F464986

General Info

Members Datasets Scaffolds Average Seq Length
571 339 1142 290

Family's Representative Sequence

Representative Sequence 3300046454|Ga0495592_0001835|Ga0495592_0001835_4999_5973
Length 324
Sequence MTSPKFSASLEQGRPPLTPAASATSTAKRLPAEARPRRRPPAHRRSTPLTIAMLAVLAYFLLPLFWLLIASTKSTQDLFNSFGLWFSHTPQLLSNIKATFTQDDGVYGRWLLNTVLYAGASALGAALLAXXXGYGFAKYRFRGHGAAFNLVLGAIMIPTTALAIPTYLLFAKAGLVNTPWAVILPSLISPFGLYLMRIYAEDAVPDSLIEAARMDGAGELRIFLTIALRLLAPGLVTVILFTLVATWNNYFLPLIMLNDPDLYPITVGLSRWADQAQNGGAGASSDMLALVVTGSLISIIPLVLAFLMLQRYWQSGLATGGVKQ

Samples

Sample ID Description Type Environment
1 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
6 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
44 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
54 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
55 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
121 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
122 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
125 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
126 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
127 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
128 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
129 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
130 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
131 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
132 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
133 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
134 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
135 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
136 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
140 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
141 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
144 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
148 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
149 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
150 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
151 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
152 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
153 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
154 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
155 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
156 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
157 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
158 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
159 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
162 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
163 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
164 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
167 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
170 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
171 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
172 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
173 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
174 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
175 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
176 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
177 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
178 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
179 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
180 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
181 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
182 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
183 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
186 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
187 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
188 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
189 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
190 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
191 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
192 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
199 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
204 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
205 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
206 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
209 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
210 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
211 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
212 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
220 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
223 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
224 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
228 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
229 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
233 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
234 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
235 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
238 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
239 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
240 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
241 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
245 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
246 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
247 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
248 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
249 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
250 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
251 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
252 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
255 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
263 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
264 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
265 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
266 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
271 3300049685 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_B_3_control Metagenome Rhizosphere
272 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
273 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
274 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
275 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
276 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
277 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
