Ga0501079_0706555 3300049741 Bacteria 794
504 Ga0501081_0853392 3300049743 Bacteria 686
505 Ga0501035_0002182 3300049822 Bacteria 19416
506 Ga0501035_0026271 3300049822 Bacteria 5328
507 Ga0501035_0037373 3300049822 Bacteria 4397
508 Ga0501035_0676001 3300049822 Bacteria 835
509 Ga0501044_0000772 3300049823 Bacteria 38845
510 Ga0501045_0046897 3300049824 Bacteria 3146
511 nmdc:mga03n38_59097_c1 3300050490 Unclassified 1739
512 nmdc:mga00v17_868227_c1 3300050491 Unclassified 572
513 nmdc:mga0yw44_290048_c1 3300050492 Bacteria 1095
514 nmdc:mga06z11_34176_c1 3300050494 Bacteria 2494
515 nmdc:mga04h51_15060_c1 3300050495 Bacteria 2222
516 nmdc:mga05p37_179762_c1 3300050507 Bacteria 2574
517 nmdc:mga05p37_4927_c1 3300050507 Bacteria 15643
518 nmdc:mga05p37_7195_c1 3300050507 Bacteria 13126
519 nmdc:mga05p37_804963_c1 3300050507 Unclassified 1027
520 nmdc:mga09592_165579_c1 3300050508 Bacteria 1911
521 nmdc:mga09592_27589_c1 3300050508 Bacteria 4713
522 nmdc:mga09592_600651_c1 3300050508 Bacteria 943
523 nmdc:mga0qj67_10175_c1 3300050509 Bacteria 7022
524 nmdc:mga0qj67_102208_c1 3300050509 Unclassified 2311
525 nmdc:mga0qj67_187027_c1 3300050509 Bacteria 1683
526 nmdc:mga0qj67_260371_c1 3300050509 Bacteria 1407
527 nmdc:mga0qj67_41346_c2 3300050509 Bacteria 2031
528 nmdc:mga0qj67_84646_c1 3300050509 Bacteria 2543
529 nmdc:mga06r32_12344_c1 3300050510 Bacteria 7705
530 nmdc:mga06r32_124110_c1 3300050510 Unclassified 2549
531 nmdc:mga06r32_12663_c1 3300050510 Bacteria 7623
532 nmdc:mga06r32_132992_c1 3300050510 Bacteria 2461
533 nmdc:mga06r32_155951_c1 3300050510 Bacteria 2264
534 nmdc:mga06r32_169500_c1 3300050510 Bacteria 2167
535 nmdc:mga06r32_17266_c1 3300050510 Bacteria 6588
536 nmdc:mga06r32_2776_c1 3300050510 Bacteria 15677
537 nmdc:mga08y16_13669_c1 3300050511 Bacteria 8547
538 nmdc:mga08y16_809_c1 3300050511 Bacteria 29909
539 nmdc:mga0n895_88021_c1 3300050512 Bacteria 3104
540 nmdc:mga08x19_318401_c1 3300050514 Bacteria 1082
541 nmdc:mga0a205_245158_c1 3300050515 Bacteria 1672
542 Ga0495601_0279698 3300053077 Bacteria 1088
543 Ga0495612_0171953 3300053078 Bacteria 949
544 Ga0495595_0008503 3300053084 Bacteria 4215
545 Ga0500616_0054000 3300053153 Unclassified 2106
546 Ga0587071_141659 3300060344 Bacteria 591
547 Ga0501082_1165776 3300060353 Bacteria 673
548 Ga0501082_1609412 3300060353 Unclassified 567

