F465059
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 572 | 341 | 548 | 151 |
Family's Representative Sequence
| Representative Sequence | 3300009094|Ga0111539_10001638|Ga0111539_1000163815 |
| Length | 166 |
| Sequence | LHIAALAAMQLATWRLRMSDRIEKTVELKAPVSRVWRALTDHREFGTWFRVRLEGPFVPGQASRGHITYPGYEHVRWEAVVVKMEPERLFCFTWHPNAIDPGDYSNEPPTLVEFTLQEIPTGTLLRVVESGFERLPPQRRHQAFRSNEGGWGAQMENIARHVEQAP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 2 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 3 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 4 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 5 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 6 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 7 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 8 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 9 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 10 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 11 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 12 | 2767802442 | Phyllobacterium brassicacearum 29-15 | Isolate | Rhizoplane |
| 13 | 2775506902 | Phyllobacterium zundukense Tri-48 | Isolate | Unclassified |
| 14 | 2775506904 | Phyllobacterium zundukense Tri-38 | Isolate | Unclassified |
| 15 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 16 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 17 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 18 | 2954011201 | Phyllobacterium ifrigiyense W4I11 | Isolate | Rhizosphere |
| 19 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 20 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 21 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 22 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 23 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 24 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 25 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 26 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 27 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 28 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 35 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 60 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 63 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 70 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 72 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 73 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 86 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 87 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009763 | Root nodule microbial communities of legume samples collected from Mexico - Siratro Mexico nodule mix | Metagenome | Nodule |
| 120 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 121 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 122 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 136 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 137 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 195 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 196 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 201 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 202 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 203 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 204 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 207 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 208 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 209 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 210 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 211 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 212 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 214 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 215 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 218 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 220 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 223 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 224 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 225 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 226 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 229 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 230 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 231 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 232 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 233 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 234 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 235 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 236 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 237 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 238 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 239 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 240 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 278 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 279 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 280 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 281 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 282 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 283 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 284 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 285 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 286 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 287 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 288 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 289 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 290 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 291 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 292 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 293 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 294 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 295 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 303 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 305 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 308 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 311 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 312 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 314 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 316 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 317 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 318 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 319 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 320 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 321 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 322 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 323 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 324 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 326 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 327 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 336 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 337 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 338 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 339 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 340 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 341 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.28 |
| Metatranscriptomes | 0.52 |
| Isolates | 4.2 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 5.42 |
| Nodule | 2.1 |
| Rhizoplane | 6.29 |
| Rhizosphere | 83.04 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.15 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10071177 | 3300001979 | Unclassified | 931 |
| 2 | JGI24739J22299_10006377 | 3300001989 | Bacteria | 4455 |
| 3 | JGI24737J22298_10036113 | 3300001990 | Unclassified | 1527 |
| 4 | JGI25152J39213_1012654 | 3300002773 | Bacteria | 1796 |
| 5 | JGI25160J50197_1031397 | 3300003354 | Bacteria | 1369 |
| 6 | Ga0055526_1011463 | 3300003771 | Bacteria | 3988 |
| 7 | Ga0055528_1004541 | 3300003790 | Bacteria | 6656 |
| 8 | Ga0055540_1067993 | 3300003792 | Bacteria | 700 |
| 9 | Ga0070676_10950167 | 3300005328 | Unclassified | 643 |
| 10 | Ga0070683_101027547 | 3300005329 | Bacteria | 791 |
| 11 | Ga0070690_100022068 | 3300005330 | Bacteria | 3892 |
| 12 | Ga0070677_10016340 | 3300005333 | Bacteria | 2641 |
| 13 | Ga0070666_10000962 | 3300005335 | Bacteria | 17567 |
| 14 | Ga0068868_100022375 | 3300005338 | Bacteria | 4770 |
| 15 | Ga0068868_100865246 | 3300005338 | Bacteria | 819 |
| 16 | Ga0070689_100251693 | 3300005340 | Unclassified | 1458 |
| 17 | Ga0070691_10454315 | 3300005341 | Unclassified | 732 |
| 18 | Ga0070661_100208293 | 3300005344 | Bacteria | 1496 |
| 19 | Ga0070661_100304511 | 3300005344 | Bacteria | 1241 |
| 20 | Ga0070669_100091756 | 3300005353 | Bacteria | 2278 |
| 21 | Ga0070671_100074455 | 3300005355 | Bacteria | 2837 |
| 22 | Ga0070671_100114706 | 3300005355 | Bacteria | 2264 |
| 23 | Ga0070671_100307391 | 3300005355 | Unclassified | 1350 |
| 24 | Ga0070674_100035121 | 3300005356 | Bacteria | 3355 |
| 25 | Ga0070673_100236897 | 3300005364 | Bacteria | 1585 |
| 26 | Ga0070673_101321896 | 3300005364 | Unclassified | 677 |
| 27 | Ga0070659_100433262 | 3300005366 | Bacteria | 1113 |
| 28 | Ga0070659_100893356 | 3300005366 | Bacteria | 776 |
| 29 | Ga0070667_100073864 | 3300005367 | Bacteria | 2908 |
| 30 | Ga0070667_100142935 | 3300005367 | Bacteria | 2097 |
| 31 | Ga0070709_10002678 | 3300005434 | Bacteria | 9610 |
| 32 | Ga0070713_100004406 | 3300005436 | Bacteria | 9453 |
| 33 | Ga0070713_102058284 | 3300005436 | Unclassified | 554 |
| 34 | Ga0070710_10079154 | 3300005437 | Bacteria | 1914 |
| 35 | Ga0070710_11245644 | 3300005437 | Bacteria | 551 |
| 36 | Ga0070711_100011036 | 3300005439 | Bacteria | 5604 |
| 37 | Ga0070711_100025508 | 3300005439 | Bacteria | 3869 |
| 38 | Ga0070705_100248063 | 3300005440 | Bacteria | 1248 |
| 39 | Ga0070705_100332453 | 3300005440 | Bacteria | 1101 |
| 40 | Ga0070694_100265539 | 3300005444 | Bacteria | 1303 |
| 41 | Ga0070708_100809391 | 3300005445 | Bacteria | 881 |
| 42 | Ga0070663_100013612 | 3300005455 | Bacteria | 5192 |
| 43 | Ga0070678_100001882 | 3300005456 | Bacteria | 11328 |
| 44 | Ga0070662_100050121 | 3300005457 | Bacteria | 3012 |
| 45 | Ga0070662_100845552 | 3300005457 | Bacteria | 779 |
| 46 | Ga0070681_10000738 | 3300005458 | Bacteria | 27069 |
| 47 | Ga0070681_11911975 | 3300005458 | Unclassified | 521 |
| 48 | Ga0068867_100046831 | 3300005459 | Bacteria | 3177 |
| 49 | Ga0068867_100747382 | 3300005459 | Bacteria | 867 |
| 50 | Ga0070706_100523251 | 3300005467 | Bacteria | 1103 |