278 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
285 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
286 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
287 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
288 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
289 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
290 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
291 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
292 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
295 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
296 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
297 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
298 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
299 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
300 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
302 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
303 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
304 2558860280 Kutzneria sp. 744 Isolate Unclassified
305 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
306 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
307 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
308 2643221647 Streptomyces sp. Root369 Isolate Unclassified
309 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
310 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
311 2643221714 Streptomyces sp. Root264 Isolate Unclassified
312 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
313 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
314 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
315 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
316 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
317 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
318 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
319 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
320 2808606394 Promicromonospora sp. C35 Isolate Unclassified
321 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
322 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
323 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
324 2867428634 Streptomyces sp. RP5T Isolate Unclassified
325 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
326 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
327 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
328 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
329 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
330 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
331 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
332 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
333 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
334 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
335 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
336 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
337 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
338 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
339 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 92.47
Metatranscriptomes 1.23
Isolates 6.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.78
Nodule 0.35
Rhizoplane 3.85
Rhizosphere 78.98
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495592_0001835 3300046454 Bacteria 14933
2 JGI24737J22298_10006796 3300001990 Bacteria 3886
3 JGI25406J46586_10003627 3300003203 Bacteria 7242
4 rootH1_10031132 3300003316 Bacteria 7138
5 rootH1_10103549 3300003323 Bacteria 5929
6 Ga0006562J51391_1204938 3300003578 Bacteria 1970
7 Ga0006562J51391_1204939 3300003578 Bacteria 1790
8 Ga0065714_10070907 3300005288 Bacteria 3731
9 Ga0070658_10106684 3300005327 Bacteria 2318
10 Ga0070683_100109440 3300005329 Bacteria 2606
11 Ga0070670_100028121 3300005331 Bacteria 4838
12 Ga0068869_100124994 3300005334 Bacteria 1971
13 Ga0070680_100050710 3300005336 Bacteria 3385
14 Ga0070682_100028977 3300005337 Bacteria 3332
15 Ga0070682_100145968 3300005337 Bacteria 1618
16 Ga0070682_100311586 3300005337 Bacteria 1159
17 Ga0068868_100053061 3300005338 Bacteria 3193
18 Ga0070660_100099047 3300005339 Bacteria 2308
19 Ga0070687_100018282 3300005343 Bacteria 3240
20 Ga0070687_100159805 3300005343 Bacteria 1331
21 Ga0070692_10033879 3300005345 Bacteria 2576
22 Ga0070668_100070954 3300005347 Bacteria 2713
23 Ga0070668_100182447 3300005347 Bacteria 1715
24 Ga0070671_100063234 3300005355 Bacteria 3082
25 Ga0070659_100067789 3300005366 Bacteria 2830
26 Ga0070659_100287466 3300005366 Bacteria 1369
27 Ga0070667_100058987 3300005367 Bacteria 3246
28 Ga0070709_10155932 3300005434 Bacteria 1583
29 Ga0070700_100036231 3300005441 Bacteria 2991
30 Ga0070663_100056607 3300005455 Bacteria 2810
31 Ga0070663_100107741 3300005455 Bacteria 2089
32 Ga0070678_100092915 3300005456 Bacteria 2319
33 Ga0070678_100235886 3300005456 Bacteria 1527
34 Ga0070662_100315557 3300005457 Bacteria 1273
35 Ga0070681_10096650 3300005458 Bacteria 2902
36 Ga0070685_10067259 3300005466 Bacteria 2113
37 Ga0070684_100239325 3300005535 Bacteria 1658
38 Ga0068853_100033935 3300005539 Bacteria 4330
39 Ga0068853_100046139 3300005539 Bacteria 3735
40 Ga0070672_100080751 3300005543 Bacteria 2606
41 Ga0070672_100084492 3300005543 Bacteria 2549
42 Ga0070672_100138924 3300005543 Bacteria 2003
43 Ga0070696_100411309 3300005546 Bacteria 1060
44 Ga0070704_100294181 3300005549 Bacteria 1350
45 Ga0068855_100139152 3300005563 Bacteria 2769
46 Ga0070664_100038279 3300005564 Bacteria 4037
47 Ga0068857_100000743 3300005577 Bacteria 24306
48 Ga0068857_100044791 3300005577 Bacteria 3925
49 Ga0068857_100125071 3300005577 Bacteria 2317
50 Ga0068857_100392143 3300005577 Bacteria 1291
51 Ga0068856_100010052 3300005614 Bacteria 9192
52 Ga0068856_100102126 3300005614 Bacteria 2861
53 Ga0068856_100135086 3300005614 Bacteria 2472
54 Ga0070702_100029129 3300005615 Bacteria 2999
55 Ga0068852_100171711 3300005616 Bacteria 2033
56 Ga0068852_100294924 3300005616 Bacteria 1568
57 Ga0068859_100317198 3300005617 Bacteria 1652
58 Ga0068866_10209600 3300005718 Bacteria 1169
59 Ga0068866_10336469 3300005718 Bacteria 955
60 Ga0068861_100036096 3300005719 Bacteria 3666
61 Ga0068861_100127401 3300005719 Bacteria 2062
62 Ga0068870_10258578 3300005840 Bacteria 1082
63 Ga0068863_100073776 3300005841 Bacteria 3228
64 Ga0068863_100171159 3300005841 Bacteria 2083
65 Ga0068863_100325527 3300005841 Bacteria 1493