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048904 Ga0496101_1579229 Ga0496101_1579229_107_496 127
2 3300046809 Ga0495600_0322245 Ga0495600_0322245_146_550 132
3 3300046516 Ga0495628_0625110 Ga0495628_0625110_186_614 137
4 3300005937 Ga0081455_10757664 Ga0081455_107576642 139
5 3300006871 Ga0075434_101069075 Ga0075434_1010690752 142
6 3300047317 Ga0495604_0464404 Ga0495604_0464404_77_511 142
7 iso_pu_bacteria 2510917028 2511185691 144
8 iso_pu_bacteria 2513237088 2513594674 144
9 iso_pu_bacteria 2513237138 2513864739 144
10 iso_pu_bacteria 2534681796 2535516584 144
11 iso_pu_bacteria 2582581294 2585200261 144
12 iso_pu_bacteria 2582581299 2585229912 144
13 iso_pu_bacteria 2582581867 2585402102 144
14 iso_pu_bacteria 2585427590 2585821886 144
15 iso_pu_bacteria 2643221599 2644003846 144
16 iso_pu_bacteria 2643221634 2644192694 144
17 iso_pu_bacteria 2767802442 2770196785 144
18 iso_pu_bacteria 2775506902 2776268844 144
19 iso_pu_bacteria 2775506904 2776284755 144
20 iso_pu_bacteria 2840764183 2840769585 144
21 iso_pu_bacteria 2923556063 2923558022 144
22 iso_pu_bacteria 2954011201 2954014418 144
23 iso_pu_bacteria 2996887358 2996891793 144
24 iso_pu_bacteria 3005452660 3005454297 144
25 iso_pu_bacteria 8005258706 8005263122 144
26 iso_pu_bacteria 8005321885 8005326320 144
27 iso_pu_bacteria 8005542996 8005545238 144
28 iso_pu_bacteria 8024486573 8024492174 144
29 iso_pu_bacteria 2511231027 2511389162 145
30 iso_pu_bacteria 2842871566 2842873232 145
31 3300005341 Ga0070691_10454315 Ga0070691_104543151 147
32 3300005535 Ga0070684_100601499 Ga0070684_1006014992 147
33 3300005937 Ga0081455_10103275 Ga0081455_101032753 147
34 3300006844 Ga0075428_100002056 Ga0075428_10000205611 147
35 3300006844 Ga0075428_100182463 Ga0075428_1001824633 147
36 3300006846 Ga0075430_100031326 Ga0075430_1000313262 147
37 3300006846 Ga0075430_100369915 Ga0075430_1003699151 147
38 3300006847 Ga0075431_100002077 Ga0075431_1000020773 147
39 3300006847 Ga0075431_100523210 Ga0075431_1005232103 147
40 3300006880 Ga0075429_100021858 Ga0075429_1000218582 147
41 3300006880 Ga0075429_100172685 Ga0075429_1001726853 147
42 3300009093 Ga0105240_10407983 Ga0105240_104079831 147
43 3300027907 Ga0207428_10004512 Ga0207428_1000451210 147
44 3300031548 Ga0307408_100037588 Ga0307408_1000375885 147
45 3300031824 Ga0307413_10367231 Ga0307413_103672313 147
46 3300031852 Ga0307410_10582335 Ga0307410_105823352 147
47 3300031995 Ga0307409_100008605 Ga0307409_1000086053 147
48 3300032002 Ga0307416_100076784 Ga0307416_1000767843 147
49 3300032005 Ga0307411_10012283 Ga0307411_100122832 147
50 3300041451 Ga0451791_1630542 Ga0451791_1630542_215_658 147
51 3300041491 Ga0451833_1389789 Ga0451833_1389789_50_493 147
52 3300042461 Ga0439460_0243015 Ga0439460_0243015_52_501 147
53 3300050507 nmdc:mga05p37_4927_c1 nmdc:mga05p37_4927_c1_14992_15441 147
54 3300050508 nmdc:mga09592_165579_c1 nmdc:mga09592_165579_c1_990_1433 147
55 3300050508 nmdc:mga09592_27589_c1 nmdc:mga09592_27589_c1_396_845 147
56 3300050509 nmdc:mga0qj67_10175_c1 nmdc:mga0qj67_10175_c1_1792_2235 147
57 3300050509 nmdc:mga0qj67_84646_c1 nmdc:mga0qj67_84646_c1_1944_2393 147
58 3300050510 nmdc:mga06r32_12344_c1 nmdc:mga06r32_12344_c1_3652_4095 147
59 3300050510 nmdc:mga06r32_2776_c1 nmdc:mga06r32_2776_c1_12219_12668 147
60 3300050511 nmdc:mga08y16_809_c1 nmdc:mga08y16_809_c1_14955_15404 147
61 3300002773 JGI25152J39213_1012654 JGI25152J39213_10126543 148
62 3300003354 JGI25160J50197_1031397 JGI25160J50197_10313971 148
63 3300003771 Ga0055526_1011463 Ga0055526_10114635 148
64 3300003790 Ga0055528_1004541 Ga0055528_10045418 148
65 3300003792 Ga0055540_1067993 Ga0055540_10679931 148
66 3300005328 Ga0070676_10950167 Ga0070676_109501671 148
67 3300005329 Ga0070683_101027547 Ga0070683_1010275471 148
68 3300005330 Ga0070690_100022068 Ga0070690_1000220684 148
69 3300005333 Ga0070677_10016340 Ga0070677_100163404 148
70 3300005335 Ga0070666_10000962 Ga0070666_1000096214 148
71 3300005338 Ga0068868_100022375 Ga0068868_1000223752 148
72 3300005338 Ga0068868_100865246 Ga0068868_1008652462 148
73 3300005340 Ga0070689_100251693 Ga0070689_1002516933 148
74 3300005344 Ga0070661_100208293 Ga0070661_1002082933 148
75 3300005344 Ga0070661_100304511 Ga0070661_1003045112 148
76 3300005353 Ga0070669_100091756 Ga0070669_1000917563 148
77 3300005355 Ga0070671_100074455 Ga0070671_1000744553 148
78 3300005355 Ga0070671_100114706 Ga0070671_1001147063 148
79 3300005355 Ga0070671_100307391 Ga0070671_1003073912 148
80 3300005356 Ga0070674_100035121 Ga0070674_1000351212 148
81 3300005364 Ga0070673_100236897 Ga0070673_1002368971 148
82 3300005364 Ga0070673_101321896 Ga0070673_1013218961 148
83 3300005366 Ga0070659_100433262 Ga0070659_1004332622 148
84 3300005366 Ga0070659_100893356 Ga0070659_1008933562 148
85 3300005367 Ga0070667_100073864 Ga0070667_1000738642 148
86 3300005367 Ga0070667_100142935 Ga0070667_1001429351 148
87 3300005434 Ga0070709_10002678 Ga0070709_100026789 148
88 3300005436 Ga0070713_100004406 Ga0070713_1000044065 148
89 3300005436 Ga0070713_102058284 Ga0070713_1020582841 148
90 3300005437 Ga0070710_10079154 Ga0070710_100791541 148
91 3300005437 Ga0070710_11245644 Ga0070710_112456441 148
92 3300005439 Ga0070711_100011036 Ga0070711_1000110363 148
93 3300005439 Ga0070711_100025508 Ga0070711_1000255083 148
94 3300005440 Ga0070705_100248063 Ga0070705_1002480632 148
95 3300005444 Ga0070694_100265539 Ga0070694_1002655392 148
96 3300005445 Ga0070708_100809391 Ga0070708_1008093911 148
97 3300005455 Ga0070663_100013612 Ga0070663_1000136122 148
98 3300005456 Ga0070678_100001882 Ga0070678_1000018822 148
99 3300005457 Ga0070662_100845552 Ga0070662_1008455521 148
100 3300005458 Ga0070681_10000738 Ga0070681_100007385 148
101 3300005458 Ga0070681_11911975 Ga0070681_119119751 148