| 51 | Ga0070706_101558844 | 3300005467 | Unclassified | 603 |
| 52 | Ga0070698_100584211 | 3300005471 | Bacteria | 1057 |
| 53 | Ga0070699_100101141 | 3300005518 | Bacteria | 2526 |
| 54 | Ga0070699_100462088 | 3300005518 | Bacteria | 1151 |
| 55 | Ga0070679_100858161 | 3300005530 | Bacteria | 851 |
| 56 | Ga0070684_100601499 | 3300005535 | Unclassified | 1022 |
| 57 | Ga0070697_100226244 | 3300005536 | Bacteria | 1595 |
| 58 | Ga0068853_100001212 | 3300005539 | Bacteria | 18395 |
| 59 | Ga0070672_100004419 | 3300005543 | Bacteria | 9199 |
| 60 | Ga0070686_100100765 | 3300005544 | Bacteria | 1951 |
| 61 | Ga0070686_101398640 | 3300005544 | Unclassified | 587 |
| 62 | Ga0070695_100001122 | 3300005545 | Bacteria | 14667 |
| 63 | Ga0070695_100444144 | 3300005545 | Bacteria | 992 |
| 64 | Ga0070695_100569520 | 3300005545 | Bacteria | 885 |
| 65 | Ga0070696_100081554 | 3300005546 | Bacteria | 2292 |
| 66 | Ga0070696_100198021 | 3300005546 | Bacteria | 1498 |
| 67 | Ga0070696_100228251 | 3300005546 | Bacteria | 1400 |
| 68 | Ga0070693_100260896 | 3300005547 | Bacteria | 1152 |
| 69 | Ga0070665_100006732 | 3300005548 | Bacteria | 11682 |
| 70 | Ga0070665_100040389 | 3300005548 | Bacteria | 4690 |
| 71 | Ga0070665_101417716 | 3300005548 | Unclassified | 704 |
| 72 | Ga0068855_100157265 | 3300005563 | Unclassified | 2582 |
| 73 | Ga0068855_100969582 | 3300005563 | Bacteria | 895 |
| 74 | Ga0070664_100125381 | 3300005564 | Bacteria | 2252 |
| 75 | Ga0070664_100230791 | 3300005564 | Unclassified | 1659 |
| 76 | Ga0068857_100042715 | 3300005577 | Bacteria | 4022 |
| 77 | Ga0068857_100118693 | 3300005577 | Bacteria | 2381 |
| 78 | Ga0068854_100010069 | 3300005578 | Bacteria | 6123 |
| 79 | Ga0068854_100382419 | 3300005578 | Bacteria | 1160 |
| 80 | Ga0068856_100061025 | 3300005614 | Bacteria | 3724 |
| 81 | Ga0068852_100776428 | 3300005616 | Bacteria | 971 |
| 82 | Ga0068852_100793475 | 3300005616 | Bacteria | 961 |
| 83 | Ga0068859_101079688 | 3300005617 | Bacteria | 883 |
| 84 | Ga0068866_10064790 | 3300005718 | Bacteria | 1909 |
| 85 | Ga0068861_101385785 | 3300005719 | Bacteria | 686 |
| 86 | Ga0068851_10648177 | 3300005834 | Unclassified | 646 |
| 87 | Ga0068870_10372571 | 3300005840 | Bacteria | 922 |
| 88 | Ga0068863_100113370 | 3300005841 | Bacteria | 2582 |
| 89 | Ga0068863_100154209 | 3300005841 | Bacteria | 2199 |
| 90 | Ga0068858_100322543 | 3300005842 | Bacteria | 1476 |
| 91 | Ga0068860_100561455 | 3300005843 | Bacteria | 1144 |
| 92 | Ga0068860_101388031 | 3300005843 | Bacteria | 724 |
| 93 | Ga0081455_10000058 | 3300005937 | Bacteria | 119171 |
| 94 | Ga0081455_10007344 | 3300005937 | Bacteria | 11619 |
| 95 | Ga0081455_10103275 | 3300005937 | Bacteria | 2283 |
| 96 | Ga0081455_10140763 | 3300005937 | Bacteria | 1874 |
| 97 | Ga0081455_10592141 | 3300005937 | Bacteria | 725 |
| 98 | Ga0081455_10757664 | 3300005937 | Bacteria | 613 |
| 99 | Ga0081540_1014811 | 3300005983 | Bacteria | 4969 |
| 100 | Ga0081540_1142939 | 3300005983 | Bacteria | 957 |
| 101 | Ga0075365_10002801 | 3300006038 | Bacteria | 8729 |
| 102 | Ga0075365_10003928 | 3300006038 | Bacteria | 7783 |
| 103 | Ga0075368_10025213 | 3300006042 | Bacteria | 2281 |
| 104 | Ga0075363_100105906 | 3300006048 | Bacteria | 1560 |
| 105 | Ga0075364_10991509 | 3300006051 | Unclassified | 571 |
| 106 | Ga0070715_10000714 | 3300006163 | Bacteria | 8928 |
| 107 | Ga0070716_100000449 | 3300006173 | Bacteria | 17023 |
| 108 | Ga0070716_101121380 | 3300006173 | Unclassified | 628 |
| 109 | Ga0070712_100045298 | 3300006175 | Bacteria | 3037 |
| 110 | Ga0070712_100053492 | 3300006175 | Bacteria | 2819 |
| 111 | Ga0075367_10003265 | 3300006178 | Bacteria | 7676 |
| 112 | Ga0075367_10017321 | 3300006178 | Bacteria | 3952 |
| 113 | Ga0097621_100471631 | 3300006237 | Bacteria | 1133 |
| 114 | Ga0097621_100683175 | 3300006237 | Unclassified | 944 |
| 115 | Ga0075370_10079548 | 3300006353 | Bacteria | 1883 |
| 116 | Ga0068871_100028714 | 3300006358 | Bacteria | 4364 |
| 117 | Ga0068871_100435582 | 3300006358 | Bacteria | 1173 |
| 118 | Ga0075428_100002056 | 3300006844 | Bacteria | 21702 |
| 119 | Ga0075428_100002982 | 3300006844 | Bacteria | 18442 |
| 120 | Ga0075428_100042255 | 3300006844 | Bacteria | 5012 |
| 121 | Ga0075428_100182463 | 3300006844 | Bacteria | 2271 |
| 122 | Ga0075428_101526460 | 3300006844 | Bacteria | 699 |
| 123 | Ga0075428_102671727 | 3300006844 | Bacteria | 509 |
| 124 | Ga0075430_100031326 | 3300006846 | Bacteria | 4514 |
| 125 | Ga0075430_100052103 | 3300006846 | Bacteria | 3447 |
| 126 | Ga0075430_100100928 | 3300006846 | Unclassified | 2410 |
| 127 | Ga0075430_100102549 | 3300006846 | Bacteria | 2389 |
| 128 | Ga0075430_100201744 | 3300006846 | Bacteria | 1651 |
| 129 | Ga0075430_100369915 | 3300006846 | Bacteria | 1183 |
| 130 | Ga0075431_100002077 | 3300006847 | Bacteria | 19121 |
| 131 | Ga0075431_100006590 | 3300006847 | Bacteria | 11534 |
| 132 | Ga0075431_100016829 | 3300006847 | Bacteria | 7427 |
| 133 | Ga0075431_100028315 | 3300006847 | Bacteria | 5755 |
| 134 | Ga0075431_100042943 | 3300006847 | Bacteria | 4664 |
| 135 | Ga0075431_100049592 | 3300006847 | Bacteria | 4328 |
| 136 | Ga0075431_100168676 | 3300006847 | Bacteria | 2250 |
| 137 | Ga0075431_100523210 | 3300006847 | Bacteria | 1175 |
| 138 | Ga0075431_100847326 | 3300006847 | Unclassified | 885 |
| 139 | Ga0075433_10222785 | 3300006852 | Bacteria | 1675 |
| 140 | Ga0075434_100014125 | 3300006871 | Bacteria | 7626 |
| 141 | Ga0075434_100063914 | 3300006871 | Bacteria | 3663 |
| 142 | Ga0075434_101069075 | 3300006871 | Unclassified | 820 |
| 143 | Ga0075429_100021858 | 3300006880 | Bacteria | 5545 |
| 144 | Ga0075429_100130137 | 3300006880 | Bacteria | 2201 |
| 145 | Ga0075429_100172685 | 3300006880 | Bacteria | 1893 |
| 146 | Ga0075429_100410176 | 3300006880 | Bacteria | 1186 |
| 147 | Ga0068865_100005989 | 3300006881 | Bacteria | 7408 |
| 148 | Ga0075436_100350865 | 3300006914 | Bacteria | 1063 |
| 149 | Ga0097620_101079741 | 3300006931 | Bacteria | 883 |
| 150 | Ga0099794_10025383 | 3300007265 | Bacteria | 2729 |
| 151 | Ga0099794_10309009 | 3300007265 | Unclassified | 819 |
| 152 | Ga0099795_10029751 | 3300007788 | Bacteria | 1869 |
| 153 | Ga0099795_10289595 | 3300007788 | Bacteria | 717 |
| 154 | Ga0105250_10020527 | 3300009092 | Bacteria | 2670 |
| 155 | Ga0105240_10000406 | 3300009093 | Bacteria | 80007 |
| 156 | Ga0105240_10407983 | 3300009093 | Bacteria | 1529 |
| 157 | Ga0105240_10447965 | 3300009093 | Unclassified | 1445 |
| 158 | Ga0111539_10001638 | 3300009094 | Bacteria | 29905 |
| 159 | Ga0111539_10029477 | 3300009094 | Bacteria | 6684 |
| 160 | Ga0111539_10131177 | 3300009094 | Unclassified | 2934 |
| 161 | Ga0111539_10749568 | 3300009094 | Bacteria | 1137 |
| 162 | Ga0111539_10770570 | 3300009094 | Bacteria | 1120 |
| 163 | Ga0111539_11884412 | 3300009094 | Unclassified | 693 |
| 164 | Ga0105245_10012427 | 3300009098 | Bacteria | 7410 |
| 165 | Ga0105245_10093791 | 3300009098 | Bacteria | 2766 |
| 166 | Ga0105245_10426310 | 3300009098 | Bacteria | 1330 |
| 167 | Ga0105247_10118868 | 3300009101 | Bacteria | 1710 |
| 168 | Ga0105247_11483787 | 3300009101 | Unclassified | 552 |
| 169 | Ga0114129_10001489 | 3300009147 | Bacteria | 31706 |
| 170 | Ga0114129_10004660 | 3300009147 | Bacteria | 19362 |
| 171 | Ga0114129_10041628 | 3300009147 | Bacteria | 6471 |
| 172 | Ga0114129_10477306 | 3300009147 | Bacteria | 1632 |
| 173 | Ga0114129_10808824 | 3300009147 | Bacteria | 1195 |
| 174 | Ga0114129_10893575 | 3300009147 | Bacteria | 1126 |
| 175 | Ga0105243_10632277 | 3300009148 | Bacteria | 1035 |
| 176 | Ga0105243_10791127 | 3300009148 | Bacteria | 934 |
| 177 | Ga0105241_10107114 | 3300009174 | Bacteria | 2232 |
| 178 | Ga0105242_10006693 | 3300009176 | Bacteria | 8894 |
| 179 | Ga0105248_10075639 | 3300009177 | Bacteria | 3784 |
| 180 | Ga0105248_10135025 | 3300009177 | Bacteria | 2783 |
| 181 | Ga0105248_10349716 | 3300009177 | Bacteria | 1664 |
| 182 | Ga0105248_10737052 | 3300009177 | Unclassified | 1112 |
| 183 | Ga0105238_10090370 | 3300009551 | Bacteria | 3050 |
| 184 | Ga0105238_10194360 | 3300009551 | Unclassified | 2005 |
| 185 | Ga0105238_11620403 | 3300009551 | Bacteria | 677 |
| 186 | Ga0105249_10376884 | 3300009553 | Bacteria | 1444 |
| 187 | Ga0123340_1056259 | 3300009763 | Bacteria | 1262 |
| 188 | Ga0123340_1058161 | 3300009763 | Bacteria | 1186 |
| 189 | Ga0123341_1082641 | 3300009765 | Bacteria | 1239 |
| 190 | Ga0123341_1082672 | 3300009765 | Bacteria | 1239 |
| 191 | Ga0123342_1034070 | 3300009766 | Bacteria | 2267 |
| 192 | Ga0105239_10005723 | 3300010375 | Bacteria | 14518 |
| 193 | Ga0105239_11145562 | 3300010375 | Bacteria | 896 |
| 194 | Ga0105239_11196080 | 3300010375 | Unclassified | 876 |
| 195 | Ga0105246_10910273 | 3300011119 | Bacteria | 789 |
| 196 | Ga0157370_10705633 | 3300013104 | Bacteria | 921 |
| 197 | Ga0157369_10599373 | 3300013105 | Bacteria | 1137 |
| 198 | Ga0157374_10112983 | 3300013296 | Unclassified | 2614 |
| 199 | Ga0157374_10336352 | 3300013296 | Bacteria | 1498 |
| 200 | Ga0157374_10876428 | 3300013296 | Bacteria | 915 |
| 201 | Ga0163162_12349182 | 3300013306 | Bacteria | 613 |
| 202 | Ga0157372_10085393 | 3300013307 | Unclassified | 3579 |
| 203 | Ga0157372_12648297 | 3300013307 | Unclassified | 575 |
| 204 | Ga0157375_10184171 | 3300013308 | Bacteria | 2241 |
| 205 | Ga0157375_11575729 | 3300013308 | Unclassified | 776 |
| 206 | Ga0157375_11666893 | 3300013308 | Unclassified | 755 |
| 207 | Ga0157375_12013204 | 3300013308 | Unclassified | 687 |
| 208 | Ga0157375_12128558 | 3300013308 | Bacteria | 668 |
| 209 | Ga0163163_10135016 | 3300014325 | Bacteria | 2508 |
| 210 | Ga0163163_10233078 | 3300014325 | Bacteria | 1890 |
| 211 | Ga0163163_10306114 | 3300014325 | Bacteria | 1642 |
| 212 | Ga0157379_10022250 | 3300014968 | Bacteria | 5615 |
| 213 | Ga0157379_10383580 | 3300014968 | Bacteria | 1290 |
| 214 | Ga0157379_11237378 | 3300014968 | Unclassified | 719 |
| 215 | Ga0157376_10960342 | 3300014969 | Unclassified | 875 |
| 216 | Ga0206354_10229693 | 3300020081 | Bacteria | 9840 |
| 217 | Ga0206353_11805231 | 3300020082 | Bacteria | 7432 |
| 218 | Ga0213872_10001236 | 3300021361 | Bacteria | 17247 |
| 219 | Ga0213876_10295429 | 3300021384 | Bacteria | 861 |
| 220 | Ga0209129_1004672 | 3300025258 | Bacteria | 5228 |
| 221 | Ga0209673_1003809 | 3300025273 | Bacteria | 8551 |
| 222 | Ga0209130_1011356 | 3300025284 | Bacteria | 2389 |
| 223 | Ga0209025_1033874 | 3300025294 | Bacteria | 2349 |