66 Ga0068858_100622911 3300005842 Bacteria 1047
67 Ga0068860_100000631 3300005843 Bacteria 41527
68 Ga0068862_100016342 3300005844 Bacteria 6177
69 Ga0081455_10001434 3300005937 Bacteria 29516
70 Ga0081455_10007435 3300005937 Bacteria 11540
71 Ga0081455_10025713 3300005937 Bacteria 5429
72 Ga0081455_10030248 3300005937 Bacteria 4922
73 Ga0081455_10046344 3300005937 Bacteria 3773
74 Ga0081455_10080138 3300005937 Bacteria 2678
75 Ga0081455_10155281 3300005937 Bacteria 1760
76 Ga0081538_10000614 3300005981 Bacteria 39533
77 Ga0081539_10001475 3300005985 Bacteria 39913
78 Ga0081539_10001493 3300005985 Bacteria 39552
79 Ga0081539_10003600 3300005985 Bacteria 18743
80 Ga0081539_10004640 3300005985 Bacteria 14956
81 Ga0081539_10007488 3300005985 Bacteria 9925
82 Ga0081539_10087643 3300005985 Bacteria 1617
83 Ga0075365_10029282 3300006038 Bacteria 3518
84 Ga0075368_10002036 3300006042 Bacteria 6538
85 Ga0075363_100003846 3300006048 Bacteria 6473
86 Ga0075364_10191992 3300006051 Bacteria 1383
87 Ga0075367_10000946 3300006178 Bacteria 11807
88 Ga0075370_10035418 3300006353 Bacteria 2801
89 Ga0075428_100002003 3300006844 Bacteria 21949
90 Ga0075428_100086512 3300006844 Bacteria 3419
91 Ga0075431_100043445 3300006847 Bacteria 4637
92 Ga0075433_10017043 3300006852 Bacteria 6006
93 Ga0075433_10432042 3300006852 Bacteria 1161
94 Ga0075434_100013147 3300006871 Bacteria 7863
95 Ga0097620_100317198 3300006931 Bacteria 1652
96 Ga0075435_100001174 3300007076 Bacteria 16738
97 Ga0105244_10070256 3300009036 Bacteria 1747
98 Ga0105240_10020819 3300009093 Bacteria 8736
99 Ga0111539_10038057 3300009094 Bacteria 5803
100 Ga0105245_10049567 3300009098 Bacteria 3761
101 Ga0105245_10051561 3300009098 Bacteria 3689
102 Ga0105245_10065478 3300009098 Bacteria 3287
103 Ga0105245_10163929 3300009098 Bacteria 2111
104 Ga0105245_10192491 3300009098 Bacteria 1954
105 Ga0105245_10364740 3300009098 Bacteria 1434
106 Ga0105247_10071552 3300009101 Bacteria 2169
107 Ga0105247_10314150 3300009101 Bacteria 1091
108 Ga0105247_10347946 3300009101 Bacteria 1041
109 Ga0114129_10021340 3300009147 Bacteria 9195
110 Ga0105243_10077613 3300009148 Bacteria 2702
111 Ga0105243_10121307 3300009148 Bacteria 2204
112 Ga0105243_10534736 3300009148 Bacteria 1117
113 Ga0105241_10001415 3300009174 Bacteria 18390
114 Ga0105242_10252601 3300009176 Bacteria 1589
115 Ga0105248_10000365 3300009177 Bacteria 52722
116 Ga0105248_10217498 3300009177 Bacteria 2152
117 Ga0105248_10445893 3300009177 Bacteria 1458
118 Ga0105237_10012322 3300009545 Bacteria 9009
119 Ga0105237_10256147 3300009545 Bacteria 1752
120 Ga0105249_10032836 3300009553 Bacteria 4697
121 Ga0105249_10052646 3300009553 Bacteria 3718
122 Ga0105249_10077534 3300009553 Bacteria 3082
123 Ga0105249_10643501 3300009553 Bacteria 1117
124 Ga0105239_10015562 3300010375 Bacteria 8425
125 Ga0105246_10021889 3300011119 Bacteria 4121
126 Ga0157369_10658897 3300013105 Bacteria 1079
127 Ga0157374_10015647 3300013296 Bacteria 6659
128 Ga0157378_10153840 3300013297 Bacteria 2145
129 Ga0163162_10205306 3300013306 Bacteria 2099
130 Ga0163162_10337882 3300013306 Bacteria 1638
131 Ga0163162_10409472 3300013306 Bacteria 1489
132 Ga0157372_10137446 3300013307 Bacteria 2815
133 Ga0157372_10558968 3300013307 Bacteria 1334
134 Ga0157372_10750481 3300013307 Bacteria 1135
135 Ga0157375_10657220 3300013308 Bacteria 1204
136 Ga0163163_10044574 3300014325 Bacteria 4351
137 Ga0163163_10061534 3300014325 Bacteria 3720
138 Ga0163163_10139544 3300014325 Bacteria 2466
139 Ga0163163_10799123 3300014325 Bacteria 1007
140 Ga0157380_10308003 3300014326 Bacteria 1462
141 Ga0157377_10015031 3300014745 Bacteria 3948
142 Ga0183367_1004 3300015688 Bacteria 716880
143 Ga0163161_10199442 3300017792 Bacteria 1542
144 Ga0209148_1001485 3300025254 Bacteria 11737
145 Ga0207655_1097702 3300025728 Bacteria 1018
146 Ga0207710_10162102 3300025900 Bacteria 1090
147 Ga0207647_10027659 3300025904 Bacteria 3694
148 Ga0207643_10019126 3300025908 Bacteria 3753
149 Ga0207705_10033743 3300025909 Bacteria 3657
150 Ga0207654_10000001 3300025911 Bacteria 1816198
151 Ga0207695_10016594 3300025913 Bacteria 8607
152 Ga0207671_10006645 3300025914 Bacteria 10252
153 Ga0207662_10044892 3300025918 Bacteria 2611
154 Ga0207657_10185413 3300025919 Bacteria 1681
155 Ga0207694_10188056 3300025924 Bacteria 1677
156 Ga0207687_10064430 3300025927 Bacteria 2599
157 Ga0207687_10083896 3300025927 Bacteria 2308
158 Ga0207687_10094070 3300025927 Bacteria 2192
159 Ga0207687_10095137 3300025927 Bacteria 2181
160 Ga0207687_10430371 3300025927 Bacteria 1091
161 Ga0207690_10161722 3300025932 Bacteria 1670
162 Ga0207709_10161097 3300025935 Bacteria 1565
163 Ga0207709_10327543 3300025935 Bacteria 1149
164 Ga0207704_10379752 3300025938 Bacteria 1109
165 Ga0207691_10038952 3300025940 Bacteria 4398
166 Ga0207691_10081974 3300025940 Bacteria 2899
167 Ga0207691_10099722 3300025940 Bacteria 2593
168 Ga0207711_10000340 3300025941 Bacteria 49514
169 Ga0207661_10081068 3300025944 Bacteria 2680
170 Ga0207661_10158479 3300025944 Bacteria 1962
171 Ga0207679_10052195 3300025945 Bacteria 2998
172 Ga0207667_10045638 3300025949 Bacteria 4640
173 Ga0207668_10031962 3300025972 Bacteria 3472
174 Ga0207677_10114805 3300026023 Bacteria 2013
175 Ga0207677_10220613 3300026023 Bacteria 1520
176 Ga0207703_10095478 3300026035 Bacteria 2508
177 Ga0207639_10011075 3300026041 Bacteria 6255
178 Ga0207678_10014353 3300026067 Bacteria 6966
179 Ga0207678_10186062 3300026067 Bacteria 1774
180 Ga0207678_10323915 3300026067 Bacteria 1326
181 Ga0207708_10041613 3300026075 Bacteria 3502
182 Ga0207708_10228738 3300026075 Bacteria 1492
183 Ga0207702_10008774 3300026078 Bacteria 8521
184 Ga0207702_10010881 3300026078 Bacteria 7589
185 Ga0207641_10186102 3300026088 Bacteria 1905
186 Ga0207674_10001982 3300026116 Bacteria 25944
187 Ga0207674_10019601 3300026116 Bacteria 7323
188 Ga0207674_10044777 3300026116 Bacteria 4557
189 Ga0207674_10595220 3300026116 Bacteria 1068
190 Ga0207675_100012668 3300026118 Bacteria 7879
191 Ga0207675_100021272 3300026118 Bacteria 6041
192 Ga0207675_100584136 3300026118 Bacteria 1119
193 Ga0207683_10135082 3300026121 Bacteria 2220
194 Ga0209813_10035569 3300027866 Bacteria 1492
195 Ga0207428_10009325 3300027907 Bacteria 8802
196 Ga0268265_10411740 3300028380 Bacteria 1253
197 Ga0268264_10001893 3300028381 Bacteria 18990
198 Ga0307517_10002208 3300028786 Bacteria 31459