102 3300005459 Ga0068867_100046831 Ga0068867_1000468312 148
103 3300005459 Ga0068867_100747382 Ga0068867_1007473822 148
104 3300005467 Ga0070706_100523251 Ga0070706_1005232512 148
105 3300005518 Ga0070699_100101141 Ga0070699_1001011413 148
106 3300005518 Ga0070699_100462088 Ga0070699_1004620882 148
107 3300005530 Ga0070679_100858161 Ga0070679_1008581612 148
108 3300005536 Ga0070697_100226244 Ga0070697_1002262443 148
109 3300005543 Ga0070672_100004419 Ga0070672_10000441910 148
110 3300005544 Ga0070686_100100765 Ga0070686_1001007651 148
111 3300005544 Ga0070686_101398640 Ga0070686_1013986401 148
112 3300005545 Ga0070695_100001122 Ga0070695_10000112213 148
113 3300005545 Ga0070695_100444144 Ga0070695_1004441442 148
114 3300005545 Ga0070695_100569520 Ga0070695_1005695202 148
115 3300005546 Ga0070696_100081554 Ga0070696_1000815544 148
116 3300005546 Ga0070696_100198021 Ga0070696_1001980212 148
117 3300005546 Ga0070696_100228251 Ga0070696_1002282512 148
118 3300005547 Ga0070693_100260896 Ga0070693_1002608962 148
119 3300005548 Ga0070665_100006732 Ga0070665_1000067323 148
120 3300005548 Ga0070665_100040389 Ga0070665_1000403894 148
121 3300005548 Ga0070665_101417716 Ga0070665_1014177161 148
122 3300005563 Ga0068855_100157265 Ga0068855_1001572653 148
123 3300005563 Ga0068855_100969582 Ga0068855_1009695822 148
124 3300005564 Ga0070664_100125381 Ga0070664_1001253812 148
125 3300005564 Ga0070664_100230791 Ga0070664_1002307913 148
126 3300005577 Ga0068857_100042715 Ga0068857_1000427153 148
127 3300005578 Ga0068854_100382419 Ga0068854_1003824193 148
128 3300005614 Ga0068856_100061025 Ga0068856_1000610251 148
129 3300005616 Ga0068852_100793475 Ga0068852_1007934752 148
130 3300005617 Ga0068859_101079688 Ga0068859_1010796881 148
131 3300005718 Ga0068866_10064790 Ga0068866_100647902 148
132 3300005719 Ga0068861_101385785 Ga0068861_1013857852 148
133 3300005834 Ga0068851_10648177 Ga0068851_106481771 148
134 3300005840 Ga0068870_10372571 Ga0068870_103725712 148
135 3300005841 Ga0068863_100113370 Ga0068863_1001133702 148
136 3300005842 Ga0068858_100322543 Ga0068858_1003225432 148
137 3300005843 Ga0068860_100561455 Ga0068860_1005614553 148
138 3300005937 Ga0081455_10000058 Ga0081455_10000058101 148
139 3300005937 Ga0081455_10007344 Ga0081455_100073447 148
140 3300005937 Ga0081455_10140763 Ga0081455_101407632 148
141 3300005983 Ga0081540_1014811 Ga0081540_10148114 148
142 3300005983 Ga0081540_1142939 Ga0081540_11429392 148
143 3300006038 Ga0075365_10002801 Ga0075365_100028017 148
144 3300006038 Ga0075365_10003928 Ga0075365_100039287 148
145 3300006042 Ga0075368_10025213 Ga0075368_100252134 148
146 3300006048 Ga0075363_100105906 Ga0075363_1001059064 148
147 3300006051 Ga0075364_10991509 Ga0075364_109915092 148
148 3300006163 Ga0070715_10000714 Ga0070715_100007143 148
149 3300006173 Ga0070716_100000449 Ga0070716_10000044913 148
150 3300006173 Ga0070716_101121380 Ga0070716_1011213802 148
151 3300006175 Ga0070712_100045298 Ga0070712_1000452981 148
152 3300006175 Ga0070712_100053492 Ga0070712_1000534922 148
153 3300006178 Ga0075367_10003265 Ga0075367_100032655 148
154 3300006178 Ga0075367_10017321 Ga0075367_100173214 148
155 3300006237 Ga0097621_100471631 Ga0097621_1004716311 148
156 3300006237 Ga0097621_100683175 Ga0097621_1006831752 148
157 3300006353 Ga0075370_10079548 Ga0075370_100795482 148
158 3300006358 Ga0068871_100028714 Ga0068871_1000287144 148
159 3300006358 Ga0068871_100435582 Ga0068871_1004355822 148
160 3300006844 Ga0075428_100002982 Ga0075428_10000298213 148
161 3300006844 Ga0075428_100042255 Ga0075428_1000422551 148
162 3300006844 Ga0075428_101526460 Ga0075428_1015264602 148
163 3300006844 Ga0075428_102671727 Ga0075428_1026717271 148
164 3300006846 Ga0075430_100052103 Ga0075430_1000521032 148
165 3300006846 Ga0075430_100100928 Ga0075430_1001009282 148
166 3300006846 Ga0075430_100102549 Ga0075430_1001025493 148
167 3300006846 Ga0075430_100201744 Ga0075430_1002017443 148
168 3300006847 Ga0075431_100006590 Ga0075431_1000065908 148
169 3300006847 Ga0075431_100016829 Ga0075431_1000168298 148
170 3300006847 Ga0075431_100028315 Ga0075431_1000283156 148
171 3300006847 Ga0075431_100042943 Ga0075431_1000429435 148
172 3300006847 Ga0075431_100049592 Ga0075431_1000495923 148
173 3300006847 Ga0075431_100168676 Ga0075431_1001686764 148
174 3300006847 Ga0075431_100847326 Ga0075431_1008473262 148
175 3300006852 Ga0075433_10222785 Ga0075433_102227853 148
176 3300006871 Ga0075434_100063914 Ga0075434_1000639145 148
177 3300006880 Ga0075429_100130137 Ga0075429_1001301372 148
178 3300006880 Ga0075429_100410176 Ga0075429_1004101762 148
179 3300006881 Ga0068865_100005989 Ga0068865_1000059892 148
180 3300006914 Ga0075436_100350865 Ga0075436_1003508652 148
181 3300006931 Ga0097620_101079741 Ga0097620_1010797411 148
182 3300007265 Ga0099794_10025383 Ga0099794_100253833 148
183 3300007265 Ga0099794_10309009 Ga0099794_103090091 148
184 3300007788 Ga0099795_10029751 Ga0099795_100297512 148
185 3300007788 Ga0099795_10289595 Ga0099795_102895952 148
186 3300009093 Ga0105240_10447965 Ga0105240_104479652 148
187 3300009094 Ga0111539_10001638 Ga0111539_1000163815 148
188 3300009094 Ga0111539_10029477 Ga0111539_100294774 148
189 3300009094 Ga0111539_10131177 Ga0111539_101311774 148
190 3300009094 Ga0111539_10749568 Ga0111539_107495683 148
191 3300009094 Ga0111539_10770570 Ga0111539_107705702 148
192 3300009094 Ga0111539_11884412 Ga0111539_118844121 148
193 3300009098 Ga0105245_10093791 Ga0105245_100937913 148
194 3300009098 Ga0105245_10426310 Ga0105245_104263102 148
195 3300009101 Ga0105247_10118868 Ga0105247_101188682 148
196 3300009101 Ga0105247_11483787 Ga0105247_114837871 148
197 3300009147 Ga0114129_10001489 Ga0114129_1000148931 148
198 3300009147 Ga0114129_10004660 Ga0114129_100046604 148
199 3300009147 Ga0114129_10477306 Ga0114129_104773062 148