| 224 | Ga0209025_1086326 | 3300025294 | Bacteria | 1043 |
| 225 | Ga0209025_1104260 | 3300025294 | Bacteria | 888 |
| 226 | Ga0209564_1018176 | 3300025295 | Bacteria | 2695 |
| 227 | Ga0209758_1015852 | 3300025297 | Bacteria | 3872 |
| 228 | Ga0209256_1014803 | 3300025299 | Bacteria | 2773 |
| 229 | Ga0207426_1002621 | 3300025302 | Bacteria | 11149 |
| 230 | Ga0209051_1015244 | 3300025303 | Bacteria | 3547 |
| 231 | Ga0207682_10084409 | 3300025893 | Bacteria | 1367 |
| 232 | Ga0207692_10155172 | 3300025898 | Bacteria | 1314 |
| 233 | Ga0207642_10004598 | 3300025899 | Bacteria | 4457 |
| 234 | Ga0207685_10043801 | 3300025905 | Bacteria | 1689 |
| 235 | Ga0207685_10061127 | 3300025905 | Bacteria | 1492 |
| 236 | Ga0207699_10071415 | 3300025906 | Bacteria | 2123 |
| 237 | Ga0207645_10008093 | 3300025907 | Bacteria | 7374 |
| 238 | Ga0207654_10268856 | 3300025911 | Bacteria | 1149 |
| 239 | Ga0207654_10274218 | 3300025911 | Bacteria | 1139 |
| 240 | Ga0207707_10001614 | 3300025912 | Bacteria | 20779 |
| 241 | Ga0207695_10377655 | 3300025913 | Unclassified | 1303 |
| 242 | Ga0207693_10000083 | 3300025915 | Bacteria | 84611 |
| 243 | Ga0207693_10204486 | 3300025915 | Bacteria | 1553 |
| 244 | Ga0207662_10295032 | 3300025918 | Bacteria | 1076 |
| 245 | Ga0207649_10293112 | 3300025920 | Bacteria | 1187 |
| 246 | Ga0207652_10916467 | 3300025921 | Bacteria | 774 |
| 247 | Ga0207681_10221419 | 3300025923 | Bacteria | 1464 |
| 248 | Ga0207681_10431226 | 3300025923 | Bacteria | 1070 |
| 249 | Ga0207694_10134868 | 3300025924 | Bacteria | 1982 |
| 250 | Ga0207694_10149723 | 3300025924 | Bacteria | 1879 |
| 251 | Ga0207687_10026282 | 3300025927 | Unclassified | 3896 |
| 252 | Ga0207687_10028228 | 3300025927 | Bacteria | 3770 |
| 253 | Ga0207700_10286606 | 3300025928 | Bacteria | 1418 |
| 254 | Ga0207664_10146050 | 3300025929 | Bacteria | 2006 |
| 255 | Ga0207644_10043415 | 3300025931 | Bacteria | 3190 |
| 256 | Ga0207644_10137714 | 3300025931 | Bacteria | 1876 |
| 257 | Ga0207644_10248764 | 3300025931 | Bacteria | 1418 |
| 258 | Ga0207690_11417920 | 3300025932 | Bacteria | 581 |
| 259 | Ga0207690_11544576 | 3300025932 | Unclassified | 555 |
| 260 | Ga0207706_10003176 | 3300025933 | Bacteria | 15789 |
| 261 | Ga0207706_10009554 | 3300025933 | Bacteria | 8904 |
| 262 | Ga0207706_11083920 | 3300025933 | Bacteria | 670 |
| 263 | Ga0207686_10132872 | 3300025934 | Bacteria | 1709 |
| 264 | Ga0207709_10624142 | 3300025935 | Bacteria | 856 |
| 265 | Ga0207669_10257157 | 3300025937 | Bacteria | 1304 |
| 266 | Ga0207704_10250025 | 3300025938 | Bacteria | 1330 |
| 267 | Ga0207665_10000587 | 3300025939 | Bacteria | 24539 |
| 268 | Ga0207665_10037791 | 3300025939 | Bacteria | 3214 |
| 269 | Ga0207665_11036317 | 3300025939 | Unclassified | 653 |
| 270 | Ga0207691_10016487 | 3300025940 | Bacteria | 7013 |
| 271 | Ga0207711_10193825 | 3300025941 | Bacteria | 1852 |
| 272 | Ga0207711_10429180 | 3300025941 | Bacteria | 1230 |
| 273 | Ga0207661_10222430 | 3300025944 | Unclassified | 1669 |
| 274 | Ga0207667_10082789 | 3300025949 | Unclassified | 3323 |
| 275 | Ga0207667_10608458 | 3300025949 | Bacteria | 1101 |
| 276 | Ga0207667_11379864 | 3300025949 | Unclassified | 679 |
| 277 | Ga0207651_10246098 | 3300025960 | Bacteria | 1460 |
| 278 | Ga0207651_11031578 | 3300025960 | Unclassified | 736 |
| 279 | Ga0207651_12019629 | 3300025960 | Unclassified | 518 |
| 280 | Ga0207712_11256785 | 3300025961 | Bacteria | 661 |
| 281 | Ga0207668_10087746 | 3300025972 | Bacteria | 2276 |
| 282 | Ga0207668_10351362 | 3300025972 | Bacteria | 1233 |
| 283 | Ga0207640_10288197 | 3300025981 | Bacteria | 1293 |
| 284 | Ga0207640_10551823 | 3300025981 | Bacteria | 968 |
| 285 | Ga0207658_10146136 | 3300025986 | Bacteria | 1920 |
| 286 | Ga0207677_10118489 | 3300026023 | Bacteria | 1986 |
| 287 | Ga0207639_10004188 | 3300026041 | Bacteria | 9713 |
| 288 | Ga0207708_10193947 | 3300026075 | Unclassified | 1618 |
| 289 | Ga0207702_10138353 | 3300026078 | Bacteria | 2200 |
| 290 | Ga0207641_10345799 | 3300026088 | Bacteria | 1416 |
| 291 | Ga0207641_11812181 | 3300026088 | Bacteria | 612 |
| 292 | Ga0207648_10003167 | 3300026089 | Bacteria | 17348 |
| 293 | Ga0207674_10020062 | 3300026116 | Bacteria | 7230 |
| 294 | Ga0207674_10099189 | 3300026116 | Bacteria | 2895 |
| 295 | Ga0207674_10818338 | 3300026116 | Bacteria | 899 |
| 296 | Ga0207675_100004907 | 3300026118 | Bacteria | 12886 |
| 297 | Ga0207675_100658016 | 3300026118 | Unclassified | 1054 |
| 298 | Ga0207683_10002455 | 3300026121 | Bacteria | 16158 |
| 299 | Ga0207698_10743699 | 3300026142 | Bacteria | 979 |
| 300 | Ga0207698_10994972 | 3300026142 | Bacteria | 849 |
| 301 | Ga0209179_1069662 | 3300027512 | Bacteria | 769 |
| 302 | Ga0209971_1004557 | 3300027682 | Bacteria | 3288 |
| 303 | Ga0209998_10005976 | 3300027717 | Bacteria | 2532 |
| 304 | Ga0209813_10009170 | 3300027866 | Bacteria | 2522 |
| 305 | Ga0207428_10004512 | 3300027907 | Bacteria | 13205 |
| 306 | Ga0207428_10067272 | 3300027907 | Unclassified | 2821 |
| 307 | Ga0207428_10386451 | 3300027907 | Bacteria | 1026 |
| 308 | Ga0268266_10019128 | 3300028379 | Bacteria | 5832 |
| 309 | Ga0268264_10520821 | 3300028381 | Bacteria | 1162 |
| 310 | Ga0265316_10447276 | 3300031344 | Unclassified | 927 |
| 311 | Ga0307408_100037588 | 3300031548 | Bacteria | 3411 |
| 312 | Ga0307408_100468991 | 3300031548 | Bacteria | 1096 |
| 313 | Ga0307408_100910328 | 3300031548 | Bacteria | 806 |
| 314 | Ga0307405_10027552 | 3300031731 | Bacteria | 3296 |
| 315 | Ga0307405_10141450 | 3300031731 | Bacteria | 1678 |
| 316 | Ga0307413_10104459 | 3300031824 | Bacteria | 1881 |
| 317 | Ga0307413_10367231 | 3300031824 | Bacteria | 1116 |
| 318 | Ga0307410_10582335 | 3300031852 | Bacteria | 931 |
| 319 | Ga0307406_10160051 | 3300031901 | Bacteria | 1617 |
| 320 | Ga0307412_10095880 | 3300031911 | Unclassified | 2087 |
| 321 | Ga0307409_100008605 | 3300031995 | Bacteria | 6208 |
| 322 | Ga0307416_100076784 | 3300032002 | Bacteria | 2802 |
| 323 | Ga0307416_101482356 | 3300032002 | Bacteria | 784 |
| 324 | Ga0307414_10119131 | 3300032004 | Bacteria | 2026 |
| 325 | Ga0307414_10976249 | 3300032004 | Unclassified | 779 |
| 326 | Ga0307411_10012283 | 3300032005 | Bacteria | 4665 |
| 327 | Ga0307411_11441235 | 3300032005 | Bacteria | 631 |
| 328 | Ga0307415_100277662 | 3300032126 | Bacteria | 1376 |
| 329 | Ga0307415_102178040 | 3300032126 | Bacteria | 542 |
| 330 | Ga0373926_0067873 | 3300035083 | Bacteria | 1307 |
| 331 | Ga0373940_0062800 | 3300035088 | Bacteria | 1066 |
| 332 | Ga0373949_0086013 | 3300035090 | Bacteria | 844 |
| 333 | Ga0373923_0182297 | 3300035111 | Bacteria | 965 |
| 334 | Ga0373953_0079389 | 3300035117 | Bacteria | 1362 |
| 335 | Ga0373953_0124344 | 3300035117 | Bacteria | 1097 |
| 336 | Ga0373954_0117613 | 3300035118 | Bacteria | 1289 |
| 337 | Ga0373943_0442803 | 3300035170 | Bacteria | 754 |
| 338 | Ga0373955_0015905 | 3300035172 | Bacteria | 3692 |
| 339 | Ga0373955_0119699 | 3300035172 | Bacteria | 1530 |
| 340 | Ga0373961_0195311 | 3300035241 | Bacteria | 711 |
| 341 | Ga0373935_0828266 | 3300035692 | Bacteria | 684 |
| 342 | Ga0373927_0000772 | 3300035695 | Bacteria | 24478 |
| 343 | Ga0373927_0064997 | 3300035695 | Bacteria | 2360 |
| 344 | Ga0373927_0259811 | 3300035695 | Bacteria | 1142 |
| 345 | Ga0373933_0038327 | 3300035724 | Bacteria | 2816 |
| 346 | Ga0373937_0006608 | 3300036401 | Bacteria | 10014 |
| 347 | Ga0373937_0049306 | 3300036401 | Bacteria | 3856 |
| 348 | Ga0373937_0190795 | 3300036401 | Bacteria | 1925 |
| 349 | Ga0373937_0513343 | 3300036401 | Bacteria | 1139 |
| 350 | Ga0373937_1998775 | 3300036401 | Unclassified | 526 |
| 351 | Ga0395899_0005256 | 3300037312 | Bacteria | 10064 |
| 352 | Ga0395899_0008193 | 3300037312 | Bacteria | 8051 |
| 353 | Ga0395900_0009362 | 3300037418 | Bacteria | 10044 |
| 354 | Ga0395900_0376114 | 3300037418 | Bacteria | 1389 |
| 355 | Ga0395898_0095189 | 3300037466 | Bacteria | 2861 |
| 356 | Ga0395898_0357957 | 3300037466 | Bacteria | 1391 |
| 357 | Ga0395905_0168442 | 3300037471 | Bacteria | 2058 |
| 358 | Ga0395905_0724916 | 3300037471 | Bacteria | 897 |
| 359 | Ga0436364_1204884 | 3300037853 | Unclassified | 2403 |
| 360 | Ga0395901_0020564 | 3300038443 | Bacteria | 6754 |
| 361 | Ga0436365_0340625 | 3300039437 | Bacteria | 1488 |
| 362 | Ga0436365_0701502 | 3300039437 | Bacteria | 5706 |
| 363 | Ga0436360_0122890 | 3300039438 | Bacteria | 584 |
| 364 | Ga0436360_0352942 | 3300039438 | Bacteria | 934 |
| 365 | Ga0436360_1031893 | 3300039438 | Bacteria | 741 |
| 366 | Ga0436360_1170569 | 3300039438 | Bacteria | 603 |
| 367 | Ga0436361_1165271 | 3300039447 | Bacteria | 12230 |
| 368 | Ga0436362_0170168 | 3300039453 | Bacteria | 760 |
| 369 | Ga0439465_0130887 | 3300041413 | Bacteria | 886 |
| 370 | Ga0451791_1630542 | 3300041451 | Unclassified | 786 |
| 371 | Ga0451833_1389789 | 3300041491 | Unclassified | 634 |
| 372 | Ga0451849_0967899 | 3300041505 | Bacteria | 672 |
| 373 | Ga0450896_035893 | 3300042133 | Bacteria | 762 |
| 374 | Ga0439435_0075695 | 3300042436 | Unclassified | 1003 |
| 375 | Ga0439460_0243015 | 3300042461 | Bacteria | 621 |
| 376 | Ga0466957_0430041 | 3300044842 | Unclassified | 907 |
| 377 | Ga0466967_1890625 | 3300045976 | Bacteria | 594 |
| 378 | Ga0495592_0012377 | 3300046454 | Bacteria | 6479 |
| 379 | Ga0495592_0541624 | 3300046454 | Unclassified | 717 |
| 380 | Ga0495603_0221315 | 3300046455 | Bacteria | 1092 |
| 381 | Ga0495590_0324923 | 3300046457 | Archaea | 582 |
| 382 | Ga0495651_0402896 | 3300046462 | Bacteria | 893 |
| 383 | Ga0495650_0087307 | 3300046471 | Bacteria | 1193 |
| 384 | Ga0495580_0002317 | 3300046472 | Bacteria | 16600 |
| 385 | Ga0495580_0028129 | 3300046472 | Bacteria | 4088 |
| 386 | Ga0495580_0032532 | 3300046472 | Bacteria | 3763 |
| 387 | Ga0495664_0673948 | 3300046477 | Unclassified | 612 |
| 388 | Ga0495585_0288120 | 3300046492 | Bacteria | 810 |
| 389 | Ga0495585_0374396 | 3300046492 | Bacteria | 689 |
| 390 | Ga0495594_0486821 | 3300046499 | Bacteria | 701 |
| 391 | Ga0495607_0252098 | 3300046501 | Bacteria | 849 |
| 392 | Ga0495583_0125424 | 3300046506 | Bacteria | 1077 |
| 393 | Ga0495606_0294405 | 3300046507 | Bacteria | 882 |
| 394 | Ga0495606_0361544 | 3300046507 | Bacteria | 767 |
| 395 | Ga0495608_0100505 | 3300046511 | Bacteria | 1865 |
| 396 | Ga0495628_0192642 | 3300046516 | Bacteria | 1539 |
| 397 | Ga0495628_0625110 | 3300046516 | Unclassified | 767 |
| 398 | Ga0495586_0506526 | 3300046535 | Bacteria | 697 |
| 399 | Ga0495645_0129976 | 3300046543 | Bacteria | 1766 |