199 Ga0307517_10017578 3300028786 Bacteria 9314
200 Ga0307515_10000025 3300028794 Bacteria 390205
201 Ga0307515_10001892 3300028794 Bacteria 46582
202 Ga0307515_10054085 3300028794 Bacteria 5902
203 Ga0307515_10200302 3300028794 Bacteria 1874
204 Ga0307511_10015772 3300030521 Bacteria 7305
205 Ga0307512_10025790 3300030522 Bacteria 5200
206 Ga0307512_10033438 3300030522 Bacteria 4420
207 Ga0316177_1029591 3300030731 Bacteria 2697
208 Ga0314311_1057787 3300030733 Bacteria 1676
209 Ga0316179_1080272 3300030734 Bacteria 1551
210 Ga0307513_10370288 3300031456 Bacteria 1175
211 Ga0307509_10020406 3300031507 Bacteria 7517
212 Ga0307509_10045377 3300031507 Bacteria 4739
213 Ga0307509_10055056 3300031507 Bacteria 4229
214 Ga0307408_100002739 3300031548 Bacteria 12229
215 Ga0307408_100008774 3300031548 Bacteria 6674
216 Ga0307408_100081741 3300031548 Bacteria 2416
217 Ga0307408_100135967 3300031548 Bacteria 1923
218 Ga0307408_100324096 3300031548 Bacteria 1299
219 Ga0307508_10004924 3300031616 Bacteria 12852
220 Ga0307508_10015871 3300031616 Bacteria 6863
221 Ga0307508_10051617 3300031616 Bacteria 3655
222 Ga0307508_10140454 3300031616 Bacteria 2019
223 Ga0307514_10007902 3300031649 Bacteria 9125
224 Ga0307516_10001224 3300031730 Bacteria 35749
225 Ga0307516_10021937 3300031730 Bacteria 6561
226 Ga0307516_10052870 3300031730 Bacteria 3975
227 Ga0307516_10081822 3300031730 Bacteria 3071
228 Ga0307516_10084159 3300031730 Bacteria 3020
229 Ga0307516_10152513 3300031730 Bacteria 2069
230 Ga0307405_10017630 3300031731 Bacteria 3923
231 Ga0307405_10020275 3300031731 Bacteria 3712
232 Ga0307413_10011684 3300031824 Bacteria 4333
233 Ga0307413_10019189 3300031824 Bacteria 3607
234 Ga0307413_10020770 3300031824 Bacteria 3501
235 Ga0307413_10024372 3300031824 Bacteria 3298
236 Ga0307518_10040551 3300031838 Bacteria 3386
237 Ga0307518_10188841 3300031838 Bacteria 1383
238 Ga0307518_10261598 3300031838 Bacteria 1089
239 Ga0307410_10001657 3300031852 Bacteria 10246
240 Ga0307410_10023548 3300031852 Bacteria 3831
241 Ga0307410_10034272 3300031852 Bacteria 3286
242 Ga0307410_10141712 3300031852 Bacteria 1779
243 Ga0326468_10001800 3300031889 Bacteria 1826
244 Ga0307406_10000550 3300031901 Bacteria 21605
245 Ga0307406_10007372 3300031901 Bacteria 6098
246 Ga0307406_10069837 3300031901 Bacteria 2298
247 Ga0307406_10276687 3300031901 Bacteria 1278
248 Ga0307407_10020519 3300031903 Bacteria 3388
249 Ga0307407_10031573 3300031903 Bacteria 2870
250 Ga0307407_10033160 3300031903 Bacteria 2815
251 Ga0307407_10104349 3300031903 Bacteria 1766
252 Ga0307407_10119872 3300031903 Bacteria 1666
253 Ga0307407_10146496 3300031903 Bacteria 1530
254 Ga0307412_10005767 3300031911 Bacteria 6966
255 Ga0307412_10009668 3300031911 Bacteria 5536
256 Ga0307412_10018775 3300031911 Bacteria 4170
257 Ga0307412_10199413 3300031911 Bacteria 1519
258 Ga0307409_100000736 3300031995 Bacteria 14695
259 Ga0307409_100006708 3300031995 Bacteria 6806
260 Ga0307409_100006955 3300031995 Bacteria 6718
261 Ga0307409_100063813 3300031995 Bacteria 2890
262 Ga0307409_100103358 3300031995 Bacteria 2369
263 Ga0307409_100312917 3300031995 Bacteria 1466
264 Ga0307416_100000340 3300032002 Bacteria 24185
265 Ga0307416_100007100 3300032002 Bacteria 7079
266 Ga0307416_100012511 3300032002 Bacteria 5719
267 Ga0307416_100013068 3300032002 Bacteria 5628
268 Ga0307416_100056028 3300032002 Bacteria 3178
269 Ga0307416_100100584 3300032002 Bacteria 2515
270 Ga0307416_100180907 3300032002 Bacteria 1976
271 Ga0307416_100246513 3300032002 Bacteria 1735
272 Ga0307414_10009363 3300032004 Bacteria 5620
273 Ga0307414_10110119 3300032004 Bacteria 2094
274 Ga0307414_10115216 3300032004 Bacteria 2055
275 Ga0307414_10192439 3300032004 Bacteria 1652
276 Ga0307411_10006502 3300032005 Bacteria 5855
277 Ga0307411_10011082 3300032005 Bacteria 4843
278 Ga0307411_10107233 3300032005 Bacteria 1990
279 Ga0307411_10139977 3300032005 Bacteria 1783
280 Ga0307415_100000176 3300032126 Bacteria 28510
281 Ga0307415_100004324 3300032126 Bacteria 7354
282 Ga0307415_100009600 3300032126 Bacteria 5435
283 Ga0307415_100022220 3300032126 Bacteria 3911
284 Ga0307415_100032899 3300032126 Bacteria 3359
285 Ga0307415_100106001 3300032126 Bacteria 2074
286 Ga0307415_100217714 3300032126 Bacteria 1528
287 Ga0307507_10015152 3300033179 Bacteria 9099
288 Ga0307507_10029493 3300033179 Bacteria 5815
289 Ga0307507_10045192 3300033179 Bacteria 4337
290 Ga0307507_10116480 3300033179 Bacteria 2158
291 Ga0307510_10142835 3300033180 Bacteria 2033
292 Ga0373940_0004275 3300035088 Bacteria 3008
293 Ga0373951_0000049 3300035091 Bacteria 47611
294 Ga0373941_0027973 3300035115 Bacteria 1651
295 Ga0373942_0002128 3300035207 Bacteria 4904
296 Ga0373962_0001042 3300035242 Bacteria 6430
297 Ga0395900_0023096 3300037418 Bacteria 6365
298 Ga0395898_0013350 3300037466 Bacteria 8460
299 Ga0395905_0067103 3300037471 Bacteria 3360
300 Ga0395901_0032950 3300038443 Bacteria 5345
301 Ga0395901_0326889 3300038443 Bacteria 1586
302 Ga0439439_0013146 3300041406 Bacteria 2005
303 Ga0451789_0002229 3300041443 Bacteria 3147
304 Ga0451791_0044804 3300041451 Bacteria 2099
305 Ga0451791_0279174 3300041451 Bacteria 2570
306 Ga0451791_1725454 3300041451 Bacteria 1224
307 Ga0451793_0786197 3300041452 Bacteria 1569
308 Ga0451807_0078752 3300041486 Bacteria 1277
309 Ga0451807_0441246 3300041486 Bacteria 1257
310 Ga0451807_1909701 3300041486 Bacteria 1389
311 Ga0451833_0465043 3300041491 Bacteria 1117
312 Ga0451837_0464582 3300041494 Bacteria 2466
313 Ga0451839_0404140 3300041496 Bacteria 894
314 Ga0451841_1196870 3300041498 Bacteria 1792
315 Ga0451843_0451920 3300041509 Bacteria 3334
316 Ga0451853_1365077 3300041512 Bacteria 1458
317 Ga0439431_0036474 3300041997 Bacteria 1238
318 Ga0439449_0003718 3300042007 Bacteria 5917
319 Ga0439463_005832 3300042016 Bacteria 3058
320 Ga0439458_0028095 3300042157 Bacteria 1330
321 Ga0466969_0020497 3300044656 Bacteria 3423
322 Ga0466965_0000536 3300044683 Bacteria 13677
323 Ga0466966_0005223 3300044684 Bacteria 8535
324 Ga0466966_0083098 3300044684 Bacteria 1993
325 Ga0466961_0004724 3300044693 Bacteria 8568
326 Ga0466963_0000867 3300044694 Bacteria 15312
327 Ga0466964_0070413 3300044706 Bacteria 1478
328 Ga0466971_0000558 3300044719 Bacteria 14746
329 Ga0466970_0000414 3300044765 Bacteria 20867
330 Ga0466957_0002513 3300044842 Bacteria 9870
331 Ga0466960_0105713 3300044901 Bacteria 1455