200 3300009147 Ga0114129_10808824 Ga0114129_108088242 148
201 3300009147 Ga0114129_10893575 Ga0114129_108935752 148
202 3300009148 Ga0105243_10632277 Ga0105243_106322772 148
203 3300009148 Ga0105243_10791127 Ga0105243_107911271 148
204 3300009174 Ga0105241_10107114 Ga0105241_101071142 148
205 3300009176 Ga0105242_10006693 Ga0105242_100066934 148
206 3300009177 Ga0105248_10075639 Ga0105248_100756391 148
207 3300009177 Ga0105248_10349716 Ga0105248_103497162 148
208 3300009177 Ga0105248_10737052 Ga0105248_107370523 148
209 3300009551 Ga0105238_10090370 Ga0105238_100903702 148
210 3300009551 Ga0105238_11620403 Ga0105238_116204031 148
211 3300009553 Ga0105249_10376884 Ga0105249_103768842 148
212 3300009765 Ga0123341_1082672 Ga0123341_10826722 148
213 3300010375 Ga0105239_10005723 Ga0105239_1000572313 148
214 3300010375 Ga0105239_11145562 Ga0105239_111455622 148
215 3300010375 Ga0105239_11196080 Ga0105239_111960801 148
216 3300011119 Ga0105246_10910273 Ga0105246_109102732 148
217 3300013104 Ga0157370_10705633 Ga0157370_107056331 148
218 3300013105 Ga0157369_10599373 Ga0157369_105993732 148
219 3300013296 Ga0157374_10112983 Ga0157374_101129832 148
220 3300013296 Ga0157374_10336352 Ga0157374_103363522 148
221 3300013296 Ga0157374_10876428 Ga0157374_108764282 148
222 3300013306 Ga0163162_12349182 Ga0163162_123491821 148
223 3300013307 Ga0157372_10085393 Ga0157372_100853932 148
224 3300013308 Ga0157375_10184171 Ga0157375_101841714 148
225 3300013308 Ga0157375_11575729 Ga0157375_115757292 148
226 3300013308 Ga0157375_11666893 Ga0157375_116668931 148
227 3300013308 Ga0157375_12013204 Ga0157375_120132041 148
228 3300013308 Ga0157375_12128558 Ga0157375_121285581 148
229 3300014325 Ga0163163_10135016 Ga0163163_101350162 148
230 3300014325 Ga0163163_10233078 Ga0163163_102330781 148
231 3300014968 Ga0157379_10022250 Ga0157379_100222504 148
232 3300014968 Ga0157379_10383580 Ga0157379_103835803 148
233 3300014968 Ga0157379_11237378 Ga0157379_112373782 148
234 3300014969 Ga0157376_10960342 Ga0157376_109603422 148
235 3300020081 Ga0206354_10229693 Ga0206354_102296938 148
236 3300020082 Ga0206353_11805231 Ga0206353_118052317 148
237 3300021361 Ga0213872_10001236 Ga0213872_1000123621 148
238 3300021384 Ga0213876_10295429 Ga0213876_102954291 148
239 3300025258 Ga0209129_1004672 Ga0209129_10046724 148
240 3300025273 Ga0209673_1003809 Ga0209673_10038095 148
241 3300025284 Ga0209130_1011356 Ga0209130_10113564 148
242 3300025294 Ga0209025_1033874 Ga0209025_10338744 148
243 3300025294 Ga0209025_1086326 Ga0209025_10863263 148
244 3300025294 Ga0209025_1104260 Ga0209025_11042601 148
245 3300025295 Ga0209564_1018176 Ga0209564_10181764 148
246 3300025297 Ga0209758_1015852 Ga0209758_10158521 148
247 3300025299 Ga0209256_1014803 Ga0209256_10148034 148
248 3300025302 Ga0207426_1002621 Ga0207426_100262110 148
249 3300025303 Ga0209051_1015244 Ga0209051_10152444 148
250 3300025893 Ga0207682_10084409 Ga0207682_100844092 148
251 3300025898 Ga0207692_10155172 Ga0207692_101551722 148
252 3300025899 Ga0207642_10004598 Ga0207642_100045983 148
253 3300025905 Ga0207685_10043801 Ga0207685_100438011 148
254 3300025905 Ga0207685_10061127 Ga0207685_100611272 148
255 3300025906 Ga0207699_10071415 Ga0207699_100714151 148
256 3300025907 Ga0207645_10008093 Ga0207645_100080935 148
257 3300025911 Ga0207654_10268856 Ga0207654_102688562 148
258 3300025911 Ga0207654_10274218 Ga0207654_102742181 148
259 3300025912 Ga0207707_10001614 Ga0207707_100016144 148
260 3300025913 Ga0207695_10377655 Ga0207695_103776552 148
261 3300025915 Ga0207693_10000083 Ga0207693_1000008329 148
262 3300025915 Ga0207693_10204486 Ga0207693_102044862 148
263 3300025918 Ga0207662_10295032 Ga0207662_102950322 148
264 3300025920 Ga0207649_10293112 Ga0207649_102931122 148
265 3300025921 Ga0207652_10916467 Ga0207652_109164672 148
266 3300025923 Ga0207681_10221419 Ga0207681_102214191 148
267 3300025923 Ga0207681_10431226 Ga0207681_104312262 148
268 3300025924 Ga0207694_10149723 Ga0207694_101497232 148
269 3300025927 Ga0207687_10028228 Ga0207687_100282284 148
270 3300025928 Ga0207700_10286606 Ga0207700_102866062 148
271 3300025929 Ga0207664_10146050 Ga0207664_101460504 148
272 3300025931 Ga0207644_10043415 Ga0207644_100434154 148
273 3300025931 Ga0207644_10137714 Ga0207644_101377143 148
274 3300025931 Ga0207644_10248764 Ga0207644_102487641 148
275 3300025932 Ga0207690_11417920 Ga0207690_114179201 148
276 3300025932 Ga0207690_11544576 Ga0207690_115445761 148
277 3300025933 Ga0207706_10003176 Ga0207706_100031765 148
278 3300025933 Ga0207706_11083920 Ga0207706_110839202 148
279 3300025934 Ga0207686_10132872 Ga0207686_101328722 148
280 3300025935 Ga0207709_10624142 Ga0207709_106241422 148
281 3300025937 Ga0207669_10257157 Ga0207669_102571572 148
282 3300025938 Ga0207704_10250025 Ga0207704_102500253 148
283 3300025939 Ga0207665_10000587 Ga0207665_1000058712 148
284 3300025939 Ga0207665_10037791 Ga0207665_100377913 148
285 3300025939 Ga0207665_11036317 Ga0207665_110363171 148
286 3300025940 Ga0207691_10016487 Ga0207691_100164877 148
287 3300025941 Ga0207711_10193825 Ga0207711_101938252 148
288 3300025941 Ga0207711_10429180 Ga0207711_104291802 148
289 3300025944 Ga0207661_10222430 Ga0207661_102224302 148
290 3300025949 Ga0207667_10082789 Ga0207667_100827893 148
291 3300025949 Ga0207667_10608458 Ga0207667_106084581 148
292 3300025960 Ga0207651_10246098 Ga0207651_102460982 148
293 3300025960 Ga0207651_11031578 Ga0207651_110315781 148
294 3300025960 Ga0207651_12019629 Ga0207651_120196291 148
295 3300025961 Ga0207712_11256785 Ga0207712_112567851 148
296 3300025972 Ga0207668_10087746 Ga0207668_100877462 148
297 3300025972 Ga0207668_10351362 Ga0207668_103513622 148
298 3300025981 Ga0207640_10551823 Ga0207640_105518232 148
299 3300025986 Ga0207658_10146136 Ga0207658_101461362 148
300 3300026023 Ga0207677_10118489 Ga0207677_101184892 148
301 3300026075 Ga0207708_10193947 Ga0207708_101939472 148
302 3300026078 Ga0207702_10138353 Ga0207702_101383533 148
303 3300026088 Ga0207641_10345799 Ga0207641_103457992 148
304 3300026088 Ga0207641_11812181 Ga0207641_118121811 148
305 3300026089 Ga0207648_10003167 Ga0207648_1000316717 148
306 3300026116 Ga0207674_10020062 Ga0207674_100200624 148
307 3300026116 Ga0207674_10818338 Ga0207674_108183381 148
308 3300026118 Ga0207675_100004907 Ga0207675_1000049075 148
309 3300026118 Ga0207675_100658016 Ga0207675_1006580161 148
310 3300026121 Ga0207683_10002455 Ga0207683_1000245511 148
311 3300026142 Ga0207698_10994972 Ga0207698_109949722 148
312 3300027682 Ga0209971_1004557 Ga0209971_10045573 148
313 3300027717 Ga0209998_10005976 Ga0209998_100059763 148
314 3300027866 Ga0209813_10009170 Ga0209813_100091704 148
315 3300027907 Ga0207428_10067272 Ga0207428_100672724 148
316 3300027907 Ga0207428_10386451 Ga0207428_103864512 148
317 3300028379 Ga0268266_10019128 Ga0268266_100191282 148
318 3300031344 Ga0265316_10447276 Ga0265316_104472761 148
319 3300031548 Ga0307408_100468991 Ga0307408_1004689911 148
320 3300031548 Ga0307408_100910328 Ga0307408_1009103281 148
321 3300031824 Ga0307413_10104459 Ga0307413_101044592 148
322 3300032004 Ga0307414_10119131 Ga0307414_101191313 148
323 3300032005 Ga0307411_11441235 Ga0307411_114412352 148
324 3300032126 Ga0307415_100277662 Ga0307415_1002776622 148
325 3300032126 Ga0307415_102178040 Ga0307415_1021780402 148
326 3300035083 Ga0373926_0067873 Ga0373926_0067873_128_574 148
327 3300035088 Ga0373940_0062800 Ga0373940_0062800_440_892 148
328 3300035090 Ga0373949_0086013 Ga0373949_0086013_296_748 148
329 3300035111 Ga0373923_0182297 Ga0373923_0182297_267_719 148
330 3300035117 Ga0373953_0079389 Ga0373953_0079389_196_648 148
331 3300035117 Ga0373953_0124344 Ga0373953_0124344_347_799 148
332 3300035118 Ga0373954_0117613 Ga0373954_0117613_555_1007 148
333 3300035170 Ga0373943_0442803 Ga0373943_0442803_17_469 148
334 3300035172 Ga0373955_0015905 Ga0373955_0015905_3188_3640 148
335 3300035172 Ga0373955_0119699 Ga0373955_0119699_778_1230 148
336 3300035241 Ga0373961_0195311 Ga0373961_0195311_33_485 148
337 3300035692 Ga0373935_0828266 Ga0373935_0828266_192_638 148
338 3300035695 Ga0373927_0000772 Ga0373927_0000772_12895_13341 148
339 3300035695 Ga0373927_0064997 Ga0373927_0064997_1893_2345 148
340 3300035695 Ga0373927_0259811 Ga0373927_0259811_29_481 148
341 3300035724 Ga0373933_0038327 Ga0373933_0038327_295_747 148
342 3300036401 Ga0373937_0006608 Ga0373937_0006608_350_802 148
343 3300036401 Ga0373937_0049306 Ga0373937_0049306_1076_1528 148
344 3300036401 Ga0373937_0190795 Ga0373937_0190795_95_547 148
345 3300036401 Ga0373937_0513343 Ga0373937_0513343_69_521 148
346 3300036401 Ga0373937_1998775 Ga0373937_1998775_40_486 148
347 3300037312 Ga0395899_0005256 Ga0395899_0005256_9404_9871 148
348 3300037312 Ga0395899_0008193 Ga0395899_0008193_4802_5269 148
349 3300037418 Ga0395900_0009362 Ga0395900_0009362_4850_5317 148
350 3300037418 Ga0395900_0376114 Ga0395900_0376114_610_1068 148
351 3300037466 Ga0395898_0095189 Ga0395898_0095189_1472_1939 148
352 3300037466 Ga0395898_0357957 Ga0395898_0357957_796_1263 148
353 3300037471 Ga0395905_0168442 Ga0395905_0168442_1251_1718 148
354 3300037853 Ga0436364_1204884 Ga0436364_1204884_1671_2123 148
355 3300038443 Ga0395901_0020564 Ga0395901_0020564_4846_5313 148
356 3300039437 Ga0436365_0340625 Ga0436365_0340625_620_1072 148
357 3300039437 Ga0436365_0701502 Ga0436365_0701502_302_754 148
358 3300039438 Ga0436360_0122890 Ga0436360_0122890_97_555 148
359 3300039438 Ga0436360_0352942 Ga0436360_0352942_468_923 148
360 3300039438 Ga0436360_1031893 Ga0436360_1031893_279_731 148
361 3300039438 Ga0436360_1170569 Ga0436360_1170569_126_578 148
362 3300039447 Ga0436361_1165271 Ga0436361_1165271_8479_8931 148
363 3300039453 Ga0436362_0170168 Ga0436362_0170168_275_727 148
364 3300041413 Ga0439465_0130887 Ga0439465_0130887_374_826 148
365 3300041505 Ga0451849_0967899 Ga0451849_0967899_188_634 148
366 3300042133 Ga0450896_035893 Ga0450896_035893_37_498 148
367 3300042436 Ga0439435_0075695 Ga0439435_0075695_411_872 148
368 3300044842 Ga0466957_0430041 Ga0466957_0430041_15_479 148
369 3300045976 Ga0466967_1890625 Ga0466967_1890625_94_546 148
370 3300046454 Ga0495592_0012377 Ga0495592_0012377_4785_5246 148
371 3300046454 Ga0495592_0541624 Ga0495592_0541624_41_493 148
372 3300046462 Ga0495651_0402896 Ga0495651_0402896_253_705 148
373 3300046471 Ga0495650_0087307 Ga0495650_0087307_201_653 148
374 3300046472 Ga0495580_0002317 Ga0495580_0002317_7576_8028 148
375 3300046472 Ga0495580_0028129 Ga0495580_0028129_2626_3078 148
376 3300046472 Ga0495580_0032532 Ga0495580_0032532_754_1206 148
377 3300046477 Ga0495664_0673948 Ga0495664_0673948_121_573 148
378 3300046492 Ga0495585_0374396 Ga0495585_0374396_28_474 148
379 3300046499 Ga0495594_0486821 Ga0495594_0486821_22_468 148
380 3300046506 Ga0495583_0125424 Ga0495583_0125424_181_627 148
381 3300046507 Ga0495606_0294405 Ga0495606_0294405_220_672 148
382 3300046507 Ga0495606_0361544 Ga0495606_0361544_135_581 148
383 3300046511 Ga0495608_0100505 Ga0495608_0100505_794_1246 148
384 3300046516 Ga0495628_0192642 Ga0495628_0192642_1075_1527 148
385 3300046535 Ga0495586_0506526 Ga0495586_0506526_39_491 148
386 3300046543 Ga0495645_0129976 Ga0495645_0129976_691_1143 148
387 3300046559 Ga0495667_0007136 Ga0495667_0007136_1641_2093 148
388 3300046616 Ga0495668_0019219 Ga0495668_0019219_2635_3081 148
389 3300046660 Ga0495625_0143701 Ga0495625_0143701_554_1000 148
390 3300046675 Ga0495657_0038547 Ga0495657_0038547_462_914 148
391 3300046675 Ga0495657_0146608 Ga0495657_0146608_78_530 148
392 3300046675 Ga0495657_0206296 Ga0495657_0206296_551_1003 148
393 3300046678 Ga0495599_0263458 Ga0495599_0263458_522_974 148
394 3300046679 Ga0495623_0243639 Ga0495623_0243639_405_857 148
395 3300046681 Ga0495647_0239224 Ga0495647_0239224_301_753 148
396 3300046683 Ga0495658_0227048 Ga0495658_0227048_290_742 148
397 3300046809 Ga0495600_0149144 Ga0495600_0149144_325_777 148
398 3300047317 Ga0495604_0177444 Ga0495604_0177444_240_701 148
399 3300047319 Ga0495674_0172755 Ga0495674_0172755_1239_1691 148
400 3300047322 Ga0495680_0000817 Ga0495680_0000817_32945_33397 148
401 3300047444 Ga0495675_0007417 Ga0495675_0007417_5883_6335 148
402 3300047471 Ga0495684_0213231 Ga0495684_0213231_127_579 148
403 3300047472 Ga0495686_0040857 Ga0495686_0040857_1298_1744 148
404 3300047472 Ga0495686_0171809 Ga0495686_0171809_310_756 148
405 3300048088 Ga0495602_0229751 Ga0495602_0229751_914_1366 148
406 3300048088 Ga0495602_0705771 Ga0495602_0705771_103_555 148
407 3300048088 Ga0495602_1053812 Ga0495602_1053812_51_503 148
408 3300048903 Ga0496100_0099797 Ga0496100_0099797_464_916 148
409 3300048903 Ga0496100_0159739 Ga0496100_0159739_902_1354 148
410 3300048903 Ga0496100_0292265 Ga0496100_0292265_389_841 148
411 3300048904 Ga0496101_0002781 Ga0496101_0002781_6767_7219 148
412 3300048904 Ga0496101_0458546 Ga0496101_0458546_295_747 148
413 3300048905 Ga0496102_0079333 Ga0496102_0079333_608_1060 148
414 3300048907 Ga0496104_0122439 Ga0496104_0122439_357_809 148
415 3300048907 Ga0496104_0163771 Ga0496104_0163771_1083_1535 148
416 3300048907 Ga0496104_0351360 Ga0496104_0351360_427_879 148
417 3300048908 Ga0496105_0060265 Ga0496105_0060265_1220_1672 148
418 3300048909 Ga0496106_0019073 Ga0496106_0019073_703_1155 148
419 3300048909 Ga0496106_0474679 Ga0496106_0474679_389_841 148
420 3300048910 Ga0496107_0001015 Ga0496107_0001015_14801_15253 148
421 3300048910 Ga0496107_0479908 Ga0496107_0479908_410_862 148
422 3300048910 Ga0496107_0531169 Ga0496107_0531169_96_548 148
423 3300048911 Ga0496108_0038274 Ga0496108_0038274_734_1186 148
424 3300048911 Ga0496108_1072265 Ga0496108_1072265_43_495 148
425 3300048912 Ga0496109_0220308 Ga0496109_0220308_1301_1753 148
426 3300048912 Ga0496109_0438409 Ga0496109_0438409_329_781 148
427 3300048913 Ga0496110_0000749 Ga0496110_0000749_6775_7227 148
428 3300048913 Ga0496110_1622786 Ga0496110_1622786_74_526 148
429 3300048914 Ga0496111_0262853 Ga0496111_0262853_585_1037 148
430 3300048915 Ga0496112_0005843 Ga0496112_0005843_4668_5120 148
431 3300048915 Ga0496112_0138398 Ga0496112_0138398_138_590 148
432 3300048915 Ga0496112_0685121 Ga0496112_0685121_450_902 148
433 3300048916 Ga0496113_0036857 Ga0496113_0036857_2245_2697 148
434 3300048916 Ga0496113_1529551 Ga0496113_1529551_34_486 148
435 3300048917 Ga0496114_0001864 Ga0496114_0001864_12691_13143 148
436 3300048917 Ga0496114_0580000 Ga0496114_0580000_274_720 148
437 3300048918 Ga0496115_0131209 Ga0496115_0131209_1563_2015 148
438 3300049568 Ga0501031_0032810 Ga0501031_0032810_1861_2313 148
439 3300049568 Ga0501031_0038007 Ga0501031_0038007_2073_2525 148
440 3300049569 Ga0501032_0000347 Ga0501032_0000347_12664_13116 148
441 3300049570 Ga0501033_0001128 Ga0501033_0001128_22199_22651 148
442 3300049570 Ga0501033_0017584 Ga0501033_0017584_817_1269 148
443 3300049570 Ga0501033_0019916 Ga0501033_0019916_1285_1737 148
444 3300049572 Ga0501036_0000478 Ga0501036_0000478_25883_26335 148
445 3300049572 Ga0501036_0005040 Ga0501036_0005040_4210_4662 148
446 3300049572 Ga0501036_0077004 Ga0501036_0077004_1267_1719 148
447 3300049573 Ga0501037_0000473 Ga0501037_0000473_25597_26049 148
448 3300049573 Ga0501037_0092458 Ga0501037_0092458_47_499 148
449 3300049573 Ga0501037_0874143 Ga0501037_0874143_24_476 148
450 3300049574 Ga0501038_0004697 Ga0501038_0004697_5031_5483 148
451 3300049574 Ga0501038_0044079 Ga0501038_0044079_2892_3344 148
452 3300049574 Ga0501038_0080123 Ga0501038_0080123_1973_2425 148
453 3300049574 Ga0501038_0236005 Ga0501038_0236005_379_831 148
454 3300049575 Ga0501039_0001356 Ga0501039_0001356_15965_16417 148
455 3300049575 Ga0501039_0316871 Ga0501039_0316871_325_777 148
456 3300049576 Ga0501040_0000822 Ga0501040_0000822_2498_2950 148
457 3300049578 Ga0501042_0003268 Ga0501042_0003268_7205_7657 148
458 3300049579 Ga0501043_0000887 Ga0501043_0000887_487_939 148
459 3300049579 Ga0501043_0033954 Ga0501043_0033954_1682_2134 148
460 3300049580 Ga0501046_0000045 Ga0501046_0000045_26428_26889 148
461 3300049580 Ga0501046_0002039 Ga0501046_0002039_16457_16909 148
462 3300049580 Ga0501046_0266000 Ga0501046_0266000_310_762 148
463 3300049581 Ga0501047_0000694 Ga0501047_0000694_25407_25859 148
464 3300049581 Ga0501047_0166338 Ga0501047_0166338_1503_1955 148
465 3300049582 Ga0501048_0008242 Ga0501048_0008242_2511_2963 148
466 3300049582 Ga0501048_0426148 Ga0501048_0426148_425_877 148
467 3300049584 Ga0501068_0000204 Ga0501068_0000204_2511_2963 148
468 3300049586 Ga0501070_0132344 Ga0501070_0132344_307_759 148
469 3300049587 Ga0501071_0526200 Ga0501071_0526200_156_608 148
470 3300049591 Ga0501075_0031242 Ga0501075_0031242_2189_2641 148
471 3300049592 Ga0501076_0186867 Ga0501076_0186867_175_627 148
472 3300049741 Ga0501079_0706555 Ga0501079_0706555_214_666 148
473 3300049822 Ga0501035_0002182 Ga0501035_0002182_2511_2963 148
474 3300049822 Ga0501035_0026271 Ga0501035_0026271_2287_2739 148
475 3300049822 Ga0501035_0037373 Ga0501035_0037373_328_780 148
476 3300049822 Ga0501035_0676001 Ga0501035_0676001_185_637 148
477 3300049823 Ga0501044_0000772 Ga0501044_0000772_25407_25859 148
478 3300049824 Ga0501045_0046897 Ga0501045_0046897_199_651 148
479 3300050490 nmdc:mga03n38_59097_c1 nmdc:mga03n38_59097_c1_345_797 148
480 3300050491 nmdc:mga00v17_868227_c1 nmdc:mga00v17_868227_c1_48_494 148
481 3300050492 nmdc:mga0yw44_290048_c1 nmdc:mga0yw44_290048_c1_609_1067 148
482 3300050494 nmdc:mga06z11_34176_c1 nmdc:mga06z11_34176_c1_1396_1848 148
483 3300050495 nmdc:mga04h51_15060_c1 nmdc:mga04h51_15060_c1_1485_1937 148
484 3300050507 nmdc:mga05p37_7195_c1 nmdc:mga05p37_7195_c1_4724_5176 148
485 3300050507 nmdc:mga05p37_804963_c1 nmdc:mga05p37_804963_c1_375_833 148
486 3300050508 nmdc:mga09592_600651_c1 nmdc:mga09592_600651_c1_174_635 148
487 3300050509 nmdc:mga0qj67_102208_c1 nmdc:mga0qj67_102208_c1_840_1298 148
488 3300050509 nmdc:mga0qj67_187027_c1 nmdc:mga0qj67_187027_c1_262_723 148
489 3300050509 nmdc:mga0qj67_260371_c1 nmdc:mga0qj67_260371_c1_851_1303 148
490 3300050509 nmdc:mga0qj67_41346_c2 nmdc:mga0qj67_41346_c2_475_927 148
491 3300050510 nmdc:mga06r32_124110_c1 nmdc:mga06r32_124110_c1_62_520 148
492 3300050510 nmdc:mga06r32_12663_c1 nmdc:mga06r32_12663_c1_3651_4112 148
493 3300050510 nmdc:mga06r32_132992_c1 nmdc:mga06r32_132992_c1_367_828 148
494 3300050510 nmdc:mga06r32_155951_c1 nmdc:mga06r32_155951_c1_1484_1936 148
495 3300050510 nmdc:mga06r32_169500_c1 nmdc:mga06r32_169500_c1_1363_1824 148
496 3300050510 nmdc:mga06r32_17266_c1 nmdc:mga06r32_17266_c1_869_1321 148
497 3300050511 nmdc:mga08y16_13669_c1 nmdc:mga08y16_13669_c1_2095_2547 148
498 3300050512 nmdc:mga0n895_88021_c1 nmdc:mga0n895_88021_c1_1533_1985 148
499 3300050514 nmdc:mga08x19_318401_c1 nmdc:mga08x19_318401_c1_495_947 148
500 3300050515 nmdc:mga0a205_245158_c1 nmdc:mga0a205_245158_c1_280_732 148
501 3300053077 Ga0495601_0279698 Ga0495601_0279698_275_727 148
502 3300053078 Ga0495612_0171953 Ga0495612_0171953_470_922 148
503 3300053084 Ga0495595_0008503 Ga0495595_0008503_300_752 148
504 3300053153 Ga0500616_0054000 Ga0500616_0054000_1636_2088 148
505 3300060344 Ga0587071_141659 Ga0587071_141659_16_462 148
506 3300060353 Ga0501082_1165776 Ga0501082_1165776_151_603 148
507 3300001979 JGI24740J21852_10071177 JGI24740J21852_100711772 149
508 3300001989 JGI24739J22299_10006377 JGI24739J22299_100063777 149
509 3300001990 JGI24737J22298_10036113 JGI24737J22298_100361132 149
510 3300005440 Ga0070705_100332453 Ga0070705_1003324531 149
511 3300005457 Ga0070662_100050121 Ga0070662_1000501213 149
512 3300005467 Ga0070706_101558844 Ga0070706_1015588441 149
513 3300005471 Ga0070698_100584211 Ga0070698_1005842112 149
514 3300005539 Ga0068853_100001212 Ga0068853_10000121217 149
515 3300005577 Ga0068857_100118693 Ga0068857_1001186933 149
516 3300005578 Ga0068854_100010069 Ga0068854_1000100698 149
517 3300005616 Ga0068852_100776428 Ga0068852_1007764282 149
518 3300005841 Ga0068863_100154209 Ga0068863_1001542092 149
519 3300005843 Ga0068860_101388031 Ga0068860_1013880311 149
520 3300005937 Ga0081455_10592141 Ga0081455_105921412 149
521 3300006871 Ga0075434_100014125 Ga0075434_1000141255 149
522 3300009092 Ga0105250_10020527 Ga0105250_100205272 149
523 3300009093 Ga0105240_10000406 Ga0105240_1000040642 149
524 3300009098 Ga0105245_10012427 Ga0105245_100124277 149
525 3300009147 Ga0114129_10041628 Ga0114129_100416286 149
526 3300009177 Ga0105248_10135025 Ga0105248_101350254 149
527 3300009551 Ga0105238_10194360 Ga0105238_101943602 149
528 3300009763 Ga0123340_1056259 Ga0123340_10562592 149
529 3300009763 Ga0123340_1058161 Ga0123340_10581612 149
530 3300009765 Ga0123341_1082641 Ga0123341_10826412 149
531 3300009766 Ga0123342_1034070 Ga0123342_10340704 149
532 3300013307 Ga0157372_12648297 Ga0157372_126482971 149
533 3300014325 Ga0163163_10306114 Ga0163163_103061143 149
534 3300025924 Ga0207694_10134868 Ga0207694_101348684 149
535 3300025927 Ga0207687_10026282 Ga0207687_100262822 149
536 3300025933 Ga0207706_10009554 Ga0207706_100095547 149
537 3300025949 Ga0207667_11379864 Ga0207667_113798642 149
538 3300025981 Ga0207640_10288197 Ga0207640_102881972 149
539 3300026041 Ga0207639_10004188 Ga0207639_100041888 149
540 3300026116 Ga0207674_10099189 Ga0207674_100991894 149
541 3300026142 Ga0207698_10743699 Ga0207698_107436992 149
542 3300027512 Ga0209179_1069662 Ga0209179_10696621 149
543 3300028381 Ga0268264_10520821 Ga0268264_105208212 149
544 3300031731 Ga0307405_10027552 Ga0307405_100275523 149
545 3300031731 Ga0307405_10141450 Ga0307405_101414503 149
546 3300031901 Ga0307406_10160051 Ga0307406_101600513 149
547 3300031911 Ga0307412_10095880 Ga0307412_100958803 149
548 3300032002 Ga0307416_101482356 Ga0307416_1014823562 149
549 3300032004 Ga0307414_10976249 Ga0307414_109762492 149
550 3300037471 Ga0395905_0724916 Ga0395905_0724916_66_542 149
551 3300046455 Ga0495603_0221315 Ga0495603_0221315_249_740 149
552 3300046457 Ga0495590_0324923 Ga0495590_0324923_37_507 149
553 3300046492 Ga0495585_0288120 Ga0495585_0288120_133_609 149
554 3300046501 Ga0495607_0252098 Ga0495607_0252098_85_576 149
555 3300046674 Ga0495588_0138881 Ga0495588_0138881_323_814 149
556 3300046689 Ga0495613_0143223 Ga0495613_0143223_143_646 149
557 3300046794 Ga0495589_0098836 Ga0495589_0098836_822_1313 149
558 3300046809 Ga0495600_0533044 Ga0495600_0533044_197_700 149
559 3300047471 Ga0495684_0130791 Ga0495684_0130791_393_896 149
560 3300047472 Ga0495686_0000526 Ga0495686_0000526_4175_4651 149
561 3300048907 Ga0496104_0021841 Ga0496104_0021841_3814_4344 149
562 3300048908 Ga0496105_0111864 Ga0496105_0111864_1515_2045 149
563 3300048918 Ga0496115_0098142 Ga0496115_0098142_213_674 149
564 3300048925 Ga0496122_0058929 Ga0496122_0058929_1019_1549 149
565 3300048927 Ga0496124_0043314 Ga0496124_0043314_634_1164 149
566 3300048928 Ga0496125_0092215 Ga0496125_0092215_1518_2048 149
567 3300049579 Ga0501043_0317866 Ga0501043_0317866_674_1129 149
568 3300049584 Ga0501068_1163337 Ga0501068_1163337_22_480 149
569 3300049589 Ga0501073_0896528 Ga0501073_0896528_142_600 149
570 3300049743 Ga0501081_0853392 Ga0501081_0853392_166_630 149
571 3300050507 nmdc:mga05p37_179762_c1 nmdc:mga05p37_179762_c1_977_1435 149
572 3300060353 Ga0501082_1609412 Ga0501082_1609412_74_532 149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

29

163

0.87

PF10604

Polyketide_cyc2

Polyketide cyclase / dehydrase and lipid transport

19

163

0.65

Structural Annotation

Top 5 Hits

ID Description Score Start End
6v04-assembly1.cif.gz_A dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus 0.8669 3 148
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.8648 5 149
8es5-assembly1.cif.gz_B aha1 domain protein from pseudomonas aeruginosa 0.8519 5 149
3q6a-assembly1.cif.gz_A x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8506 5 149
3q6a-assembly1.cif.gz_D x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 0.8398 5 149
ID Description Score Start End Superfamily
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8238 5 149 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8192 3 148 3.30.530.20
af_Q8N9S3_197_326_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8188 5 149 3.30.530.20
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8148 5 147 3.30.530.20
3q6aA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.813 3 149 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1H8NFQ3-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 1.001 2 149
AF-A0A6I2H0R6-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 1.001 4 148 GO:0008168
GO:0032259
AF-A0A2V9JT73-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 1.001 22 147 GO:0008168
GO:0032259
AF-A0A6L5FIU4-F1-model_v4 Vanillate O-demethylase oxidoreductase VanB 1 2 147 GO:0008168
GO:0032259
AF-A0A5C5WGU9-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.998 4 148

Feature Viewer

pLDDT pTM Quality
95.93 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map