| 400 | Ga0495667_0007136 | 3300046559 | Bacteria | 7577 |
| 401 | Ga0495668_0019219 | 3300046616 | Bacteria | 3942 |
| 402 | Ga0495625_0143701 | 3300046660 | Bacteria | 1608 |
| 403 | Ga0495588_0138881 | 3300046674 | Bacteria | 1283 |
| 404 | Ga0495657_0038547 | 3300046675 | Bacteria | 3288 |
| 405 | Ga0495657_0146608 | 3300046675 | Bacteria | 1468 |
| 406 | Ga0495657_0206296 | 3300046675 | Bacteria | 1196 |
| 407 | Ga0495599_0263458 | 3300046678 | Bacteria | 1047 |
| 408 | Ga0495623_0243639 | 3300046679 | Unclassified | 1014 |
| 409 | Ga0495647_0239224 | 3300046681 | Bacteria | 806 |
| 410 | Ga0495658_0227048 | 3300046683 | Bacteria | 1170 |
| 411 | Ga0495613_0143223 | 3300046689 | Unclassified | 1707 |
| 412 | Ga0495589_0098836 | 3300046794 | Bacteria | 1413 |
| 413 | Ga0495600_0149144 | 3300046809 | Unclassified | 1515 |
| 414 | Ga0495600_0322245 | 3300046809 | Bacteria | 972 |
| 415 | Ga0495600_0533044 | 3300046809 | Unclassified | 719 |
| 416 | Ga0495604_0177444 | 3300047317 | Bacteria | 1492 |
| 417 | Ga0495604_0464404 | 3300047317 | Bacteria | 825 |
| 418 | Ga0495674_0172755 | 3300047319 | Bacteria | 1803 |
| 419 | Ga0495680_0000817 | 3300047322 | Bacteria | 34725 |
| 420 | Ga0495675_0007417 | 3300047444 | Bacteria | 6754 |
| 421 | Ga0495684_0130791 | 3300047471 | Bacteria | 1885 |
| 422 | Ga0495684_0213231 | 3300047471 | Bacteria | 1419 |
| 423 | Ga0495686_0000526 | 3300047472 | Bacteria | 55119 |
| 424 | Ga0495686_0040857 | 3300047472 | Bacteria | 2955 |
| 425 | Ga0495686_0171809 | 3300047472 | Bacteria | 1260 |
| 426 | Ga0495602_0229751 | 3300048088 | Bacteria | 1395 |
| 427 | Ga0495602_0705771 | 3300048088 | Unclassified | 684 |
| 428 | Ga0495602_1053812 | 3300048088 | Unclassified | 535 |
| 429 | Ga0496100_0099797 | 3300048903 | Bacteria | 1998 |
| 430 | Ga0496100_0159739 | 3300048903 | Bacteria | 1615 |
| 431 | Ga0496100_0292265 | 3300048903 | Unclassified | 1218 |
| 432 | Ga0496101_0002781 | 3300048904 | Bacteria | 10726 |
| 433 | Ga0496101_0458546 | 3300048904 | Unclassified | 1006 |
| 434 | Ga0496101_1579229 | 3300048904 | Bacteria | 510 |
| 435 | Ga0496102_0079333 | 3300048905 | Bacteria | 3023 |
| 436 | Ga0496104_0021841 | 3300048907 | Bacteria | 5878 |
| 437 | Ga0496104_0122439 | 3300048907 | Bacteria | 2497 |
| 438 | Ga0496104_0163771 | 3300048907 | Bacteria | 2132 |
| 439 | Ga0496104_0351360 | 3300048907 | Bacteria | 1387 |
| 440 | Ga0496105_0060265 | 3300048908 | Bacteria | 3131 |
| 441 | Ga0496105_0111864 | 3300048908 | Bacteria | 2253 |
| 442 | Ga0496106_0019073 | 3300048909 | Bacteria | 5083 |
| 443 | Ga0496106_0474679 | 3300048909 | Bacteria | 1005 |
| 444 | Ga0496107_0001015 | 3300048910 | Bacteria | 16758 |
| 445 | Ga0496107_0479908 | 3300048910 | Bacteria | 923 |
| 446 | Ga0496107_0531169 | 3300048910 | Bacteria | 872 |
| 447 | Ga0496108_0038274 | 3300048911 | Bacteria | 3995 |
| 448 | Ga0496108_1072265 | 3300048911 | Bacteria | 686 |
| 449 | Ga0496109_0220308 | 3300048912 | Bacteria | 1784 |
| 450 | Ga0496109_0438409 | 3300048912 | Bacteria | 1234 |
| 451 | Ga0496110_0000749 | 3300048913 | Bacteria | 22420 |
| 452 | Ga0496110_1622786 | 3300048913 | Bacteria | 557 |
| 453 | Ga0496111_0262853 | 3300048914 | Bacteria | 1280 |
| 454 | Ga0496112_0005843 | 3300048915 | Bacteria | 10714 |
| 455 | Ga0496112_0138398 | 3300048915 | Bacteria | 2404 |
| 456 | Ga0496112_0685121 | 3300048915 | Bacteria | 953 |
| 457 | Ga0496113_0036857 | 3300048916 | Bacteria | 3585 |
| 458 | Ga0496113_1529551 | 3300048916 | Bacteria | 515 |
| 459 | Ga0496114_0001864 | 3300048917 | Bacteria | 15980 |
| 460 | Ga0496114_0580000 | 3300048917 | Bacteria | 990 |
| 461 | Ga0496115_0098142 | 3300048918 | Unclassified | 2399 |
| 462 | Ga0496115_0131209 | 3300048918 | Bacteria | 2065 |
| 463 | Ga0496122_0058929 | 3300048925 | Bacteria | 2838 |
| 464 | Ga0496124_0043314 | 3300048927 | Bacteria | 3869 |
| 465 | Ga0496125_0092215 | 3300048928 | Bacteria | 2266 |
| 466 | Ga0501031_0032810 | 3300049568 | Unclassified | 3386 |
| 467 | Ga0501031_0038007 | 3300049568 | Bacteria | 3142 |
| 468 | Ga0501032_0000347 | 3300049569 | Bacteria | 38712 |
| 469 | Ga0501033_0001128 | 3300049570 | Bacteria | 24173 |
| 470 | Ga0501033_0017584 | 3300049570 | Bacteria | 5401 |
| 471 | Ga0501033_0019916 | 3300049570 | Bacteria | 5071 |
| 472 | Ga0501036_0000478 | 3300049572 | Bacteria | 28581 |
| 473 | Ga0501036_0005040 | 3300049572 | Bacteria | 10688 |
| 474 | Ga0501036_0077004 | 3300049572 | Bacteria | 2822 |
| 475 | Ga0501037_0000473 | 3300049573 | Bacteria | 32620 |
| 476 | Ga0501037_0092458 | 3300049573 | Bacteria | 2188 |
| 477 | Ga0501037_0874143 | 3300049573 | Unclassified | 590 |
| 478 | Ga0501038_0004697 | 3300049574 | Bacteria | 12707 |
| 479 | Ga0501038_0044079 | 3300049574 | Bacteria | 3877 |
| 480 | Ga0501038_0080123 | 3300049574 | Unclassified | 2752 |
| 481 | Ga0501038_0236005 | 3300049574 | Bacteria | 1453 |
| 482 | Ga0501039_0001356 | 3300049575 | Bacteria | 17939 |
| 483 | Ga0501039_0316871 | 3300049575 | Unclassified | 1226 |
| 484 | Ga0501040_0000822 | 3300049576 | Bacteria | 19406 |
| 485 | Ga0501042_0003268 | 3300049578 | Bacteria | 10139 |
| 486 | Ga0501043_0000887 | 3300049579 | Bacteria | 26535 |
| 487 | Ga0501043_0033954 | 3300049579 | Unclassified | 4013 |
| 488 | Ga0501043_0317866 | 3300049579 | Bacteria | 1187 |
| 489 | Ga0501046_0000045 | 3300049580 | Bacteria | 144492 |
| 490 | Ga0501046_0002039 | 3300049580 | Bacteria | 19200 |
| 491 | Ga0501046_0266000 | 3300049580 | Bacteria | 1259 |
| 492 | Ga0501047_0000694 | 3300049581 | Bacteria | 35179 |
| 493 | Ga0501047_0166338 | 3300049581 | Bacteria | 2075 |
| 494 | Ga0501048_0008242 | 3300049582 | Bacteria | 7884 |
| 495 | Ga0501048_0426148 | 3300049582 | Bacteria | 949 |
| 496 | Ga0501068_0000204 | 3300049584 | Bacteria | 28405 |
| 497 | Ga0501068_1163337 | 3300049584 | Bacteria | 511 |
| 498 | Ga0501070_0132344 | 3300049586 | Bacteria | 2060 |
| 499 | Ga0501071_0526200 | 3300049587 | Bacteria | 907 |
| 500 | Ga0501073_0896528 | 3300049589 | Archaea | 611 |
| 501 | Ga0501075_0031242 | 3300049591 | Bacteria | 3952 |
| 502 | Ga0501076_0186867 | 3300049592 | Bacteria | 1690 |
| 503 | Ga0501079_0706555 | 3300049741 | Bacteria | 794 |
| 504 | Ga0501081_0853392 | 3300049743 | Bacteria | 686 |
| 505 | Ga0501035_0002182 | 3300049822 | Bacteria | 19416 |
| 506 | Ga0501035_0026271 | 3300049822 | Bacteria | 5328 |
| 507 | Ga0501035_0037373 | 3300049822 | Bacteria | 4397 |
| 508 | Ga0501035_0676001 | 3300049822 | Bacteria | 835 |
| 509 | Ga0501044_0000772 | 3300049823 | Bacteria | 38845 |
| 510 | Ga0501045_0046897 | 3300049824 | Bacteria | 3146 |
| 511 | nmdc:mga03n38_59097_c1 | 3300050490 | Unclassified | 1739 |
| 512 | nmdc:mga00v17_868227_c1 | 3300050491 | Unclassified | 572 |
| 513 | nmdc:mga0yw44_290048_c1 | 3300050492 | Bacteria | 1095 |
| 514 | nmdc:mga06z11_34176_c1 | 3300050494 | Bacteria | 2494 |
| 515 | nmdc:mga04h51_15060_c1 | 3300050495 | Bacteria | 2222 |
| 516 | nmdc:mga05p37_179762_c1 | 3300050507 | Bacteria | 2574 |
| 517 | nmdc:mga05p37_4927_c1 | 3300050507 | Bacteria | 15643 |
| 518 | nmdc:mga05p37_7195_c1 | 3300050507 | Bacteria | 13126 |
| 519 | nmdc:mga05p37_804963_c1 | 3300050507 | Unclassified | 1027 |
| 520 | nmdc:mga09592_165579_c1 | 3300050508 | Bacteria | 1911 |
| 521 | nmdc:mga09592_27589_c1 | 3300050508 | Bacteria | 4713 |
| 522 | nmdc:mga09592_600651_c1 | 3300050508 | Bacteria | 943 |
| 523 | nmdc:mga0qj67_10175_c1 | 3300050509 | Bacteria | 7022 |
| 524 | nmdc:mga0qj67_102208_c1 | 3300050509 | Unclassified | 2311 |
| 525 | nmdc:mga0qj67_187027_c1 | 3300050509 | Bacteria | 1683 |
| 526 | nmdc:mga0qj67_260371_c1 | 3300050509 | Bacteria | 1407 |
| 527 | nmdc:mga0qj67_41346_c2 | 3300050509 | Bacteria | 2031 |
| 528 | nmdc:mga0qj67_84646_c1 | 3300050509 | Bacteria | 2543 |
| 529 | nmdc:mga06r32_12344_c1 | 3300050510 | Bacteria | 7705 |
| 530 | nmdc:mga06r32_124110_c1 | 3300050510 | Unclassified | 2549 |
| 531 | nmdc:mga06r32_12663_c1 | 3300050510 | Bacteria | 7623 |
| 532 | nmdc:mga06r32_132992_c1 | 3300050510 | Bacteria | 2461 |
| 533 | nmdc:mga06r32_155951_c1 | 3300050510 | Bacteria | 2264 |
| 534 | nmdc:mga06r32_169500_c1 | 3300050510 | Bacteria | 2167 |
| 535 | nmdc:mga06r32_17266_c1 | 3300050510 | Bacteria | 6588 |
| 536 | nmdc:mga06r32_2776_c1 | 3300050510 | Bacteria | 15677 |
| 537 | nmdc:mga08y16_13669_c1 | 3300050511 | Bacteria | 8547 |
| 538 | nmdc:mga08y16_809_c1 | 3300050511 | Bacteria | 29909 |
| 539 | nmdc:mga0n895_88021_c1 | 3300050512 | Bacteria | 3104 |
| 540 | nmdc:mga08x19_318401_c1 | 3300050514 | Bacteria | 1082 |
| 541 | nmdc:mga0a205_245158_c1 | 3300050515 | Bacteria | 1672 |
| 542 | Ga0495601_0279698 | 3300053077 | Bacteria | 1088 |
| 543 | Ga0495612_0171953 | 3300053078 | Bacteria | 949 |
| 544 | Ga0495595_0008503 | 3300053084 | Bacteria | 4215 |
| 545 | Ga0500616_0054000 | 3300053153 | Unclassified | 2106 |
| 546 | Ga0587071_141659 | 3300060344 | Bacteria | 591 |
| 547 | Ga0501082_1165776 | 3300060353 | Bacteria | 673 |
| 548 | Ga0501082_1609412 | 3300060353 | Unclassified | 567 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048904 | Ga0496101_1579229 | Ga0496101_1579229_107_496 | 127 |
| 2 | 3300046809 | Ga0495600_0322245 | Ga0495600_0322245_146_550 | 132 |
| 3 | 3300046516 | Ga0495628_0625110 | Ga0495628_0625110_186_614 | 137 |
| 4 | 3300005937 | Ga0081455_10757664 | Ga0081455_107576642 | 139 |
| 5 | 3300006871 | Ga0075434_101069075 | Ga0075434_1010690752 | 142 |
| 6 | 3300047317 | Ga0495604_0464404 | Ga0495604_0464404_77_511 | 142 |
| 7 | iso_pu_bacteria | 2510917028 | 2511185691 | 144 |
| 8 | iso_pu_bacteria | 2513237088 | 2513594674 | 144 |
| 9 | iso_pu_bacteria | 2513237138 | 2513864739 | 144 |
| 10 | iso_pu_bacteria | 2534681796 | 2535516584 | 144 |
| 11 | iso_pu_bacteria | 2582581294 | 2585200261 | 144 |
| 12 | iso_pu_bacteria | 2582581299 | 2585229912 | 144 |
| 13 | iso_pu_bacteria | 2582581867 | 2585402102 | 144 |
| 14 | iso_pu_bacteria | 2585427590 | 2585821886 | 144 |
| 15 | iso_pu_bacteria | 2643221599 | 2644003846 | 144 |
| 16 | iso_pu_bacteria | 2643221634 | 2644192694 | 144 |
| 17 | iso_pu_bacteria | 2767802442 | 2770196785 | 144 |
| 18 | iso_pu_bacteria | 2775506902 | 2776268844 | 144 |
| 19 | iso_pu_bacteria | 2775506904 | 2776284755 | 144 |
| 20 | iso_pu_bacteria | 2840764183 | 2840769585 | 144 |
| 21 | iso_pu_bacteria | 2923556063 | 2923558022 | 144 |
| 22 | iso_pu_bacteria | 2954011201 | 2954014418 | 144 |
| 23 | iso_pu_bacteria | 2996887358 | 2996891793 | 144 |