332 Ga0466960_0140901 3300044901 Bacteria 1281
333 Ga0466959_0015694 3300045049 Bacteria 5523
334 Ga0466958_0027958 3300045836 Bacteria 3340
335 Ga0466967_0004720 3300045976 Bacteria 9265
336 Ga0466967_0026116 3300045976 Bacteria 4831
337 Ga0466967_0102643 3300045976 Bacteria 2616
338 Ga0495617_046239 3300046452 Bacteria 1450
339 Ga0495627_030641 3300046453 Bacteria 1704
340 Ga0495592_0003204 3300046454 Bacteria 11728
341 Ga0495592_0025591 3300046454 Bacteria 4478
342 Ga0495592_0176915 3300046454 Bacteria 1456
343 Ga0495603_0000911 3300046455 Bacteria 16993
344 Ga0495590_0000142 3300046457 Bacteria 43345
345 Ga0495629_0009114 3300046459 Bacteria 7269
346 Ga0495629_0044899 3300046459 Bacteria 3100
347 Ga0495629_0053946 3300046459 Bacteria 2811
348 Ga0495629_0054834 3300046459 Bacteria 2788
349 Ga0495629_0056633 3300046459 Bacteria 2740
350 Ga0495638_0024173 3300046460 Bacteria 3965
351 Ga0495638_0032867 3300046460 Bacteria 3321
352 Ga0495651_0013615 3300046462 Bacteria 6287
353 Ga0495651_0115582 3300046462 Bacteria 1978
354 Ga0495653_0002029 3300046463 Bacteria 15922
355 Ga0495653_0159540 3300046463 Bacteria 1567
356 Ga0495580_0033730 3300046472 Bacteria 3687
357 Ga0495605_0001464 3300046474 Bacteria 15422
358 Ga0495662_0001362 3300046476 Bacteria 12078
359 Ga0495662_0002684 3300046476 Bacteria 8984
360 Ga0495662_0123731 3300046476 Bacteria 1270
361 Ga0495664_0001605 3300046477 Bacteria 12024
362 Ga0495664_0029546 3300046477 Bacteria 3206
363 Ga0495585_0024697 3300046492 Bacteria 3444
364 Ga0495585_0073162 3300046492 Bacteria 1866
365 Ga0495594_0022491 3300046499 Bacteria 3372
366 Ga0495594_0035256 3300046499 Bacteria 2725
367 Ga0495594_0095915 3300046499 Bacteria 1666
368 Ga0495596_0037125 3300046500 Bacteria 1928
369 Ga0495607_0037388 3300046501 Bacteria 2916
370 Ga0495583_0005674 3300046506 Bacteria 8397
371 Ga0495606_0009352 3300046507 Bacteria 8301
372 Ga0495608_0017280 3300046511 Bacteria 4992
373 Ga0495608_0041724 3300046511 Bacteria 3069
374 Ga0495616_0022931 3300046513 Bacteria 3364
375 Ga0495620_0011710 3300046515 Bacteria 4561
376 Ga0495620_0011920 3300046515 Bacteria 4516
377 Ga0495628_0004079 3300046516 Bacteria 12987
378 Ga0495628_0008151 3300046516 Bacteria 9014
379 Ga0495628_0025140 3300046516 Bacteria 4866
380 Ga0495630_0031378 3300046517 Bacteria 3956
381 Ga0495630_0060988 3300046517 Bacteria 2832
382 Ga0495631_0002744 3300046518 Bacteria 9760
383 Ga0495643_0002615 3300046522 Bacteria 14014
384 Ga0495643_0012039 3300046522 Bacteria 5233
385 Ga0495643_0142248 3300046522 Bacteria 1195
386 Ga0495643_0160668 3300046522 Bacteria 1106
387 Ga0495648_0007727 3300046524 Bacteria 8564
388 Ga0495666_0002838 3300046526 Bacteria 8670
389 Ga0495666_0029465 3300046526 Bacteria 2700
390 Ga0495652_0003709 3300046529 Bacteria 14945
391 Ga0495652_0016428 3300046529 Bacteria 6622
392 Ga0495652_0210209 3300046529 Bacteria 1469
393 Ga0495652_0311507 3300046529 Bacteria 1140
394 Ga0495640_0008123 3300046533 Bacteria 8241
395 Ga0495640_0048147 3300046533 Bacteria 2947
396 Ga0495640_0136316 3300046533 Bacteria 1585
397 Ga0495587_0032614 3300046536 Bacteria 3147
398 Ga0495609_0037345 3300046538 Bacteria 2191
399 Ga0495597_0013995 3300046542 Bacteria 3831
400 Ga0495667_0034622 3300046559 Bacteria 3376
401 Ga0495668_0056109 3300046616 Bacteria 2174
402 Ga0495668_0103471 3300046616 Bacteria 1558
403 Ga0495634_0000745 3300046642 Bacteria 31538
404 Ga0495634_0011240 3300046642 Bacteria 6525
405 Ga0495634_0169199 3300046642 Bacteria 1374
406 Ga0495625_0003926 3300046660 Bacteria 14294
407 Ga0495625_0046547 3300046660 Bacteria 3129
408 Ga0495635_0007408 3300046663 Bacteria 7657
409 Ga0495635_0012263 3300046663 Bacteria 6006
410 Ga0495635_0018381 3300046663 Bacteria 4878
411 Ga0495635_0050288 3300046663 Bacteria 2873
412 Ga0495659_0134967 3300046664 Bacteria 981
413 Ga0495661_0015815 3300046665 Bacteria 5025
414 Ga0495588_0006810 3300046674 Bacteria 5173
415 Ga0495657_0003773 3300046675 Bacteria 12271
416 Ga0495657_0032694 3300046675 Bacteria 3628
417 Ga0495657_0039572 3300046675 Bacteria 3238
418 Ga0495657_0050745 3300046675 Bacteria 2788
419 Ga0495623_0008482 3300046679 Bacteria 6676
420 Ga0495623_0010093 3300046679 Bacteria 6111
421 Ga0495623_0011396 3300046679 Bacteria 5754
422 Ga0495646_0000930 3300046680 Bacteria 16647
423 Ga0495646_0048524 3300046680 Bacteria 2578
424 Ga0495646_0049116 3300046680 Bacteria 2561
425 Ga0495613_0005769 3300046689 Bacteria 9271
426 Ga0495613_0007455 3300046689 Bacteria 8150
427 Ga0495624_0096671 3300046690 Bacteria 1819
428 Ga0495624_0118038 3300046690 Bacteria 1630
429 Ga0495670_0011701 3300046691 Bacteria 4319
430 Ga0495671_0006199 3300046692 Bacteria 6938
431 Ga0495671_0050161 3300046692 Bacteria 2079
432 Ga0495589_0002220 3300046794 Bacteria 10919
433 Ga0495589_0027497 3300046794 Bacteria 2876
434 Ga0495600_0007269 3300046809 Bacteria 6765
435 Ga0495600_0014454 3300046809 Bacteria 4975
436 Ga0495600_0047004 3300046809 Bacteria 2815
437 Ga0495600_0055150 3300046809 Bacteria 2596
438 Ga0495600_0128913 3300046809 Bacteria 1644
439 Ga0495660_0097577 3300046810 Bacteria 1517
440 Ga0495604_0000558 3300047317 Bacteria 32740
441 Ga0495604_0005891 3300047317 Bacteria 9720
442 Ga0495636_0001479 3300047318 Bacteria 8896
443 Ga0495674_0035955 3300047319 Bacteria 4463
444 Ga0495676_0000917 3300047321 Bacteria 24687
445 Ga0495676_0001734 3300047321 Bacteria 19047
446 Ga0495680_0002951 3300047322 Bacteria 17021
447 Ga0495687_003729 3300047443 Bacteria 10805
448 Ga0495687_005416 3300047443 Bacteria 8144
449 Ga0495687_009628 3300047443 Bacteria 5381
450 Ga0495687_026079 3300047443 Bacteria 2755
451 Ga0495687_029829 3300047443 Bacteria 2518
452 Ga0495675_0011602 3300047444 Bacteria 5532
453 Ga0495675_0260635 3300047444 Bacteria 1038
454 Ga0495679_043280 3300047446 Bacteria 1385
455 Ga0495685_001706 3300047447 Bacteria 6769
456 Ga0495685_033083 3300047447 Bacteria 1776
457 Ga0495685_041620 3300047447 Bacteria 1569
458 Ga0495681_0002132 3300047470 Bacteria 14352
459 Ga0495681_0009151 3300047470 Bacteria 6128
460 Ga0495681_0046037 3300047470 Bacteria 2083
461 Ga0495684_0031211 3300047471 Bacteria 4090
462 Ga0495593_0009986 3300047673 Bacteria 5501
463 Ga0495602_0034326 3300048088 Bacteria 4747
464 Ga0495602_0106623 3300048088 Bacteria 2286
465 Ga0495602_0193513 3300048088 Bacteria 1557
466 Ga0495614_0000340 3300048089 Bacteria 18522
467 Ga0495614_0001852 3300048089 Bacteria 9262
468 Ga0495614_0003404 3300048089 Bacteria 7116
469 Ga0495614_0025542 3300048089 Bacteria 2547
470 Ga0495614_0038708 3300048089 Bacteria 2046
471 Ga0496102_0005294 3300048905 Bacteria 10954
472 Ga0496102_0122760 3300048905 Bacteria 2427
473 Ga0496103_0195865 3300048906 Bacteria 1299
474 Ga0496106_0019059 3300048909 Bacteria 5085
475 Ga0496106_0089586 3300048909 Bacteria 2373
476 Ga0496107_0010597 3300048910 Bacteria 6409
477 Ga0496108_0047928 3300048911 Bacteria 3572
478 Ga0496108_0156788 3300048911 Bacteria 1966
479 Ga0496109_0053497 3300048912 Bacteria 3682
480 Ga0496109_0406833 3300048912 Bacteria 1286
481 Ga0496110_0366961 3300048913 Bacteria 1312
482 Ga0496111_0126361 3300048914 Bacteria 1890
483 Ga0496114_0036131 3300048917 Bacteria 4084
484 Ga0496114_0200685 3300048917 Bacteria 1747
485 Ga0496117_0007274 3300048920 Bacteria 10878
486 Ga0496126_0037356 3300048929 Bacteria 4533
487 Ga0496126_0345201 3300048929 Bacteria 1219
488 Ga0501291_001880 3300049514 Bacteria 2464
489 Ga0501299_011460 3300049522 Bacteria 1498
490 Ga0501318_000322 3300049534 Bacteria 2833
491 Ga0501325_000179 3300049541 Bacteria 2478
492 Ga0501033_0000299 3300049570 Bacteria 47420
493 Ga0501067_0033375 3300049583 Bacteria 2856
494 Ga0501070_0111060 3300049586 Bacteria 2266
495 Ga0501256_001683 3300049685 Bacteria 1672
496 Ga0501225_0022526 3300049705 Bacteria 1739
497 nmdc:mga03n38_2870_c1 3300050490 Bacteria 5426
498 nmdc:mga03n38_43916_c1 3300050490 Bacteria 1960
499 nmdc:mga00v17_161794_c1 3300050491 Bacteria 1441
500 nmdc:mga0yw44_249856_c1 3300050492 Bacteria 1180
501 nmdc:mga06z11_846_c1 3300050494 Bacteria 11204
502 nmdc:mga04h51_46185_c1 3300050495 Bacteria 1443
503 nmdc:mga05p37_4112_c1 3300050507 Bacteria 17014
504 nmdc:mga06r32_53235_c1 3300050510 Bacteria 3877
505 nmdc:mga08y16_65979_c1 3300050511 Bacteria 3778
506 nmdc:mga0n895_18435_c1 3300050512 Bacteria 6460
507 nmdc:mga0rr50_100495_c1 3300050513 Bacteria 2272
508 nmdc:mga0a205_27989_c1 3300050515 Bacteria 5385
509 Ga0495612_0011653 3300053078 Bacteria 3543
510 Ga0495655_0029791 3300053083 Bacteria 1315
511 Ga0495619_0096842 3300053085 Bacteria 2004
512 Ga0495619_0167278 3300053085 Bacteria 1520
513 Ga0500578_0009922 3300053086 Bacteria 6181
514 Ga0500640_055721 3300053095 Bacteria 1721
515 Ga0500553_045091 3300053101 Bacteria 2141
516 Ga0500560_000339 3300053107 Bacteria 6099
517 Ga0500560_019725 3300053107 Bacteria 1902
518 Ga0500560_050519 3300053107 Bacteria 1333
519 Ga0500652_002983 3300053131 Bacteria 5105
520 Ga0500561_0001554 3300053137 Bacteria 3736
521 Ga0500568_0005345 3300053139 Bacteria 6654
522 Ga0500600_0002715 3300053149 Bacteria 10032
523 Ga0500600_0019895 3300053149 Bacteria 4040
524 Ga0500600_0092251 3300053149 Bacteria 1614
525 Ga0500616_0000951 3300053153 Bacteria 31533
526 Ga0500616_0004306 3300053153 Bacteria 10208
527 Ga0500616_0048304 3300053153 Bacteria 2256
528 Ga0500633_0024157 3300053160 Bacteria 1884
529 Ga0500634_0064521 3300053161 Bacteria 1934
530 Ga0500656_000416 3300053732 Bacteria 3098
531 Ga0500587_000745 3300053739 Bacteria 4193
532 Ga0587080_004467 3300059503 Bacteria 1820
533 Ga0587106_003045 3300059605 Bacteria 1714
534 Ga0587079_005274 3300059647 Bacteria 1816
535 Ga0466962_0005022 3300061719 Bacteria 6363
536 2559422795 2558860280 Bacteria 11429938
537 2585309622 2582581313 Bacteria 10042643
538 2585311969 2582581314 Bacteria 11452267
539 2616698469 2616644814 Bacteria 11555299
540 2644270608 2643221647 Bacteria 10741251
541 2644440357 2643221678 Bacteria 9540101
542 2644506128 2643221690 Bacteria 4654705
543 2644631969 2643221714 Bacteria 9015452
544 2723640802 2721755702 Bacteria 4373124
545 2738693977 2738541272 Bacteria 6848551
546 2739327440 2738543027 Bacteria 6409078
547 2739607219 2739367654 Bacteria 6049412
548 2760621294 2758568621 Bacteria 5967089
549 2785346099 2784746763 Bacteria 9783172
550 2785371599 2784746768 Bacteria 10036182
551 2808845877 2808606359 Bacteria 9866990
552 2809026088 2808606394 Bacteria 6248540
553 2812321933 2811994872 Bacteria 4121241
554 2862391781 2862382967 Bacteria 10317375
555 2862994981 2862993130 Bacteria 3860849
556 2867434034 2867428634 Bacteria 9590268
557 2877679014 2877676314 Bacteria 9512378
558 2887447058 2887443736 Bacteria 4426037
559 2895428877 2895427314 Bacteria 13147766
560 2906802216 2906799679 Bacteria 4031749
561 2919443975 2919443155 Bacteria 4072969
562 2946072305 2946064051 Bacteria 8957905
563 2946079859 2946072368 Bacteria 8999607
564 2954390111 2954380949 Bacteria 10050426
565 2954692518 2954691527 Bacteria 10720516
566 2954707587 2954701450 Bacteria 10834262
567 2954729915 2954721474 Bacteria 10456478
568 2954750832 2954749733 Bacteria 10366972
569 2966926728 2966924647 Bacteria 3268643
570 8008564921 8008558824 Bacteria 10610750
571 8056579799 8056579771 Bacteria 5840325
572 Ga0495592_0001835
573 JGI24737J22298_10006796
574 JGI25406J46586_10003627
575 rootH1_10031132
576 rootH1_10103549
577 Ga0006562J51391_1204938
578 Ga0006562J51391_1204939
579 Ga0065714_10070907
580 Ga0070658_10106684
581 Ga0070683_100109440
582 Ga0070670_100028121
583 Ga0068869_100124994
584 Ga0070680_100050710
585 Ga0070682_100028977
586 Ga0070682_100145968
587 Ga0070682_100311586
588 Ga0068868_100053061
589 Ga0070660_100099047
590 Ga0070687_100018282
591 Ga0070687_100159805
592 Ga0070692_10033879
593 Ga0070668_100070954
594 Ga0070668_100182447
595 Ga0070671_100063234
596 Ga0070659_100067789
597 Ga0070659_100287466
598 Ga0070667_100058987
599 Ga0070709_10155932
600 Ga0070700_100036231
601 Ga0070663_100056607
602 Ga0070663_100107741
603 Ga0070678_100092915
604 Ga0070678_100235886
605 Ga0070662_100315557
606 Ga0070681_10096650
607 Ga0070685_10067259
608 Ga0070684_100239325
609 Ga0068853_100033935
610 Ga0068853_100046139
611 Ga0070672_100080751
612 Ga0070672_100084492
613 Ga0070672_100138924
614 Ga0070696_100411309
615 Ga0070704_100294181
616 Ga0068855_100139152
617 Ga0070664_100038279
618 Ga0068857_100000743
619 Ga0068857_100044791
620 Ga0068857_100125071
621 Ga0068857_100392143
622 Ga0068856_100010052
623 Ga0068856_100102126
624 Ga0068856_100135086
625 Ga0070702_100029129
626 Ga0068852_100171711
627 Ga0068852_100294924
628 Ga0068859_100317198
629 Ga0068866_10209600
630 Ga0068866_10336469
631 Ga0068861_100036096
632 Ga0068861_100127401
633 Ga0068870_10258578
634 Ga0068863_100073776
635 Ga0068863_100171159
636 Ga0068863_100325527