| 24 | iso_pu_bacteria | 3005452660 | 3005454297 | 144 |
| 25 | iso_pu_bacteria | 8005258706 | 8005263122 | 144 |
| 26 | iso_pu_bacteria | 8005321885 | 8005326320 | 144 |
| 27 | iso_pu_bacteria | 8005542996 | 8005545238 | 144 |
| 28 | iso_pu_bacteria | 8024486573 | 8024492174 | 144 |
| 29 | iso_pu_bacteria | 2511231027 | 2511389162 | 145 |
| 30 | iso_pu_bacteria | 2842871566 | 2842873232 | 145 |
| 31 | 3300005341 | Ga0070691_10454315 | Ga0070691_104543151 | 147 |
| 32 | 3300005535 | Ga0070684_100601499 | Ga0070684_1006014992 | 147 |
| 33 | 3300005937 | Ga0081455_10103275 | Ga0081455_101032753 | 147 |
| 34 | 3300006844 | Ga0075428_100002056 | Ga0075428_10000205611 | 147 |
| 35 | 3300006844 | Ga0075428_100182463 | Ga0075428_1001824633 | 147 |
| 36 | 3300006846 | Ga0075430_100031326 | Ga0075430_1000313262 | 147 |
| 37 | 3300006846 | Ga0075430_100369915 | Ga0075430_1003699151 | 147 |
| 38 | 3300006847 | Ga0075431_100002077 | Ga0075431_1000020773 | 147 |
| 39 | 3300006847 | Ga0075431_100523210 | Ga0075431_1005232103 | 147 |
| 40 | 3300006880 | Ga0075429_100021858 | Ga0075429_1000218582 | 147 |
| 41 | 3300006880 | Ga0075429_100172685 | Ga0075429_1001726853 | 147 |
| 42 | 3300009093 | Ga0105240_10407983 | Ga0105240_104079831 | 147 |
| 43 | 3300027907 | Ga0207428_10004512 | Ga0207428_1000451210 | 147 |
| 44 | 3300031548 | Ga0307408_100037588 | Ga0307408_1000375885 | 147 |
| 45 | 3300031824 | Ga0307413_10367231 | Ga0307413_103672313 | 147 |
| 46 | 3300031852 | Ga0307410_10582335 | Ga0307410_105823352 | 147 |
| 47 | 3300031995 | Ga0307409_100008605 | Ga0307409_1000086053 | 147 |
| 48 | 3300032002 | Ga0307416_100076784 | Ga0307416_1000767843 | 147 |
| 49 | 3300032005 | Ga0307411_10012283 | Ga0307411_100122832 | 147 |
| 50 | 3300041451 | Ga0451791_1630542 | Ga0451791_1630542_215_658 | 147 |
| 51 | 3300041491 | Ga0451833_1389789 | Ga0451833_1389789_50_493 | 147 |
| 52 | 3300042461 | Ga0439460_0243015 | Ga0439460_0243015_52_501 | 147 |
| 53 | 3300050507 | nmdc:mga05p37_4927_c1 | nmdc:mga05p37_4927_c1_14992_15441 | 147 |
| 54 | 3300050508 | nmdc:mga09592_165579_c1 | nmdc:mga09592_165579_c1_990_1433 | 147 |
| 55 | 3300050508 | nmdc:mga09592_27589_c1 | nmdc:mga09592_27589_c1_396_845 | 147 |
| 56 | 3300050509 | nmdc:mga0qj67_10175_c1 | nmdc:mga0qj67_10175_c1_1792_2235 | 147 |
| 57 | 3300050509 | nmdc:mga0qj67_84646_c1 | nmdc:mga0qj67_84646_c1_1944_2393 | 147 |
| 58 | 3300050510 | nmdc:mga06r32_12344_c1 | nmdc:mga06r32_12344_c1_3652_4095 | 147 |
| 59 | 3300050510 | nmdc:mga06r32_2776_c1 | nmdc:mga06r32_2776_c1_12219_12668 | 147 |
| 60 | 3300050511 | nmdc:mga08y16_809_c1 | nmdc:mga08y16_809_c1_14955_15404 | 147 |
| 61 | 3300002773 | JGI25152J39213_1012654 | JGI25152J39213_10126543 | 148 |
| 62 | 3300003354 | JGI25160J50197_1031397 | JGI25160J50197_10313971 | 148 |
| 63 | 3300003771 | Ga0055526_1011463 | Ga0055526_10114635 | 148 |
| 64 | 3300003790 | Ga0055528_1004541 | Ga0055528_10045418 | 148 |
| 65 | 3300003792 | Ga0055540_1067993 | Ga0055540_10679931 | 148 |
| 66 | 3300005328 | Ga0070676_10950167 | Ga0070676_109501671 | 148 |
| 67 | 3300005329 | Ga0070683_101027547 | Ga0070683_1010275471 | 148 |
| 68 | 3300005330 | Ga0070690_100022068 | Ga0070690_1000220684 | 148 |
| 69 | 3300005333 | Ga0070677_10016340 | Ga0070677_100163404 | 148 |
| 70 | 3300005335 | Ga0070666_10000962 | Ga0070666_1000096214 | 148 |
| 71 | 3300005338 | Ga0068868_100022375 | Ga0068868_1000223752 | 148 |
| 72 | 3300005338 | Ga0068868_100865246 | Ga0068868_1008652462 | 148 |
| 73 | 3300005340 | Ga0070689_100251693 | Ga0070689_1002516933 | 148 |
| 74 | 3300005344 | Ga0070661_100208293 | Ga0070661_1002082933 | 148 |
| 75 | 3300005344 | Ga0070661_100304511 | Ga0070661_1003045112 | 148 |
| 76 | 3300005353 | Ga0070669_100091756 | Ga0070669_1000917563 | 148 |
| 77 | 3300005355 | Ga0070671_100074455 | Ga0070671_1000744553 | 148 |
| 78 | 3300005355 | Ga0070671_100114706 | Ga0070671_1001147063 | 148 |
| 79 | 3300005355 | Ga0070671_100307391 | Ga0070671_1003073912 | 148 |
| 80 | 3300005356 | Ga0070674_100035121 | Ga0070674_1000351212 | 148 |
| 81 | 3300005364 | Ga0070673_100236897 | Ga0070673_1002368971 | 148 |
| 82 | 3300005364 | Ga0070673_101321896 | Ga0070673_1013218961 | 148 |
| 83 | 3300005366 | Ga0070659_100433262 | Ga0070659_1004332622 | 148 |
| 84 | 3300005366 | Ga0070659_100893356 | Ga0070659_1008933562 | 148 |
| 85 | 3300005367 | Ga0070667_100073864 | Ga0070667_1000738642 | 148 |
| 86 | 3300005367 | Ga0070667_100142935 | Ga0070667_1001429351 | 148 |
| 87 | 3300005434 | Ga0070709_10002678 | Ga0070709_100026789 | 148 |
| 88 | 3300005436 | Ga0070713_100004406 | Ga0070713_1000044065 | 148 |
| 89 | 3300005436 | Ga0070713_102058284 | Ga0070713_1020582841 | 148 |
| 90 | 3300005437 | Ga0070710_10079154 | Ga0070710_100791541 | 148 |
| 91 | 3300005437 | Ga0070710_11245644 | Ga0070710_112456441 | 148 |
| 92 | 3300005439 | Ga0070711_100011036 | Ga0070711_1000110363 | 148 |
| 93 | 3300005439 | Ga0070711_100025508 | Ga0070711_1000255083 | 148 |
| 94 | 3300005440 | Ga0070705_100248063 | Ga0070705_1002480632 | 148 |
| 95 | 3300005444 | Ga0070694_100265539 | Ga0070694_1002655392 | 148 |
| 96 | 3300005445 | Ga0070708_100809391 | Ga0070708_1008093911 | 148 |
| 97 | 3300005455 | Ga0070663_100013612 | Ga0070663_1000136122 | 148 |
| 98 | 3300005456 | Ga0070678_100001882 | Ga0070678_1000018822 | 148 |
| 99 | 3300005457 | Ga0070662_100845552 | Ga0070662_1008455521 | 148 |
| 100 | 3300005458 | Ga0070681_10000738 | Ga0070681_100007385 | 148 |
| 101 | 3300005458 | Ga0070681_11911975 | Ga0070681_119119751 | 148 |
| 102 | 3300005459 | Ga0068867_100046831 | Ga0068867_1000468312 | 148 |
| 103 | 3300005459 | Ga0068867_100747382 | Ga0068867_1007473822 | 148 |
| 104 | 3300005467 | Ga0070706_100523251 | Ga0070706_1005232512 | 148 |
| 105 | 3300005518 | Ga0070699_100101141 | Ga0070699_1001011413 | 148 |
| 106 | 3300005518 | Ga0070699_100462088 | Ga0070699_1004620882 | 148 |
| 107 | 3300005530 | Ga0070679_100858161 | Ga0070679_1008581612 | 148 |
| 108 | 3300005536 | Ga0070697_100226244 | Ga0070697_1002262443 | 148 |
| 109 | 3300005543 | Ga0070672_100004419 | Ga0070672_10000441910 | 148 |
| 110 | 3300005544 | Ga0070686_100100765 | Ga0070686_1001007651 | 148 |
| 111 | 3300005544 | Ga0070686_101398640 | Ga0070686_1013986401 | 148 |
| 112 | 3300005545 | Ga0070695_100001122 | Ga0070695_10000112213 | 148 |
| 113 | 3300005545 | Ga0070695_100444144 | Ga0070695_1004441442 | 148 |
| 114 | 3300005545 | Ga0070695_100569520 | Ga0070695_1005695202 | 148 |
| 115 | 3300005546 | Ga0070696_100081554 | Ga0070696_1000815544 | 148 |
| 116 | 3300005546 | Ga0070696_100198021 | Ga0070696_1001980212 | 148 |
| 117 | 3300005546 | Ga0070696_100228251 | Ga0070696_1002282512 | 148 |
| 118 | 3300005547 | Ga0070693_100260896 | Ga0070693_1002608962 | 148 |
| 119 | 3300005548 | Ga0070665_100006732 | Ga0070665_1000067323 | 148 |
| 120 | 3300005548 | Ga0070665_100040389 | Ga0070665_1000403894 | 148 |
| 121 | 3300005548 | Ga0070665_101417716 | Ga0070665_1014177161 | 148 |
| 122 | 3300005563 | Ga0068855_100157265 | Ga0068855_1001572653 | 148 |
| 123 | 3300005563 | Ga0068855_100969582 | Ga0068855_1009695822 | 148 |
| 124 | 3300005564 | Ga0070664_100125381 | Ga0070664_1001253812 | 148 |
| 125 | 3300005564 | Ga0070664_100230791 | Ga0070664_1002307913 | 148 |
| 126 | 3300005577 | Ga0068857_100042715 | Ga0068857_1000427153 | 148 |
| 127 | 3300005578 | Ga0068854_100382419 | Ga0068854_1003824193 | 148 |
| 128 | 3300005614 | Ga0068856_100061025 | Ga0068856_1000610251 | 148 |
| 129 | 3300005616 | Ga0068852_100793475 | Ga0068852_1007934752 | 148 |
| 130 | 3300005617 | Ga0068859_101079688 | Ga0068859_1010796881 | 148 |
| 131 | 3300005718 | Ga0068866_10064790 | Ga0068866_100647902 | 148 |
| 132 | 3300005719 | Ga0068861_101385785 | Ga0068861_1013857852 | 148 |
| 133 | 3300005834 | Ga0068851_10648177 | Ga0068851_106481771 | 148 |
| 134 | 3300005840 | Ga0068870_10372571 | Ga0068870_103725712 | 148 |
| 135 | 3300005841 | Ga0068863_100113370 | Ga0068863_1001133702 | 148 |
| 136 | 3300005842 | Ga0068858_100322543 | Ga0068858_1003225432 | 148 |
| 137 | 3300005843 | Ga0068860_100561455 | Ga0068860_1005614553 | 148 |
| 138 | 3300005937 | Ga0081455_10000058 | Ga0081455_10000058101 | 148 |
| 139 | 3300005937 | Ga0081455_10007344 | Ga0081455_100073447 | 148 |
| 140 | 3300005937 | Ga0081455_10140763 | Ga0081455_101407632 | 148 |
| 141 | 3300005983 | Ga0081540_1014811 | Ga0081540_10148114 | 148 |
| 142 | 3300005983 | Ga0081540_1142939 | Ga0081540_11429392 | 148 |
| 143 | 3300006038 | Ga0075365_10002801 | Ga0075365_100028017 | 148 |
| 144 | 3300006038 | Ga0075365_10003928 | Ga0075365_100039287 | 148 |
| 145 | 3300006042 | Ga0075368_10025213 | Ga0075368_100252134 | 148 |
| 146 | 3300006048 | Ga0075363_100105906 | Ga0075363_1001059064 | 148 |
| 147 | 3300006051 | Ga0075364_10991509 | Ga0075364_109915092 | 148 |
| 148 | 3300006163 | Ga0070715_10000714 | Ga0070715_100007143 | 148 |
| 149 | 3300006173 | Ga0070716_100000449 | Ga0070716_10000044913 | 148 |
| 150 | 3300006173 | Ga0070716_101121380 | Ga0070716_1011213802 | 148 |
| 151 | 3300006175 | Ga0070712_100045298 | Ga0070712_1000452981 | 148 |
| 152 | 3300006175 | Ga0070712_100053492 | Ga0070712_1000534922 | 148 |
| 153 | 3300006178 | Ga0075367_10003265 | Ga0075367_100032655 | 148 |
| 154 | 3300006178 | Ga0075367_10017321 | Ga0075367_100173214 | 148 |
| 155 | 3300006237 | Ga0097621_100471631 | Ga0097621_1004716311 | 148 |
| 156 | 3300006237 | Ga0097621_100683175 | Ga0097621_1006831752 | 148 |
| 157 | 3300006353 | Ga0075370_10079548 | Ga0075370_100795482 | 148 |
| 158 | 3300006358 | Ga0068871_100028714 | Ga0068871_1000287144 | 148 |
| 159 | 3300006358 | Ga0068871_100435582 | Ga0068871_1004355822 | 148 |
| 160 | 3300006844 | Ga0075428_100002982 | Ga0075428_10000298213 | 148 |
| 161 | 3300006844 | Ga0075428_100042255 | Ga0075428_1000422551 | 148 |
| 162 | 3300006844 | Ga0075428_101526460 | Ga0075428_1015264602 | 148 |
| 163 | 3300006844 | Ga0075428_102671727 | Ga0075428_1026717271 | 148 |
| 164 | 3300006846 | Ga0075430_100052103 | Ga0075430_1000521032 | 148 |
| 165 | 3300006846 | Ga0075430_100100928 | Ga0075430_1001009282 | 148 |
| 166 | 3300006846 | Ga0075430_100102549 | Ga0075430_1001025493 | 148 |
| 167 | 3300006846 | Ga0075430_100201744 | Ga0075430_1002017443 | 148 |
| 168 | 3300006847 | Ga0075431_100006590 | Ga0075431_1000065908 | 148 |
| 169 | 3300006847 | Ga0075431_100016829 | Ga0075431_1000168298 | 148 |
| 170 | 3300006847 | Ga0075431_100028315 | Ga0075431_1000283156 | 148 |