637 Ga0068858_100622911
638 Ga0068860_100000631
639 Ga0068862_100016342
640 Ga0081455_10001434
641 Ga0081455_10007435
642 Ga0081455_10025713
643 Ga0081455_10030248
644 Ga0081455_10046344
645 Ga0081455_10080138
646 Ga0081455_10155281
647 Ga0081538_10000614
648 Ga0081539_10001475
649 Ga0081539_10001493
650 Ga0081539_10003600
651 Ga0081539_10004640
652 Ga0081539_10007488
653 Ga0081539_10087643
654 Ga0075365_10029282
655 Ga0075368_10002036
656 Ga0075363_100003846
657 Ga0075364_10191992
658 Ga0075367_10000946
659 Ga0075370_10035418
660 Ga0075428_100002003
661 Ga0075428_100086512
662 Ga0075431_100043445
663 Ga0075433_10017043
664 Ga0075433_10432042
665 Ga0075434_100013147
666 Ga0097620_100317198
667 Ga0075435_100001174
668 Ga0105244_10070256
669 Ga0105240_10020819
670 Ga0111539_10038057
671 Ga0105245_10049567
672 Ga0105245_10051561
673 Ga0105245_10065478
674 Ga0105245_10163929
675 Ga0105245_10192491
676 Ga0105245_10364740
677 Ga0105247_10071552
678 Ga0105247_10314150
679 Ga0105247_10347946
680 Ga0114129_10021340
681 Ga0105243_10077613
682 Ga0105243_10121307
683 Ga0105243_10534736
684 Ga0105241_10001415
685 Ga0105242_10252601
686 Ga0105248_10000365
687 Ga0105248_10217498
688 Ga0105248_10445893
689 Ga0105237_10012322
690 Ga0105237_10256147
691 Ga0105249_10032836
692 Ga0105249_10052646
693 Ga0105249_10077534
694 Ga0105249_10643501
695 Ga0105239_10015562
696 Ga0105246_10021889
697 Ga0157369_10658897
698 Ga0157374_10015647
699 Ga0157378_10153840
700 Ga0163162_10205306
701 Ga0163162_10337882
702 Ga0163162_10409472
703 Ga0157372_10137446
704 Ga0157372_10558968
705 Ga0157372_10750481
706 Ga0157375_10657220
707 Ga0163163_10044574
708 Ga0163163_10061534
709 Ga0163163_10139544
710 Ga0163163_10799123
711 Ga0157380_10308003
712 Ga0157377_10015031
713 Ga0183367_1004
714 Ga0163161_10199442
715 Ga0209148_1001485
716 Ga0207655_1097702
717 Ga0207710_10162102
718 Ga0207647_10027659
719 Ga0207643_10019126
720 Ga0207705_10033743
721 Ga0207654_10000001
722 Ga0207695_10016594
723 Ga0207671_10006645
724 Ga0207662_10044892
725 Ga0207657_10185413
726 Ga0207694_10188056
727 Ga0207687_10064430
728 Ga0207687_10083896
729 Ga0207687_10094070
730 Ga0207687_10095137
731 Ga0207687_10430371
732 Ga0207690_10161722
733 Ga0207709_10161097
734 Ga0207709_10327543
735 Ga0207704_10379752
736 Ga0207691_10038952
737 Ga0207691_10081974
738 Ga0207691_10099722
739 Ga0207711_10000340
740 Ga0207661_10081068
741 Ga0207661_10158479
742 Ga0207679_10052195
743 Ga0207667_10045638
744 Ga0207668_10031962
745 Ga0207677_10114805
746 Ga0207677_10220613
747 Ga0207703_10095478
748 Ga0207639_10011075
749 Ga0207678_10014353
750 Ga0207678_10186062
751 Ga0207678_10323915
752 Ga0207708_10041613
753 Ga0207708_10228738
754 Ga0207702_10008774
755 Ga0207702_10010881
756 Ga0207641_10186102
757 Ga0207674_10001982
758 Ga0207674_10019601
759 Ga0207674_10044777
760 Ga0207674_10595220
761 Ga0207675_100012668
762 Ga0207675_100021272
763 Ga0207675_100584136
764 Ga0207683_10135082
765 Ga0209813_10035569
766 Ga0207428_10009325
767 Ga0268265_10411740
768 Ga0268264_10001893
769 Ga0307517_10002208
770 Ga0307517_10017578
771 Ga0307515_10000025
772 Ga0307515_10001892
773 Ga0307515_10054085
774 Ga0307515_10200302
775 Ga0307511_10015772
776 Ga0307512_10025790
777 Ga0307512_10033438
778 Ga0316177_1029591
779 Ga0314311_1057787
780 Ga0316179_1080272
781 Ga0307513_10370288
782 Ga0307509_10020406
783 Ga0307509_10045377
784 Ga0307509_10055056
785 Ga0307408_100002739
786 Ga0307408_100008774
787 Ga0307408_100081741
788 Ga0307408_100135967
789 Ga0307408_100324096
790 Ga0307508_10004924
791 Ga0307508_10015871
792 Ga0307508_10051617
793 Ga0307508_10140454
794 Ga0307514_10007902
795 Ga0307516_10001224
796 Ga0307516_10021937
797 Ga0307516_10052870
798 Ga0307516_10081822
799 Ga0307516_10084159
800 Ga0307516_10152513
801 Ga0307405_10017630
802 Ga0307405_10020275
803 Ga0307413_10011684
804 Ga0307413_10019189
805 Ga0307413_10020770
806 Ga0307413_10024372
807 Ga0307518_10040551
808 Ga0307518_10188841
809 Ga0307518_10261598
810 Ga0307410_10001657
811 Ga0307410_10023548
812 Ga0307410_10034272
813 Ga0307410_10141712
814 Ga0326468_10001800
815 Ga0307406_10000550
816 Ga0307406_10007372
817 Ga0307406_10069837
818 Ga0307406_10276687
819 Ga0307407_10020519
820 Ga0307407_10031573
821 Ga0307407_10033160
822 Ga0307407_10104349
823 Ga0307407_10119872
824 Ga0307407_10146496
825 Ga0307412_10005767
826 Ga0307412_10009668
827 Ga0307412_10018775
828 Ga0307412_10199413
829 Ga0307409_100000736
830 Ga0307409_100006708
831 Ga0307409_100006955
832 Ga0307409_100063813
833 Ga0307409_100103358
834 Ga0307409_100312917
835 Ga0307416_100000340
836 Ga0307416_100007100
837 Ga0307416_100012511
838 Ga0307416_100013068
839 Ga0307416_100056028
840 Ga0307416_100100584
841 Ga0307416_100180907
842 Ga0307416_100246513
843 Ga0307414_10009363
844 Ga0307414_10110119
845 Ga0307414_10115216
846 Ga0307414_10192439
847 Ga0307411_10006502
848 Ga0307411_10011082
849 Ga0307411_10107233
850 Ga0307411_10139977
851 Ga0307415_100000176
852 Ga0307415_100004324
853 Ga0307415_100009600
854 Ga0307415_100022220
855 Ga0307415_100032899
856 Ga0307415_100106001
857 Ga0307415_100217714
858 Ga0307507_10015152
859 Ga0307507_10029493
860 Ga0307507_10045192
861 Ga0307507_10116480
862 Ga0307510_10142835
863 Ga0373940_0004275
864 Ga0373951_0000049
865 Ga0373941_0027973
866 Ga0373942_0002128
867 Ga0373962_0001042
868 Ga0395900_0023096
869 Ga0395898_0013350
870 Ga0395905_0067103
871 Ga0395901_0032950
872 Ga0395901_0326889
873 Ga0439439_0013146
874 Ga0451789_0002229
875 Ga0451791_0044804
876 Ga0451791_0279174
877 Ga0451791_1725454
878 Ga0451793_0786197
879 Ga0451807_0078752
880 Ga0451807_0441246
881 Ga0451807_1909701
882 Ga0451833_0465043
883 Ga0451837_0464582
884 Ga0451839_0404140
885 Ga0451841_1196870
886 Ga0451843_0451920
887 Ga0451853_1365077
888 Ga0439431_0036474
889 Ga0439449_0003718
890 Ga0439463_005832
891 Ga0439458_0028095
892 Ga0466969_0020497
893 Ga0466965_0000536
894 Ga0466966_0005223
895 Ga0466966_0083098
896 Ga0466961_0004724
897 Ga0466963_0000867
898 Ga0466964_0070413
899 Ga0466971_0000558
900 Ga0466970_0000414
901 Ga0466957_0002513
902 Ga0466960_0105713
903 Ga0466960_0140901
904 Ga0466959_0015694
905 Ga0466958_0027958
906 Ga0466967_0004720
907 Ga0466967_0026116
908 Ga0466967_0102643
909 Ga0495617_046239
910 Ga0495627_030641
911 Ga0495592_0003204
912 Ga0495592_0025591
913 Ga0495592_0176915
914 Ga0495603_0000911
915 Ga0495590_0000142
916 Ga0495629_0009114
917 Ga0495629_0044899
918 Ga0495629_0053946
919 Ga0495629_0054834
920 Ga0495629_0056633
921 Ga0495638_0024173
922 Ga0495638_0032867
923 Ga0495651_0013615
924 Ga0495651_0115582
925 Ga0495653_0002029
926 Ga0495653_0159540
927 Ga0495580_0033730
928 Ga0495605_0001464
929 Ga0495662_0001362
930 Ga0495662_0002684
931 Ga0495662_0123731
932 Ga0495664_0001605
933 Ga0495664_0029546
934 Ga0495585_0024697
935 Ga0495585_0073162
936 Ga0495594_0022491
937 Ga0495594_0035256
938 Ga0495594_0095915
939 Ga0495596_0037125
940 Ga0495607_0037388
941 Ga0495583_0005674
942 Ga0495606_0009352
943 Ga0495608_0017280
944 Ga0495608_0041724
945 Ga0495616_0022931
946 Ga0495620_0011710
947 Ga0495620_0011920
948 Ga0495628_0004079
949 Ga0495628_0008151
950 Ga0495628_0025140
951 Ga0495630_0031378
952 Ga0495630_0060988
953 Ga0495631_0002744
954 Ga0495643_0002615
955 Ga0495643_0012039
956 Ga0495643_0142248
957 Ga0495643_0160668
958 Ga0495648_0007727
959 Ga0495666_0002838
960 Ga0495666_0029465
961 Ga0495652_0003709
962 Ga0495652_0016428
963 Ga0495652_0210209
964 Ga0495652_0311507
965 Ga0495640_0008123
966 Ga0495640_0048147
967 Ga0495640_0136316
968 Ga0495587_0032614
969 Ga0495609_0037345
970 Ga0495597_0013995
971 Ga0495667_0034622
972 Ga0495668_0056109
973 Ga0495668_0103471
974 Ga0495634_0000745
975 Ga0495634_0011240
976 Ga0495634_0169199
977 Ga0495625_0003926
978 Ga0495625_0046547
979 Ga0495635_0007408
980 Ga0495635_0012263
981 Ga0495635_0018381
982 Ga0495635_0050288
983 Ga0495659_0134967
984 Ga0495661_0015815
985 Ga0495588_0006810
986 Ga0495657_0003773
987 Ga0495657_0032694
988 Ga0495657_0039572
989 Ga0495657_0050745
990 Ga0495623_0008482
991 Ga0495623_0010093
992 Ga0495623_0011396
993 Ga0495646_0000930
994 Ga0495646_0048524
995 Ga0495646_0049116
996 Ga0495613_0005769
997 Ga0495613_0007455
998 Ga0495624_0096671
999 Ga0495624_0118038
1000 Ga0495670_0011701
1001 Ga0495671_0006199
1002 Ga0495671_0050161
1003 Ga0495589_0002220
1004 Ga0495589_0027497
1005 Ga0495600_0007269
1006 Ga0495600_0014454
1007 Ga0495600_0047004
1008 Ga0495600_0055150
1009 Ga0495600_0128913
1010 Ga0495660_0097577
1011 Ga0495604_0000558
1012 Ga0495604_0005891
1013 Ga0495636_0001479
1014 Ga0495674_0035955
1015 Ga0495676_0000917
1016 Ga0495676_0001734
1017 Ga0495680_0002951
1018 Ga0495687_003729
1019 Ga0495687_005416
1020 Ga0495687_009628
1021 Ga0495687_026079
1022 Ga0495687_029829
1023 Ga0495675_0011602
1024 Ga0495675_0260635
1025 Ga0495679_043280
1026 Ga0495685_001706
1027 Ga0495685_033083
1028 Ga0495685_041620
1029 Ga0495681_0002132
1030 Ga0495681_0009151
1031 Ga0495681_0046037
1032 Ga0495684_0031211
1033 Ga0495593_0009986
1034 Ga0495602_0034326
1035 Ga0495602_0106623
1036 Ga0495602_0193513
1037 Ga0495614_0000340
1038 Ga0495614_0001852
1039 Ga0495614_0003404
1040 Ga0495614_0025542
1041 Ga0495614_0038708
1042 Ga0496102_0005294
1043 Ga0496102_0122760
1044 Ga0496103_0195865
1045 Ga0496106_0019059
1046 Ga0496106_0089586
1047 Ga0496107_0010597
1048 Ga0496108_0047928
1049 Ga0496108_0156788
1050 Ga0496109_0053497
1051 Ga0496109_0406833
1052 Ga0496110_0366961
1053 Ga0496111_0126361
1054 Ga0496114_0036131
1055 Ga0496114_0200685
1056 Ga0496117_0007274
1057 Ga0496126_0037356
1058 Ga0496126_0345201
1059 Ga0501291_001880
1060 Ga0501299_011460
1061 Ga0501318_000322
1062 Ga0501325_000179
1063 Ga0501033_0000299
1064 Ga0501067_0033375
1065 Ga0501070_0111060
1066 Ga0501256_001683
1067 Ga0501225_0022526
1068 nmdc:mga03n38_2870_c1
1069 nmdc:mga03n38_43916_c1
1070 nmdc:mga00v17_161794_c1
1071 nmdc:mga0yw44_249856_c1
1072 nmdc:mga06z11_846_c1
1073 nmdc:mga04h51_46185_c1
1074 nmdc:mga05p37_4112_c1
1075 nmdc:mga06r32_53235_c1
1076 nmdc:mga08y16_65979_c1
1077 nmdc:mga0n895_18435_c1
1078 nmdc:mga0rr50_100495_c1
1079 nmdc:mga0a205_27989_c1
1080 Ga0495612_0011653
1081 Ga0495655_0029791
1082 Ga0495619_0096842
1083 Ga0495619_0167278
1084 Ga0500578_0009922
1085 Ga0500640_055721
1086 Ga0500553_045091
1087 Ga0500560_000339
1088 Ga0500560_019725
1089 Ga0500560_050519
1090 Ga0500652_002983
1091 Ga0500561_0001554
1092 Ga0500568_0005345
1093 Ga0500600_0002715
1094 Ga0500600_0019895
1095 Ga0500600_0092251
1096 Ga0500616_0000951
1097 Ga0500616_0004306
1098 Ga0500616_0048304
1099 Ga0500633_0024157
1100 Ga0500634_0064521
1101 Ga0500656_000416
1102 Ga0500587_000745
1103 Ga0587080_004467
1104 Ga0587106_003045
1105 Ga0587079_005274
1106 Ga0466962_0005022
1107 2559422795
1108 2585309622
1109 2585311969
1110 2616698469
1111 2644270608
1112 2644440357
1113 2644506128
1114 2644631969
1115 2723640802
1116 2738693977
1117 2739327440
1118 2739607219
1119 2760621294
1120 2785346099
1121 2785371599
1122 2808845877
1123 2809026088
1124 2812321933
1125 2862391781
1126 2862994981
1127 2867434034
1128 2877679014
1129 2887447058
1130 2895428877
1131 2906802216
1132 2919443975
1133 2946072305
1134 2946079859
1135 2954390111
1136 2954692518
1137 2954707587
1138 2954729915
1139 2954750832
1140 2966926728
1141 8008564921
1142 8056579799

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

123

317

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8426 26 300
4tqu-assembly1.cif.gz_N crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8181 26 300
4jbw-assembly2.cif.gz_I crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7963 26 298
7cad-assembly1.cif.gz_B mycobacterium smegmatis sugabc complex 0.7921 29 310
8hpn-assembly1.cif.gz_B lpqy-sugabc in state 3 0.7895 29 297
ID Description Score Start End Superfamily
af_O53483_6_271_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9235 34 297 1.10.3720.10
af_I6Y1U3_2_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8975 31 297 1.10.3720.10
af_P9WG01_5_265_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8858 31 297 1.10.3720.10
af_P77716_1_267_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8793 34 294 1.10.3720.10
af_Q2G1E7_1_266_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8792 34 296 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A0Q4H5A4-F1-model_v4 Sugar ABC transporter permease 0.951 38 309 GO:0005886
GO:0055085
AF-A0A2T1FG71-F1-model_v4 Sugar ABC transporter permease 0.95 80 298 GO:0005886
GO:0055085
AF-A0A838UVG6-F1-model_v4 Carbohydrate ABC transporter permease 0.9475 45 310 GO:0005886
GO:0055085
AF-A0A561ST64-F1-model_v4 Carbohydrate ABC transporter membrane protein 2 (CUT1 family) 0.9464 34 309 GO:0005886
GO:0055085
AF-A0A2W1X252-F1-model_v4 deleted 0.9393 34 302

Map