| 171 | 3300006847 | Ga0075431_100042943 | Ga0075431_1000429435 | 148 |
| 172 | 3300006847 | Ga0075431_100049592 | Ga0075431_1000495923 | 148 |
| 173 | 3300006847 | Ga0075431_100168676 | Ga0075431_1001686764 | 148 |
| 174 | 3300006847 | Ga0075431_100847326 | Ga0075431_1008473262 | 148 |
| 175 | 3300006852 | Ga0075433_10222785 | Ga0075433_102227853 | 148 |
| 176 | 3300006871 | Ga0075434_100063914 | Ga0075434_1000639145 | 148 |
| 177 | 3300006880 | Ga0075429_100130137 | Ga0075429_1001301372 | 148 |
| 178 | 3300006880 | Ga0075429_100410176 | Ga0075429_1004101762 | 148 |
| 179 | 3300006881 | Ga0068865_100005989 | Ga0068865_1000059892 | 148 |
| 180 | 3300006914 | Ga0075436_100350865 | Ga0075436_1003508652 | 148 |
| 181 | 3300006931 | Ga0097620_101079741 | Ga0097620_1010797411 | 148 |
| 182 | 3300007265 | Ga0099794_10025383 | Ga0099794_100253833 | 148 |
| 183 | 3300007265 | Ga0099794_10309009 | Ga0099794_103090091 | 148 |
| 184 | 3300007788 | Ga0099795_10029751 | Ga0099795_100297512 | 148 |
| 185 | 3300007788 | Ga0099795_10289595 | Ga0099795_102895952 | 148 |
| 186 | 3300009093 | Ga0105240_10447965 | Ga0105240_104479652 | 148 |
| 187 | 3300009094 | Ga0111539_10001638 | Ga0111539_1000163815 | 148 |
| 188 | 3300009094 | Ga0111539_10029477 | Ga0111539_100294774 | 148 |
| 189 | 3300009094 | Ga0111539_10131177 | Ga0111539_101311774 | 148 |
| 190 | 3300009094 | Ga0111539_10749568 | Ga0111539_107495683 | 148 |
| 191 | 3300009094 | Ga0111539_10770570 | Ga0111539_107705702 | 148 |
| 192 | 3300009094 | Ga0111539_11884412 | Ga0111539_118844121 | 148 |
| 193 | 3300009098 | Ga0105245_10093791 | Ga0105245_100937913 | 148 |
| 194 | 3300009098 | Ga0105245_10426310 | Ga0105245_104263102 | 148 |
| 195 | 3300009101 | Ga0105247_10118868 | Ga0105247_101188682 | 148 |
| 196 | 3300009101 | Ga0105247_11483787 | Ga0105247_114837871 | 148 |
| 197 | 3300009147 | Ga0114129_10001489 | Ga0114129_1000148931 | 148 |
| 198 | 3300009147 | Ga0114129_10004660 | Ga0114129_100046604 | 148 |
| 199 | 3300009147 | Ga0114129_10477306 | Ga0114129_104773062 | 148 |
| 200 | 3300009147 | Ga0114129_10808824 | Ga0114129_108088242 | 148 |
| 201 | 3300009147 | Ga0114129_10893575 | Ga0114129_108935752 | 148 |
| 202 | 3300009148 | Ga0105243_10632277 | Ga0105243_106322772 | 148 |
| 203 | 3300009148 | Ga0105243_10791127 | Ga0105243_107911271 | 148 |
| 204 | 3300009174 | Ga0105241_10107114 | Ga0105241_101071142 | 148 |
| 205 | 3300009176 | Ga0105242_10006693 | Ga0105242_100066934 | 148 |
| 206 | 3300009177 | Ga0105248_10075639 | Ga0105248_100756391 | 148 |
| 207 | 3300009177 | Ga0105248_10349716 | Ga0105248_103497162 | 148 |
| 208 | 3300009177 | Ga0105248_10737052 | Ga0105248_107370523 | 148 |
| 209 | 3300009551 | Ga0105238_10090370 | Ga0105238_100903702 | 148 |
| 210 | 3300009551 | Ga0105238_11620403 | Ga0105238_116204031 | 148 |
| 211 | 3300009553 | Ga0105249_10376884 | Ga0105249_103768842 | 148 |
| 212 | 3300009765 | Ga0123341_1082672 | Ga0123341_10826722 | 148 |
| 213 | 3300010375 | Ga0105239_10005723 | Ga0105239_1000572313 | 148 |
| 214 | 3300010375 | Ga0105239_11145562 | Ga0105239_111455622 | 148 |
| 215 | 3300010375 | Ga0105239_11196080 | Ga0105239_111960801 | 148 |
| 216 | 3300011119 | Ga0105246_10910273 | Ga0105246_109102732 | 148 |
| 217 | 3300013104 | Ga0157370_10705633 | Ga0157370_107056331 | 148 |
| 218 | 3300013105 | Ga0157369_10599373 | Ga0157369_105993732 | 148 |
| 219 | 3300013296 | Ga0157374_10112983 | Ga0157374_101129832 | 148 |
| 220 | 3300013296 | Ga0157374_10336352 | Ga0157374_103363522 | 148 |
| 221 | 3300013296 | Ga0157374_10876428 | Ga0157374_108764282 | 148 |
| 222 | 3300013306 | Ga0163162_12349182 | Ga0163162_123491821 | 148 |
| 223 | 3300013307 | Ga0157372_10085393 | Ga0157372_100853932 | 148 |
| 224 | 3300013308 | Ga0157375_10184171 | Ga0157375_101841714 | 148 |
| 225 | 3300013308 | Ga0157375_11575729 | Ga0157375_115757292 | 148 |
| 226 | 3300013308 | Ga0157375_11666893 | Ga0157375_116668931 | 148 |
| 227 | 3300013308 | Ga0157375_12013204 | Ga0157375_120132041 | 148 |
| 228 | 3300013308 | Ga0157375_12128558 | Ga0157375_121285581 | 148 |
| 229 | 3300014325 | Ga0163163_10135016 | Ga0163163_101350162 | 148 |
| 230 | 3300014325 | Ga0163163_10233078 | Ga0163163_102330781 | 148 |
| 231 | 3300014968 | Ga0157379_10022250 | Ga0157379_100222504 | 148 |
| 232 | 3300014968 | Ga0157379_10383580 | Ga0157379_103835803 | 148 |
| 233 | 3300014968 | Ga0157379_11237378 | Ga0157379_112373782 | 148 |
| 234 | 3300014969 | Ga0157376_10960342 | Ga0157376_109603422 | 148 |
| 235 | 3300020081 | Ga0206354_10229693 | Ga0206354_102296938 | 148 |
| 236 | 3300020082 | Ga0206353_11805231 | Ga0206353_118052317 | 148 |
| 237 | 3300021361 | Ga0213872_10001236 | Ga0213872_1000123621 | 148 |
| 238 | 3300021384 | Ga0213876_10295429 | Ga0213876_102954291 | 148 |
| 239 | 3300025258 | Ga0209129_1004672 | Ga0209129_10046724 | 148 |
| 240 | 3300025273 | Ga0209673_1003809 | Ga0209673_10038095 | 148 |
| 241 | 3300025284 | Ga0209130_1011356 | Ga0209130_10113564 | 148 |
| 242 | 3300025294 | Ga0209025_1033874 | Ga0209025_10338744 | 148 |
| 243 | 3300025294 | Ga0209025_1086326 | Ga0209025_10863263 | 148 |
| 244 | 3300025294 | Ga0209025_1104260 | Ga0209025_11042601 | 148 |
| 245 | 3300025295 | Ga0209564_1018176 | Ga0209564_10181764 | 148 |
| 246 | 3300025297 | Ga0209758_1015852 | Ga0209758_10158521 | 148 |
| 247 | 3300025299 | Ga0209256_1014803 | Ga0209256_10148034 | 148 |
| 248 | 3300025302 | Ga0207426_1002621 | Ga0207426_100262110 | 148 |
| 249 | 3300025303 | Ga0209051_1015244 | Ga0209051_10152444 | 148 |
| 250 | 3300025893 | Ga0207682_10084409 | Ga0207682_100844092 | 148 |
| 251 | 3300025898 | Ga0207692_10155172 | Ga0207692_101551722 | 148 |
| 252 | 3300025899 | Ga0207642_10004598 | Ga0207642_100045983 | 148 |
| 253 | 3300025905 | Ga0207685_10043801 | Ga0207685_100438011 | 148 |
| 254 | 3300025905 | Ga0207685_10061127 | Ga0207685_100611272 | 148 |
| 255 | 3300025906 | Ga0207699_10071415 | Ga0207699_100714151 | 148 |
| 256 | 3300025907 | Ga0207645_10008093 | Ga0207645_100080935 | 148 |
| 257 | 3300025911 | Ga0207654_10268856 | Ga0207654_102688562 | 148 |
| 258 | 3300025911 | Ga0207654_10274218 | Ga0207654_102742181 | 148 |
| 259 | 3300025912 | Ga0207707_10001614 | Ga0207707_100016144 | 148 |
| 260 | 3300025913 | Ga0207695_10377655 | Ga0207695_103776552 | 148 |
| 261 | 3300025915 | Ga0207693_10000083 | Ga0207693_1000008329 | 148 |
| 262 | 3300025915 | Ga0207693_10204486 | Ga0207693_102044862 | 148 |
| 263 | 3300025918 | Ga0207662_10295032 | Ga0207662_102950322 | 148 |
| 264 | 3300025920 | Ga0207649_10293112 | Ga0207649_102931122 | 148 |
| 265 | 3300025921 | Ga0207652_10916467 | Ga0207652_109164672 | 148 |
| 266 | 3300025923 | Ga0207681_10221419 | Ga0207681_102214191 | 148 |
| 267 | 3300025923 | Ga0207681_10431226 | Ga0207681_104312262 | 148 |
| 268 | 3300025924 | Ga0207694_10149723 | Ga0207694_101497232 | 148 |
| 269 | 3300025927 | Ga0207687_10028228 | Ga0207687_100282284 | 148 |
| 270 | 3300025928 | Ga0207700_10286606 | Ga0207700_102866062 | 148 |
| 271 | 3300025929 | Ga0207664_10146050 | Ga0207664_101460504 | 148 |
| 272 | 3300025931 | Ga0207644_10043415 | Ga0207644_100434154 | 148 |
| 273 | 3300025931 | Ga0207644_10137714 | Ga0207644_101377143 | 148 |
| 274 | 3300025931 | Ga0207644_10248764 | Ga0207644_102487641 | 148 |
| 275 | 3300025932 | Ga0207690_11417920 | Ga0207690_114179201 | 148 |
| 276 | 3300025932 | Ga0207690_11544576 | Ga0207690_115445761 | 148 |
| 277 | 3300025933 | Ga0207706_10003176 | Ga0207706_100031765 | 148 |
| 278 | 3300025933 | Ga0207706_11083920 | Ga0207706_110839202 | 148 |
| 279 | 3300025934 | Ga0207686_10132872 | Ga0207686_101328722 | 148 |
| 280 | 3300025935 | Ga0207709_10624142 | Ga0207709_106241422 | 148 |
| 281 | 3300025937 | Ga0207669_10257157 | Ga0207669_102571572 | 148 |
| 282 | 3300025938 | Ga0207704_10250025 | Ga0207704_102500253 | 148 |
| 283 | 3300025939 | Ga0207665_10000587 | Ga0207665_1000058712 | 148 |
| 284 | 3300025939 | Ga0207665_10037791 | Ga0207665_100377913 | 148 |
| 285 | 3300025939 | Ga0207665_11036317 | Ga0207665_110363171 | 148 |
| 286 | 3300025940 | Ga0207691_10016487 | Ga0207691_100164877 | 148 |
| 287 | 3300025941 | Ga0207711_10193825 | Ga0207711_101938252 | 148 |
| 288 | 3300025941 | Ga0207711_10429180 | Ga0207711_104291802 | 148 |
| 289 | 3300025944 | Ga0207661_10222430 | Ga0207661_102224302 | 148 |
| 290 | 3300025949 | Ga0207667_10082789 | Ga0207667_100827893 | 148 |
| 291 | 3300025949 | Ga0207667_10608458 | Ga0207667_106084581 | 148 |
| 292 | 3300025960 | Ga0207651_10246098 | Ga0207651_102460982 | 148 |
| 293 | 3300025960 | Ga0207651_11031578 | Ga0207651_110315781 | 148 |
| 294 | 3300025960 | Ga0207651_12019629 | Ga0207651_120196291 | 148 |
| 295 | 3300025961 | Ga0207712_11256785 | Ga0207712_112567851 | 148 |
| 296 | 3300025972 | Ga0207668_10087746 | Ga0207668_100877462 | 148 |
| 297 | 3300025972 | Ga0207668_10351362 | Ga0207668_103513622 | 148 |
| 298 | 3300025981 | Ga0207640_10551823 | Ga0207640_105518232 | 148 |
| 299 | 3300025986 | Ga0207658_10146136 | Ga0207658_101461362 | 148 |
| 300 | 3300026023 | Ga0207677_10118489 | Ga0207677_101184892 | 148 |
| 301 | 3300026075 | Ga0207708_10193947 | Ga0207708_101939472 | 148 |
| 302 | 3300026078 | Ga0207702_10138353 | Ga0207702_101383533 | 148 |
| 303 | 3300026088 | Ga0207641_10345799 | Ga0207641_103457992 | 148 |
| 304 | 3300026088 | Ga0207641_11812181 | Ga0207641_118121811 | 148 |
| 305 | 3300026089 | Ga0207648_10003167 | Ga0207648_1000316717 | 148 |
| 306 | 3300026116 | Ga0207674_10020062 | Ga0207674_100200624 | 148 |
| 307 | 3300026116 | Ga0207674_10818338 | Ga0207674_108183381 | 148 |
| 308 | 3300026118 | Ga0207675_100004907 | Ga0207675_1000049075 | 148 |
| 309 | 3300026118 | Ga0207675_100658016 | Ga0207675_1006580161 | 148 |
| 310 | 3300026121 | Ga0207683_10002455 | Ga0207683_1000245511 | 148 |
| 311 | 3300026142 | Ga0207698_10994972 | Ga0207698_109949722 | 148 |
| 312 | 3300027682 | Ga0209971_1004557 | Ga0209971_10045573 | 148 |
| 313 | 3300027717 | Ga0209998_10005976 | Ga0209998_100059763 | 148 |
| 314 | 3300027866 | Ga0209813_10009170 | Ga0209813_100091704 | 148 |
| 315 | 3300027907 | Ga0207428_10067272 | Ga0207428_100672724 | 148 |
| 316 | 3300027907 | Ga0207428_10386451 | Ga0207428_103864512 | 148 |
| 317 | 3300028379 | Ga0268266_10019128 | Ga0268266_100191282 | 148 |
| 318 | 3300031344 | Ga0265316_10447276 | Ga0265316_104472761 | 148 |
| 319 | 3300031548 | Ga0307408_100468991 | Ga0307408_1004689911 | 148 |
| 320 | 3300031548 | Ga0307408_100910328 | Ga0307408_1009103281 | 148 |
| 321 | 3300031824 | Ga0307413_10104459 | Ga0307413_101044592 | 148 |
| 322 | 3300032004 | Ga0307414_10119131 | Ga0307414_101191313 | 148 |
| 323 | 3300032005 | Ga0307411_11441235 | Ga0307411_114412352 | 148 |
| 324 | 3300032126 | Ga0307415_100277662 | Ga0307415_1002776622 | 148 |
| 325 | 3300032126 | Ga0307415_102178040 | Ga0307415_1021780402 | 148 |
| 326 | 3300035083 | Ga0373926_0067873 | Ga0373926_0067873_128_574 | 148 |
| 327 | 3300035088 | Ga0373940_0062800 | Ga0373940_0062800_440_892 | 148 |
| 328 | 3300035090 | Ga0373949_0086013 | Ga0373949_0086013_296_748 | 148 |
| 329 | 3300035111 | Ga0373923_0182297 | Ga0373923_0182297_267_719 | 148 |
| 330 | 3300035117 | Ga0373953_0079389 | Ga0373953_0079389_196_648 | 148 |
| 331 | 3300035117 | Ga0373953_0124344 | Ga0373953_0124344_347_799 | 148 |
| 332 | 3300035118 | Ga0373954_0117613 | Ga0373954_0117613_555_1007 | 148 |
| 333 | 3300035170 | Ga0373943_0442803 | Ga0373943_0442803_17_469 | 148 |
| 334 | 3300035172 | Ga0373955_0015905 | Ga0373955_0015905_3188_3640 | 148 |
| 335 | 3300035172 | Ga0373955_0119699 | Ga0373955_0119699_778_1230 | 148 |
| 336 | 3300035241 | Ga0373961_0195311 | Ga0373961_0195311_33_485 | 148 |
| 337 | 3300035692 | Ga0373935_0828266 | Ga0373935_0828266_192_638 | 148 |
| 338 | 3300035695 | Ga0373927_0000772 | Ga0373927_0000772_12895_13341 | 148 |
| 339 | 3300035695 | Ga0373927_0064997 | Ga0373927_0064997_1893_2345 | 148 |
| 340 | 3300035695 | Ga0373927_0259811 | Ga0373927_0259811_29_481 | 148 |
| 341 | 3300035724 | Ga0373933_0038327 | Ga0373933_0038327_295_747 | 148 |
| 342 | 3300036401 | Ga0373937_0006608 | Ga0373937_0006608_350_802 | 148 |
| 343 | 3300036401 | Ga0373937_0049306 | Ga0373937_0049306_1076_1528 | 148 |
| 344 | 3300036401 | Ga0373937_0190795 | Ga0373937_0190795_95_547 | 148 |
| 345 | 3300036401 | Ga0373937_0513343 | Ga0373937_0513343_69_521 | 148 |
| 346 | 3300036401 | Ga0373937_1998775 | Ga0373937_1998775_40_486 | 148 |
| 347 | 3300037312 | Ga0395899_0005256 | Ga0395899_0005256_9404_9871 | 148 |
| 348 | 3300037312 | Ga0395899_0008193 | Ga0395899_0008193_4802_5269 | 148 |
| 349 | 3300037418 | Ga0395900_0009362 | Ga0395900_0009362_4850_5317 | 148 |
| 350 | 3300037418 | Ga0395900_0376114 | Ga0395900_0376114_610_1068 | 148 |
| 351 | 3300037466 | Ga0395898_0095189 | Ga0395898_0095189_1472_1939 | 148 |
| 352 | 3300037466 | Ga0395898_0357957 | Ga0395898_0357957_796_1263 | 148 |
| 353 | 3300037471 | Ga0395905_0168442 | Ga0395905_0168442_1251_1718 | 148 |
| 354 | 3300037853 | Ga0436364_1204884 | Ga0436364_1204884_1671_2123 | 148 |
| 355 | 3300038443 | Ga0395901_0020564 | Ga0395901_0020564_4846_5313 | 148 |
| 356 | 3300039437 | Ga0436365_0340625 | Ga0436365_0340625_620_1072 | 148 |
| 357 | 3300039437 | Ga0436365_0701502 | Ga0436365_0701502_302_754 | 148 |
| 358 | 3300039438 | Ga0436360_0122890 | Ga0436360_0122890_97_555 | 148 |
| 359 | 3300039438 | Ga0436360_0352942 | Ga0436360_0352942_468_923 | 148 |
| 360 | 3300039438 | Ga0436360_1031893 | Ga0436360_1031893_279_731 | 148 |
| 361 | 3300039438 | Ga0436360_1170569 | Ga0436360_1170569_126_578 | 148 |
| 362 | 3300039447 | Ga0436361_1165271 | Ga0436361_1165271_8479_8931 | 148 |
| 363 | 3300039453 | Ga0436362_0170168 | Ga0436362_0170168_275_727 | 148 |
| 364 | 3300041413 | Ga0439465_0130887 | Ga0439465_0130887_374_826 | 148 |
| 365 | 3300041505 | Ga0451849_0967899 | Ga0451849_0967899_188_634 | 148 |
| 366 | 3300042133 | Ga0450896_035893 | Ga0450896_035893_37_498 | 148 |
| 367 | 3300042436 | Ga0439435_0075695 | Ga0439435_0075695_411_872 | 148 |
| 368 | 3300044842 | Ga0466957_0430041 | Ga0466957_0430041_15_479 | 148 |
| 369 | 3300045976 | Ga0466967_1890625 | Ga0466967_1890625_94_546 | 148 |
| 370 | 3300046454 | Ga0495592_0012377 | Ga0495592_0012377_4785_5246 | 148 |
| 371 | 3300046454 | Ga0495592_0541624 | Ga0495592_0541624_41_493 | 148 |
| 372 | 3300046462 | Ga0495651_0402896 | Ga0495651_0402896_253_705 | 148 |
| 373 | 3300046471 | Ga0495650_0087307 | Ga0495650_0087307_201_653 | 148 |
| 374 | 3300046472 | Ga0495580_0002317 | Ga0495580_0002317_7576_8028 | 148 |
| 375 | 3300046472 | Ga0495580_0028129 | Ga0495580_0028129_2626_3078 | 148 |
| 376 | 3300046472 | Ga0495580_0032532 | Ga0495580_0032532_754_1206 | 148 |
| 377 | 3300046477 | Ga0495664_0673948 | Ga0495664_0673948_121_573 | 148 |
| 378 | 3300046492 | Ga0495585_0374396 | Ga0495585_0374396_28_474 | 148 |
| 379 | 3300046499 | Ga0495594_0486821 | Ga0495594_0486821_22_468 | 148 |
| 380 | 3300046506 | Ga0495583_0125424 | Ga0495583_0125424_181_627 | 148 |
| 381 | 3300046507 | Ga0495606_0294405 | Ga0495606_0294405_220_672 | 148 |
| 382 | 3300046507 | Ga0495606_0361544 | Ga0495606_0361544_135_581 | 148 |
| 383 | 3300046511 | Ga0495608_0100505 | Ga0495608_0100505_794_1246 | 148 |
| 384 | 3300046516 | Ga0495628_0192642 | Ga0495628_0192642_1075_1527 | 148 |
| 385 | 3300046535 | Ga0495586_0506526 | Ga0495586_0506526_39_491 | 148 |
| 386 | 3300046543 | Ga0495645_0129976 | Ga0495645_0129976_691_1143 | 148 |
| 387 | 3300046559 | Ga0495667_0007136 | Ga0495667_0007136_1641_2093 | 148 |
| 388 | 3300046616 | Ga0495668_0019219 | Ga0495668_0019219_2635_3081 | 148 |
| 389 | 3300046660 | Ga0495625_0143701 | Ga0495625_0143701_554_1000 | 148 |
| 390 | 3300046675 | Ga0495657_0038547 | Ga0495657_0038547_462_914 | 148 |
| 391 | 3300046675 | Ga0495657_0146608 | Ga0495657_0146608_78_530 | 148 |
| 392 | 3300046675 | Ga0495657_0206296 | Ga0495657_0206296_551_1003 | 148 |
| 393 | 3300046678 | Ga0495599_0263458 | Ga0495599_0263458_522_974 | 148 |
| 394 | 3300046679 | Ga0495623_0243639 | Ga0495623_0243639_405_857 | 148 |
| 395 | 3300046681 | Ga0495647_0239224 | Ga0495647_0239224_301_753 | 148 |
| 396 | 3300046683 | Ga0495658_0227048 | Ga0495658_0227048_290_742 | 148 |
| 397 | 3300046809 | Ga0495600_0149144 | Ga0495600_0149144_325_777 | 148 |
| 398 | 3300047317 | Ga0495604_0177444 | Ga0495604_0177444_240_701 | 148 |
| 399 | 3300047319 | Ga0495674_0172755 | Ga0495674_0172755_1239_1691 | 148 |
| 400 | 3300047322 | Ga0495680_0000817 | Ga0495680_0000817_32945_33397 | 148 |
| 401 | 3300047444 | Ga0495675_0007417 | Ga0495675_0007417_5883_6335 | 148 |
| 402 | 3300047471 | Ga0495684_0213231 | Ga0495684_0213231_127_579 | 148 |
| 403 | 3300047472 | Ga0495686_0040857 | Ga0495686_0040857_1298_1744 | 148 |
| 404 | 3300047472 | Ga0495686_0171809 | Ga0495686_0171809_310_756 | 148 |
| 405 | 3300048088 | Ga0495602_0229751 | Ga0495602_0229751_914_1366 | 148 |
| 406 | 3300048088 | Ga0495602_0705771 | Ga0495602_0705771_103_555 | 148 |
| 407 | 3300048088 | Ga0495602_1053812 | Ga0495602_1053812_51_503 | 148 |
| 408 | 3300048903 | Ga0496100_0099797 | Ga0496100_0099797_464_916 | 148 |
| 409 | 3300048903 | Ga0496100_0159739 | Ga0496100_0159739_902_1354 | 148 |
| 410 | 3300048903 | Ga0496100_0292265 | Ga0496100_0292265_389_841 | 148 |
| 411 | 3300048904 | Ga0496101_0002781 | Ga0496101_0002781_6767_7219 | 148 |
| 412 | 3300048904 | Ga0496101_0458546 | Ga0496101_0458546_295_747 | 148 |
| 413 | 3300048905 | Ga0496102_0079333 | Ga0496102_0079333_608_1060 | 148 |
| 414 | 3300048907 | Ga0496104_0122439 | Ga0496104_0122439_357_809 | 148 |
| 415 | 3300048907 | Ga0496104_0163771 | Ga0496104_0163771_1083_1535 | 148 |
| 416 | 3300048907 | Ga0496104_0351360 | Ga0496104_0351360_427_879 | 148 |
| 417 | 3300048908 | Ga0496105_0060265 | Ga0496105_0060265_1220_1672 | 148 |
| 418 | 3300048909 | Ga0496106_0019073 | Ga0496106_0019073_703_1155 | 148 |
| 419 | 3300048909 | Ga0496106_0474679 | Ga0496106_0474679_389_841 | 148 |
| 420 | 3300048910 | Ga0496107_0001015 | Ga0496107_0001015_14801_15253 | 148 |
| 421 | 3300048910 | Ga0496107_0479908 | Ga0496107_0479908_410_862 | 148 |
| 422 | 3300048910 | Ga0496107_0531169 | Ga0496107_0531169_96_548 | 148 |
| 423 | 3300048911 | Ga0496108_0038274 | Ga0496108_0038274_734_1186 | 148 |
| 424 | 3300048911 | Ga0496108_1072265 | Ga0496108_1072265_43_495 | 148 |
| 425 | 3300048912 | Ga0496109_0220308 | Ga0496109_0220308_1301_1753 | 148 |
| 426 | 3300048912 | Ga0496109_0438409 | Ga0496109_0438409_329_781 | 148 |
| 427 | 3300048913 | Ga0496110_0000749 | Ga0496110_0000749_6775_7227 | 148 |
| 428 | 3300048913 | Ga0496110_1622786 | Ga0496110_1622786_74_526 | 148 |
| 429 | 3300048914 | Ga0496111_0262853 | Ga0496111_0262853_585_1037 | 148 |
| 430 | 3300048915 | Ga0496112_0005843 | Ga0496112_0005843_4668_5120 | 148 |
| 431 | 3300048915 | Ga0496112_0138398 | Ga0496112_0138398_138_590 | 148 |
| 432 | 3300048915 | Ga0496112_0685121 | Ga0496112_0685121_450_902 | 148 |
| 433 | 3300048916 | Ga0496113_0036857 | Ga0496113_0036857_2245_2697 | 148 |
| 434 | 3300048916 | Ga0496113_1529551 | Ga0496113_1529551_34_486 | 148 |
| 435 | 3300048917 | Ga0496114_0001864 | Ga0496114_0001864_12691_13143 | 148 |
| 436 | 3300048917 | Ga0496114_0580000 | Ga0496114_0580000_274_720 | 148 |
| 437 | 3300048918 | Ga0496115_0131209 | Ga0496115_0131209_1563_2015 | 148 |
| 438 | 3300049568 | Ga0501031_0032810 | Ga0501031_0032810_1861_2313 | 148 |
| 439 | 3300049568 | Ga0501031_0038007 | Ga0501031_0038007_2073_2525 | 148 |
| 440 | 3300049569 | Ga0501032_0000347 | Ga0501032_0000347_12664_13116 | 148 |
| 441 | 3300049570 | Ga0501033_0001128 | Ga0501033_0001128_22199_22651 | 148 |
| 442 | 3300049570 | Ga0501033_0017584 | Ga0501033_0017584_817_1269 | 148 |
| 443 | 3300049570 | Ga0501033_0019916 | Ga0501033_0019916_1285_1737 | 148 |
| 444 | 3300049572 | Ga0501036_0000478 | Ga0501036_0000478_25883_26335 | 148 |
| 445 | 3300049572 | Ga0501036_0005040 | Ga0501036_0005040_4210_4662 | 148 |
| 446 | 3300049572 | Ga0501036_0077004 | Ga0501036_0077004_1267_1719 | 148 |
| 447 | 3300049573 | Ga0501037_0000473 | Ga0501037_0000473_25597_26049 | 148 |
| 448 | 3300049573 | Ga0501037_0092458 | Ga0501037_0092458_47_499 | 148 |
| 449 | 3300049573 | Ga0501037_0874143 | Ga0501037_0874143_24_476 | 148 |
| 450 | 3300049574 | Ga0501038_0004697 | Ga0501038_0004697_5031_5483 | 148 |
| 451 | 3300049574 | Ga0501038_0044079 | Ga0501038_0044079_2892_3344 | 148 |
| 452 | 3300049574 | Ga0501038_0080123 | Ga0501038_0080123_1973_2425 | 148 |
| 453 | 3300049574 | Ga0501038_0236005 | Ga0501038_0236005_379_831 | 148 |
| 454 | 3300049575 | Ga0501039_0001356 | Ga0501039_0001356_15965_16417 | 148 |
| 455 | 3300049575 | Ga0501039_0316871 | Ga0501039_0316871_325_777 | 148 |
| 456 | 3300049576 | Ga0501040_0000822 | Ga0501040_0000822_2498_2950 | 148 |
| 457 | 3300049578 | Ga0501042_0003268 | Ga0501042_0003268_7205_7657 | 148 |
| 458 | 3300049579 | Ga0501043_0000887 | Ga0501043_0000887_487_939 | 148 |
| 459 | 3300049579 | Ga0501043_0033954 | Ga0501043_0033954_1682_2134 | 148 |
| 460 | 3300049580 | Ga0501046_0000045 | Ga0501046_0000045_26428_26889 | 148 |
| 461 | 3300049580 | Ga0501046_0002039 | Ga0501046_0002039_16457_16909 | 148 |
| 462 | 3300049580 | Ga0501046_0266000 | Ga0501046_0266000_310_762 | 148 |
| 463 | 3300049581 | Ga0501047_0000694 | Ga0501047_0000694_25407_25859 | 148 |
| 464 | 3300049581 | Ga0501047_0166338 | Ga0501047_0166338_1503_1955 | 148 |
| 465 | 3300049582 | Ga0501048_0008242 | Ga0501048_0008242_2511_2963 | 148 |
| 466 | 3300049582 | Ga0501048_0426148 | Ga0501048_0426148_425_877 | 148 |
| 467 | 3300049584 | Ga0501068_0000204 | Ga0501068_0000204_2511_2963 | 148 |
| 468 | 3300049586 | Ga0501070_0132344 | Ga0501070_0132344_307_759 | 148 |
| 469 | 3300049587 | Ga0501071_0526200 | Ga0501071_0526200_156_608 | 148 |
| 470 | 3300049591 | Ga0501075_0031242 | Ga0501075_0031242_2189_2641 | 148 |
| 471 | 3300049592 | Ga0501076_0186867 | Ga0501076_0186867_175_627 | 148 |
| 472 | 3300049741 | Ga0501079_0706555 | Ga0501079_0706555_214_666 | 148 |
| 473 | 3300049822 | Ga0501035_0002182 | Ga0501035_0002182_2511_2963 | 148 |
| 474 | 3300049822 | Ga0501035_0026271 | Ga0501035_0026271_2287_2739 | 148 |
| 475 | 3300049822 | Ga0501035_0037373 | Ga0501035_0037373_328_780 | 148 |
| 476 | 3300049822 | Ga0501035_0676001 | Ga0501035_0676001_185_637 | 148 |
| 477 | 3300049823 | Ga0501044_0000772 | Ga0501044_0000772_25407_25859 | 148 |
| 478 | 3300049824 | Ga0501045_0046897 | Ga0501045_0046897_199_651 | 148 |
| 479 | 3300050490 | nmdc:mga03n38_59097_c1 | nmdc:mga03n38_59097_c1_345_797 | 148 |
| 480 | 3300050491 | nmdc:mga00v17_868227_c1 | nmdc:mga00v17_868227_c1_48_494 | 148 |
| 481 | 3300050492 | nmdc:mga0yw44_290048_c1 | nmdc:mga0yw44_290048_c1_609_1067 | 148 |
| 482 | 3300050494 | nmdc:mga06z11_34176_c1 | nmdc:mga06z11_34176_c1_1396_1848 | 148 |
| 483 | 3300050495 | nmdc:mga04h51_15060_c1 | nmdc:mga04h51_15060_c1_1485_1937 | 148 |
| 484 | 3300050507 | nmdc:mga05p37_7195_c1 | nmdc:mga05p37_7195_c1_4724_5176 | 148 |
| 485 | 3300050507 | nmdc:mga05p37_804963_c1 | nmdc:mga05p37_804963_c1_375_833 | 148 |
| 486 | 3300050508 | nmdc:mga09592_600651_c1 | nmdc:mga09592_600651_c1_174_635 | 148 |
| 487 | 3300050509 | nmdc:mga0qj67_102208_c1 | nmdc:mga0qj67_102208_c1_840_1298 | 148 |
| 488 | 3300050509 | nmdc:mga0qj67_187027_c1 | nmdc:mga0qj67_187027_c1_262_723 | 148 |
| 489 | 3300050509 | nmdc:mga0qj67_260371_c1 | nmdc:mga0qj67_260371_c1_851_1303 | 148 |
| 490 | 3300050509 | nmdc:mga0qj67_41346_c2 | nmdc:mga0qj67_41346_c2_475_927 | 148 |
| 491 | 3300050510 | nmdc:mga06r32_124110_c1 | nmdc:mga06r32_124110_c1_62_520 | 148 |
| 492 | 3300050510 | nmdc:mga06r32_12663_c1 | nmdc:mga06r32_12663_c1_3651_4112 | 148 |
| 493 | 3300050510 | nmdc:mga06r32_132992_c1 | nmdc:mga06r32_132992_c1_367_828 | 148 |
| 494 | 3300050510 | nmdc:mga06r32_155951_c1 | nmdc:mga06r32_155951_c1_1484_1936 | 148 |
| 495 | 3300050510 | nmdc:mga06r32_169500_c1 | nmdc:mga06r32_169500_c1_1363_1824 | 148 |
| 496 | 3300050510 | nmdc:mga06r32_17266_c1 | nmdc:mga06r32_17266_c1_869_1321 | 148 |
| 497 | 3300050511 | nmdc:mga08y16_13669_c1 | nmdc:mga08y16_13669_c1_2095_2547 | 148 |
| 498 | 3300050512 | nmdc:mga0n895_88021_c1 | nmdc:mga0n895_88021_c1_1533_1985 | 148 |
| 499 | 3300050514 | nmdc:mga08x19_318401_c1 | nmdc:mga08x19_318401_c1_495_947 | 148 |
| 500 | 3300050515 | nmdc:mga0a205_245158_c1 | nmdc:mga0a205_245158_c1_280_732 | 148 |
| 501 | 3300053077 | Ga0495601_0279698 | Ga0495601_0279698_275_727 | 148 |
| 502 | 3300053078 | Ga0495612_0171953 | Ga0495612_0171953_470_922 | 148 |
| 503 | 3300053084 | Ga0495595_0008503 | Ga0495595_0008503_300_752 | 148 |
| 504 | 3300053153 | Ga0500616_0054000 | Ga0500616_0054000_1636_2088 | 148 |
| 505 | 3300060344 | Ga0587071_141659 | Ga0587071_141659_16_462 | 148 |
| 506 | 3300060353 | Ga0501082_1165776 | Ga0501082_1165776_151_603 | 148 |
| 507 | 3300001979 | JGI24740J21852_10071177 | JGI24740J21852_100711772 | 149 |
| 508 | 3300001989 | JGI24739J22299_10006377 | JGI24739J22299_100063777 | 149 |
| 509 | 3300001990 | JGI24737J22298_10036113 | JGI24737J22298_100361132 | 149 |
| 510 | 3300005440 | Ga0070705_100332453 | Ga0070705_1003324531 | 149 |
| 511 | 3300005457 | Ga0070662_100050121 | Ga0070662_1000501213 | 149 |
| 512 | 3300005467 | Ga0070706_101558844 | Ga0070706_1015588441 | 149 |
| 513 | 3300005471 | Ga0070698_100584211 | Ga0070698_1005842112 | 149 |
| 514 | 3300005539 | Ga0068853_100001212 | Ga0068853_10000121217 | 149 |
| 515 | 3300005577 | Ga0068857_100118693 | Ga0068857_1001186933 | 149 |
| 516 | 3300005578 | Ga0068854_100010069 | Ga0068854_1000100698 | 149 |
| 517 | 3300005616 | Ga0068852_100776428 | Ga0068852_1007764282 | 149 |
| 518 | 3300005841 | Ga0068863_100154209 | Ga0068863_1001542092 | 149 |
| 519 | 3300005843 | Ga0068860_101388031 | Ga0068860_1013880311 | 149 |
| 520 | 3300005937 | Ga0081455_10592141 | Ga0081455_105921412 | 149 |
| 521 | 3300006871 | Ga0075434_100014125 | Ga0075434_1000141255 | 149 |
| 522 | 3300009092 | Ga0105250_10020527 | Ga0105250_100205272 | 149 |
| 523 | 3300009093 | Ga0105240_10000406 | Ga0105240_1000040642 | 149 |
| 524 | 3300009098 | Ga0105245_10012427 | Ga0105245_100124277 | 149 |
| 525 | 3300009147 | Ga0114129_10041628 | Ga0114129_100416286 | 149 |
| 526 | 3300009177 | Ga0105248_10135025 | Ga0105248_101350254 | 149 |
| 527 | 3300009551 | Ga0105238_10194360 | Ga0105238_101943602 | 149 |
| 528 | 3300009763 | Ga0123340_1056259 | Ga0123340_10562592 | 149 |
| 529 | 3300009763 | Ga0123340_1058161 | Ga0123340_10581612 | 149 |
| 530 | 3300009765 | Ga0123341_1082641 | Ga0123341_10826412 | 149 |
| 531 | 3300009766 | Ga0123342_1034070 | Ga0123342_10340704 | 149 |
| 532 | 3300013307 | Ga0157372_12648297 | Ga0157372_126482971 | 149 |
| 533 | 3300014325 | Ga0163163_10306114 | Ga0163163_103061143 | 149 |
| 534 | 3300025924 | Ga0207694_10134868 | Ga0207694_101348684 | 149 |
| 535 | 3300025927 | Ga0207687_10026282 | Ga0207687_100262822 | 149 |
| 536 | 3300025933 | Ga0207706_10009554 | Ga0207706_100095547 | 149 |
| 537 | 3300025949 | Ga0207667_11379864 | Ga0207667_113798642 | 149 |
| 538 | 3300025981 | Ga0207640_10288197 | Ga0207640_102881972 | 149 |
| 539 | 3300026041 | Ga0207639_10004188 | Ga0207639_100041888 | 149 |
| 540 | 3300026116 | Ga0207674_10099189 | Ga0207674_100991894 | 149 |
| 541 | 3300026142 | Ga0207698_10743699 | Ga0207698_107436992 | 149 |
| 542 | 3300027512 | Ga0209179_1069662 | Ga0209179_10696621 | 149 |
| 543 | 3300028381 | Ga0268264_10520821 | Ga0268264_105208212 | 149 |
| 544 | 3300031731 | Ga0307405_10027552 | Ga0307405_100275523 | 149 |
| 545 | 3300031731 | Ga0307405_10141450 | Ga0307405_101414503 | 149 |
| 546 | 3300031901 | Ga0307406_10160051 | Ga0307406_101600513 | 149 |
| 547 | 3300031911 | Ga0307412_10095880 | Ga0307412_100958803 | 149 |
| 548 | 3300032002 | Ga0307416_101482356 | Ga0307416_1014823562 | 149 |
| 549 | 3300032004 | Ga0307414_10976249 | Ga0307414_109762492 | 149 |
| 550 | 3300037471 | Ga0395905_0724916 | Ga0395905_0724916_66_542 | 149 |
| 551 | 3300046455 | Ga0495603_0221315 | Ga0495603_0221315_249_740 | 149 |
| 552 | 3300046457 | Ga0495590_0324923 | Ga0495590_0324923_37_507 | 149 |
| 553 | 3300046492 | Ga0495585_0288120 | Ga0495585_0288120_133_609 | 149 |
| 554 | 3300046501 | Ga0495607_0252098 | Ga0495607_0252098_85_576 | 149 |
| 555 | 3300046674 | Ga0495588_0138881 | Ga0495588_0138881_323_814 | 149 |
| 556 | 3300046689 | Ga0495613_0143223 | Ga0495613_0143223_143_646 | 149 |
| 557 | 3300046794 | Ga0495589_0098836 | Ga0495589_0098836_822_1313 | 149 |
| 558 | 3300046809 | Ga0495600_0533044 | Ga0495600_0533044_197_700 | 149 |
| 559 | 3300047471 | Ga0495684_0130791 | Ga0495684_0130791_393_896 | 149 |
| 560 | 3300047472 | Ga0495686_0000526 | Ga0495686_0000526_4175_4651 | 149 |
| 561 | 3300048907 | Ga0496104_0021841 | Ga0496104_0021841_3814_4344 | 149 |
| 562 | 3300048908 | Ga0496105_0111864 | Ga0496105_0111864_1515_2045 | 149 |
| 563 | 3300048918 | Ga0496115_0098142 | Ga0496115_0098142_213_674 | 149 |
| 564 | 3300048925 | Ga0496122_0058929 | Ga0496122_0058929_1019_1549 | 149 |
| 565 | 3300048927 | Ga0496124_0043314 | Ga0496124_0043314_634_1164 | 149 |
| 566 | 3300048928 | Ga0496125_0092215 | Ga0496125_0092215_1518_2048 | 149 |
| 567 | 3300049579 | Ga0501043_0317866 | Ga0501043_0317866_674_1129 | 149 |
| 568 | 3300049584 | Ga0501068_1163337 | Ga0501068_1163337_22_480 | 149 |
| 569 | 3300049589 | Ga0501073_0896528 | Ga0501073_0896528_142_600 | 149 |
| 570 | 3300049743 | Ga0501081_0853392 | Ga0501081_0853392_166_630 | 149 |
| 571 | 3300050507 | nmdc:mga05p37_179762_c1 | nmdc:mga05p37_179762_c1_977_1435 | 149 |
| 572 | 3300060353 | Ga0501082_1609412 | Ga0501082_1609412_74_532 | 149 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6v04-assembly1.cif.gz_A | dynu16 crystal structure, a putative protein in the dynemicin biosynthetic locus | 0.8669 | 3 | 148 |
| 3q63-assembly2.cif.gz_D | x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. | 0.8648 | 5 | 149 |
| 8es5-assembly1.cif.gz_B | aha1 domain protein from pseudomonas aeruginosa | 0.8519 | 5 | 149 |
| 3q6a-assembly1.cif.gz_A | x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 | 0.8506 | 5 | 149 |
| 3q6a-assembly1.cif.gz_D | x-ray crystal structure of the protein ssp2350 from staphylococcus saprophyticus, northeast structural genomics consortium target syr116 | 0.8398 | 5 | 149 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3q63F00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8238 | 5 | 149 | 3.30.530.20 |
| 2m89B00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8192 | 3 | 148 | 3.30.530.20 |
| af_Q8N9S3_197_326_3.30.530.20 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8188 | 5 | 149 | 3.30.530.20 |
| 2luzA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.8148 | 5 | 147 | 3.30.530.20 |
| 3q6aA00 | Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain | 0.813 | 3 | 149 | 3.30.530.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H8NFQ3-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 1.001 | 2 | 149 |
|
| AF-A0A6I2H0R6-F1-model_v4 | Vanillate O-demethylase oxidoreductase VanB | 1.001 | 4 | 148 |
GO:0008168
GO:0032259 |
| AF-A0A2V9JT73-F1-model_v4 | Vanillate O-demethylase oxidoreductase VanB | 1.001 | 22 | 147 |
GO:0008168
GO:0032259 |
| AF-A0A6L5FIU4-F1-model_v4 | Vanillate O-demethylase oxidoreductase VanB | 1 | 2 | 147 |
GO:0008168
GO:0032259 |
| AF-A0A5C5WGU9-F1-model_v4 | Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein | 0.998 | 4 | 148 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar