F464984

General Info

Members Datasets Scaffolds Average Seq Length
571 215 1142 187

Family's Representative Sequence

Representative Sequence 3300045976|Ga0466967_0133714|Ga0466967_0133714_1434_2171
Length 222
Sequence MRRNEACALMVEAAKEDAMADQRNSDLPEGTDTVIEPANVGAIATDPTAPDQGGQTITIDDTALVAERKIAAPSGDAERPVSGTGNPATGLTDTGIADRIRSGREQIASQAGDKARGLVSQGLERTSEALANVARMVGDTASGIDERLGEDYGDYARRAAGAIENVANTIAEKDPDELIDDTRNFVRNSPGVALAGAAVVGFVLSRLIKSGLASNRDEDDDA

Samples

Sample ID Description Type Environment
1 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
146 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
157 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
158 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
161 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
162 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
163 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
164 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
165 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
168 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
169 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
170 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
171 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
172 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
173 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
178 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
179 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
180 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
181 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
182 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
183 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
184 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
185 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
186 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
189 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
190 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
191 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
192 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
193 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
194 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
195 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
209 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
210 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
211 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
212 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
213 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
214 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.25
Metatranscriptomes 1.75
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.03
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 5.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466967_0133714 3300045976 Bacteria 2305
2 JGI24752J21851_1018455 3300001976 Bacteria 910
3 JGI24740J21852_10031858 3300001979 Bacteria 1693
4 JGI24739J22299_10031112 3300001989 Bacteria 1846
5 JGI24739J22299_10042498 3300001989 Bacteria 1507
6 JGI24737J22298_10000640 3300001990 Bacteria 12332
7 JGI24737J22298_10004080 3300001990 Bacteria 5102
8 JGI24735J21928_10015924 3300002067 Bacteria 2341
9 JGI24735J21928_10027835 3300002067 Bacteria 1692
10 JGI24735J21928_10097395 3300002067 Bacteria 844
11 JGI24738J21930_10000976 3300002075 Bacteria 8189
12 JGI24744J21845_10000093 3300002077 Bacteria 11838
13 JGI24742J22300_10030502 3300002244 Bacteria 941
14 Ga0070658_10000590 3300005327 Bacteria 31506
15 Ga0070658_10083991 3300005327 Bacteria 2618
16 Ga0070658_10255723 3300005327 Bacteria 1486
17 Ga0070676_10018137 3300005328 Bacteria 3897
18 Ga0070676_10033595 3300005328 Bacteria 2943
19 Ga0070683_100032804 3300005329 Bacteria 4733
20 Ga0070683_100078608 3300005329 Bacteria 3086
21 Ga0070690_100102418 3300005330 Bacteria 1900
22 Ga0070670_100004598 3300005331 Bacteria 11579
23 Ga0070670_100024374 3300005331 Bacteria 5203
24 Ga0070670_100059654 3300005331 Bacteria 3275
25 Ga0070670_100110654 3300005331 Bacteria 2366
26 Ga0070670_100131296 3300005331 Bacteria 2163
27 Ga0070677_10022527 3300005333 Bacteria 2321
28 Ga0070677_10027729 3300005333 Bacteria 2135
29 Ga0068869_100485260 3300005334 Bacteria 1029
30 Ga0070666_10003731 3300005335 Bacteria 9230
31 Ga0070666_10005609 3300005335 Bacteria 7701
32 Ga0070666_10036604 3300005335 Bacteria 3259
33 Ga0070680_100003865 3300005336 Bacteria 11196
34 Ga0070680_100028300 3300005336 Bacteria 4494
35 Ga0070680_100061175 3300005336 Bacteria 3082
36 Ga0070680_100066112 3300005336 Bacteria 2964
37 Ga0070680_100306844 3300005336 Bacteria 1346
38 Ga0070682_100037532 3300005337 Bacteria 2967
39 Ga0070660_100000033 3300005339 Bacteria 83079
40 Ga0070660_100009941 3300005339 Bacteria 6710
41 Ga0070660_100011523 3300005339 Bacteria 6289
42 Ga0070660_100040475 3300005339 Bacteria 3547
43 Ga0070660_100070801 3300005339 Bacteria 2722
44 Ga0070660_100141712 3300005339 Bacteria 1929
45 Ga0070660_100146667 3300005339 Bacteria 1896
46 Ga0070660_100552610 3300005339 Bacteria 961
47 Ga0070691_10265906 3300005341 Bacteria 925
48 Ga0070661_100000547 3300005344 Bacteria 28803
49 Ga0070661_100024506 3300005344 Bacteria 4328
50 Ga0070661_100069821 3300005344 Bacteria 2583
51 Ga0070661_100099443 3300005344 Bacteria 2161
52 Ga0070661_100148385 3300005344 Bacteria 1772
53 Ga0070661_100331366 3300005344 Bacteria 1191
54 Ga0070692_10003701 3300005345 Bacteria 6269
55 Ga0070692_10020328 3300005345 Bacteria 3219
56 Ga0070692_10190669 3300005345 Bacteria 1194
57 Ga0070668_100257244 3300005347 Bacteria 1451
58 Ga0070668_100292660 3300005347 Bacteria 1363
59 Ga0070669_100540492 3300005353 Bacteria 970
60 Ga0070675_100498954 3300005354 Bacteria 1097
61 Ga0070671_100099582 3300005355 Bacteria 2438
62 Ga0070671_100240098 3300005355 Archaea 1538
63 Ga0070671_100771943 3300005355 Bacteria 836
64 Ga0070674_100011974 3300005356 Bacteria 5308
65 Ga0070674_100058633 3300005356 Bacteria 2677
66 Ga0070674_100263900 3300005356 Unclassified 1358
67 Ga0070674_100390007 3300005356 Bacteria 1135
68 Ga0070673_100016115 3300005364 Bacteria 5274
69 Ga0070659_100000433 3300005366 Bacteria 31495
70 Ga0070659_100115045 3300005366 Bacteria 2174
71 Ga0070659_100135435 3300005366 Bacteria 2003
72 Ga0070659_101612000 3300005366 Bacteria 579
73 Ga0070667_100005129 3300005367 Bacteria 10965
74 Ga0070667_100016916 3300005367 Bacteria 6035
75 Ga0070667_100017782 3300005367 Bacteria 5893
76 Ga0070667_100019495 3300005367 Bacteria 5628
77 Ga0070667_100241608 3300005367 Bacteria 1613
78 Ga0070667_100568868 3300005367 Bacteria 1043
79 Ga0070714_100093979 3300005435 Bacteria 2631
80 Ga0070714_100106786 3300005435 Bacteria 2474
81 Ga0070714_100315435 3300005435 Bacteria 1461
82 Ga0070694_100025724 3300005444 Bacteria 3809
83 Ga0070663_100004999 3300005455 Bacteria 7832
84 Ga0070663_100012882 3300005455 Bacteria 5308
85 Ga0070663_100015833 3300005455 Bacteria 4879
86 Ga0070663_100070596 3300005455 Bacteria 2540
87 Ga0070678_100001396 3300005456 Bacteria 12865
88 Ga0070678_100013753 3300005456 Bacteria 5087
89 Ga0070678_100268551 3300005456 Bacteria 1438
90 Ga0070662_100000522 3300005457 Bacteria 23134
91 Ga0070662_100003549 3300005457 Bacteria 9727
92 Ga0070662_100039372 3300005457 Bacteria 3361
93 Ga0070662_100101050 3300005457 Bacteria 2183
94 Ga0070662_100329794 3300005457 Bacteria 1246
95 Ga0070681_10028840 3300005458 Bacteria 5577
96 Ga0070681_10068580 3300005458 Bacteria 3513
97 Ga0070679_100026078 3300005530 Bacteria 5737
98 Ga0070679_100045186 3300005530 Bacteria 4389
99 Ga0070679_100339249 3300005530 Bacteria 1451
100 Ga0070679_100373941 3300005530 Bacteria 1372
101 Ga0070684_100372562 3300005535 Bacteria 1315
102 Ga0068853_100006622 3300005539 Bacteria 9224
103 Ga0068853_100024702 3300005539 Bacteria 5040
104 Ga0068853_100070155 3300005539 Bacteria 3050
105 Ga0068853_100075035 3300005539 Bacteria 2951
106 Ga0068853_100233048 3300005539 Bacteria 1685
107 Ga0068853_100536654 3300005539 Bacteria 1107
108 Ga0068853_101186028 3300005539 Unclassified 737
109 Ga0070672_100222709 3300005543 Bacteria 1583
110 Ga0070672_100234712 3300005543 Bacteria 1542
111 Ga0070695_100010625 3300005545 Bacteria 5503
112 Ga0070696_100009154 3300005546 Bacteria 6629
113 Ga0070696_100232309 3300005546 Bacteria 1388
114 Ga0070696_100409765 3300005546 Bacteria 1062
115 Ga0070696_100438045 3300005546 Bacteria 1029
116 Ga0070693_100002317 3300005547 Bacteria 8737
117 Ga0070693_100026610 3300005547 Bacteria 3125
118 Ga0070693_100065759 3300005547 Bacteria 2120
119 Ga0070665_100009480 3300005548 Bacteria 9852
120 Ga0070665_100017292 3300005548 Bacteria 7237
121 Ga0070665_100895261 3300005548 Bacteria 900
122 Ga0068855_100013548 3300005563 Bacteria 9834
123 Ga0068855_100035598 3300005563 Bacteria 5930
124 Ga0068855_100071761 3300005563 Bacteria 4025
125 Ga0068855_100081713 3300005563 Bacteria 3745
126 Ga0068855_100123750 3300005563 Bacteria 2958
127 Ga0070664_100000822 3300005564 Bacteria 23916
128 Ga0070664_100038334 3300005564 Bacteria 4033
129 Ga0070664_100073306 3300005564 Bacteria 2937
130 Ga0070664_100121721 3300005564 Bacteria 2285
131 Ga0070664_100177533 3300005564 Bacteria 1892
132 Ga0070664_100179436 3300005564 Bacteria 1881
133 Ga0070664_100186826 3300005564 Bacteria 1845
134 Ga0068857_100006795 3300005577 Bacteria 9849
135 Ga0068857_100239144 3300005577 Bacteria 1662
136 Ga0068854_100168933 3300005578 Bacteria 1700
137 Ga0068854_100282092 3300005578 Bacteria 1338
138 Ga0068854_100394038 3300005578 Bacteria 1144
139 Ga0068854_100907381 3300005578 Bacteria 775
140 Ga0068856_100001471 3300005614 Bacteria 24671
141 Ga0068856_100054489 3300005614 Bacteria 3944
142 Ga0068856_100064770 3300005614 Bacteria 3612
143 Ga0070702_100036380 3300005615 Bacteria 2727
144 Ga0068852_100002526 3300005616 Bacteria 12606
145 Ga0068852_100002763 3300005616 Bacteria 12157
146 Ga0068852_100011623 3300005616 Bacteria 6639
147 Ga0068852_100024573 3300005616 Bacteria 4871
148 Ga0068852_100164666 3300005616 Bacteria 2074
149 Ga0068852_100344975 3300005616 Bacteria 1452
150 Ga0068852_100383894 3300005616 Bacteria 1378
151 Ga0068859_100511502 3300005617 Bacteria 1296
152 Ga0068864_100021810 3300005618 Bacteria 5367
153 Ga0068864_100026583 3300005618 Bacteria 4881
154 Ga0068866_10006055 3300005718 Bacteria 5035
155 Ga0068851_10021238 3300005834 Bacteria 3152
156 Ga0068851_10030876 3300005834 Bacteria 2659
157 Ga0068851_10102809 3300005834 Bacteria 1518
158 Ga0068851_10417229 3300005834 Bacteria 792
159 Ga0068863_100004110 3300005841 Bacteria 14383
160 Ga0068863_100034058 3300005841 Bacteria 4852
161 Ga0068863_101132436 3300005841 Bacteria 788
162 Ga0068858_100008591 3300005842 Bacteria 9808
163 Ga0068858_100556086 3300005842 Bacteria 1111
164 Ga0068858_100568006 3300005842 Bacteria 1099
165 Ga0068860_100048298 3300005843 Bacteria 4056
166 Ga0068860_100388764 3300005843 Bacteria 1378
167 Ga0068862_100123192 3300005844 Bacteria 2287
168 Ga0081539_10015777 3300005985 Bacteria 5461
169 Ga0070712_101124190 3300006175 Bacteria 682
170 Ga0097621_100010323 3300006237 Bacteria 6827
171 Ga0097621_100343012 3300006237 Bacteria 1327
172 Ga0068871_100021332 3300006358 Bacteria 4977
173 Ga0068871_100150289 3300006358 Bacteria 1986
174 Ga0068871_100203371 3300006358 Bacteria 1711
175 Ga0075428_100267279 3300006844 Bacteria 1841
176 Ga0075431_100554626 3300006847 Bacteria 1136
177 Ga0075429_100286963 3300006880 Bacteria 1441
178 Ga0068865_100310925 3300006881 Bacteria 1264
179 Ga0097620_100511536 3300006931 Bacteria 1296
180 Ga0111539_10211783 3300009094 Bacteria 2258
181 Ga0114129_10559401 3300009147 Bacteria 1486
182 Ga0105243_10250387 3300009148 Bacteria 1581
183 Ga0105241_10347185 3300009174 Bacteria 1287
184 Ga0105241_10556124 3300009174 Bacteria 1031
185 Ga0105248_10000182 3300009177 Bacteria 73487
186 Ga0105248_10018014 3300009177 Bacteria 7796
187 Ga0105248_10039198 3300009177 Bacteria 5305
188 Ga0105238_10104825 3300009551 Bacteria 2809
189 Ga0105238_10468263 3300009551 Bacteria 1258
190 Ga0105238_10605344 3300009551 Bacteria 1104
191 Ga0105246_10861824 3300011119 Unclassified 809
192 Ga0157373_10095271 3300013100 Bacteria 2095
193 Ga0157373_10244315 3300013100 Bacteria 1269
194 Ga0157371_10001754 3300013102 Bacteria 21989
195 Ga0157371_10043667 3300013102 Bacteria 3192
196 Ga0157371_10073360 3300013102 Bacteria 2424
197 Ga0157371_10085651 3300013102 Bacteria 2232
198 Ga0157370_10068246 3300013104 Bacteria 3360
199 Ga0157370_10100316 3300013104 Bacteria 2713
200 Ga0157370_11174997 3300013104 Unclassified 692
201 Ga0157369_10025584 3300013105 Bacteria 6549
202 Ga0157369_10222850 3300013105 Bacteria 1973
203 Ga0157369_10386409 3300013105 Bacteria 1452
204 Ga0157369_10718546 3300013105 Bacteria 1028
205 Ga0157369_11016706 3300013105 Bacteria 848
206 Ga0157374_10013976 3300013296 Bacteria 7017
207 Ga0157374_10115685 3300013296 Bacteria 2584
208 Ga0157374_10214919 3300013296 Bacteria 1886
209 Ga0157378_10054144 3300013297 Bacteria 3573
210 Ga0163162_10019626 3300013306 Bacteria 6635
211 Ga0157372_10129918 3300013307 Bacteria 2897
212 Ga0157372_10421238 3300013307 Bacteria 1556
213 Ga0157372_10557610 3300013307 Bacteria 1335
214 Ga0157372_10760289 3300013307 Bacteria 1127
215 Ga0157372_10806371 3300013307 Bacteria 1091
216 Ga0157372_10948803 3300013307 Bacteria 997
217 Ga0157375_10018221 3300013308 Bacteria 6363
218 Ga0157375_10632333 3300013308 Bacteria 1227
219 Ga0157375_11278231 3300013308 Bacteria 862
220 Ga0163163_10000058 3300014325 Bacteria 123478
221 Ga0163163_10002256 3300014325 Bacteria 16246
222 Ga0163163_10022712 3300014325 Bacteria 5944
223 Ga0157377_10074149 3300014745 Bacteria 1974
224 Ga0157379_10036006 3300014968 Bacteria 4413
225 Ga0157379_10113020 3300014968 Bacteria 2441
226 Ga0197907_11388595 3300020069 Bacteria 2123
227 Ga0206356_10816572 3300020070 Bacteria 811
228 Ga0206349_1922197 3300020075 Bacteria 1008
229 Ga0206351_10678103 3300020077 Unclassified 715
230 Ga0206352_10015386 3300020078 Bacteria 1031
231 Ga0206350_10587277 3300020080 Bacteria 1428
232 Ga0206354_10311629 3300020081 Bacteria 752
233 Ga0206354_10313717 3300020081 Bacteria 1653
234 Ga0206353_10822112 3300020082 Bacteria 2007
235 Ga0224712_10129282 3300022467 Bacteria 1102
236 Ga0207656_10003002 3300025321 Bacteria 5770
237 Ga0207682_10029207 3300025893 Bacteria 2204
238 Ga0207682_10097742 3300025893 Bacteria 1280
239 Ga0207688_10059838 3300025901 Bacteria 2145
240 Ga0207688_10522112 3300025901 Bacteria 745
241 Ga0207680_10005665 3300025903 Bacteria 5978
242 Ga0207680_10027312 3300025903 Bacteria 3177
243 Ga0207680_10057350 3300025903 Bacteria 2356
244 Ga0207647_10026241 3300025904 Bacteria 3815
245 Ga0207647_10034734 3300025904 Bacteria 3217
246 Ga0207647_10301359 3300025904 Bacteria 913
247 Ga0207645_10014955 3300025907 Bacteria 5171
248 Ga0207705_10000074 3300025909 Bacteria 123863
249 Ga0207705_10006427 3300025909 Bacteria 8706
250 Ga0207705_10019676 3300025909 Bacteria 4827
251 Ga0207705_10041259 3300025909 Bacteria 3310
252 Ga0207684_10637549 3300025910 Bacteria 908
253 Ga0207654_10012125 3300025911 Bacteria 4411
254 Ga0207654_10265858 3300025911 Bacteria 1155
255 Ga0207707_10078574 3300025912 Bacteria 2881
256 Ga0207707_10158382 3300025912 Bacteria 1980
257 Ga0207707_10247449 3300025912 Bacteria 1549
258 Ga0207707_10398385 3300025912 Bacteria 1182
259 Ga0207707_10529311 3300025912 Bacteria 1003
260 Ga0207707_10794359 3300025912 Bacteria 789
261 Ga0207660_10008550 3300025917 Bacteria 6625
262 Ga0207660_10036434 3300025917 Bacteria 3420
263 Ga0207657_10000572 3300025919 Bacteria 39129
264 Ga0207657_10008868 3300025919 Bacteria 10172
265 Ga0207657_10011404 3300025919 Bacteria 8824
266 Ga0207657_10074379 3300025919 Bacteria 2869
267 Ga0207657_10095569 3300025919 Bacteria 2473
268 Ga0207657_10099248 3300025919 Bacteria 2419
269 Ga0207657_10558677 3300025919 Bacteria 895
270 Ga0207649_10000701 3300025920 Bacteria 21986
271 Ga0207649_10005877 3300025920 Bacteria 6651
272 Ga0207649_10120325 3300025920 Bacteria 1769
273 Ga0207649_10376924 3300025920 Bacteria 1056
274 Ga0207649_10381780 3300025920 Bacteria 1050
275 Ga0207649_10619336 3300025920 Bacteria 834
276 Ga0207652_10007093 3300025921 Bacteria 9029
277 Ga0207652_10018468 3300025921 Bacteria 5721
278 Ga0207652_10281594 3300025921 Bacteria 1500
279 Ga0207652_10758902 3300025921 Bacteria 863
280 Ga0207681_10563784 3300025923 Unclassified 938
281 Ga0207694_10017073 3300025924 Bacteria 5483
282 Ga0207650_10006180 3300025925 Bacteria 8161
283 Ga0207650_10078948 3300025925 Bacteria 2491
284 Ga0207650_10117225 3300025925 Bacteria 2069
285 Ga0207650_10161942 3300025925 Bacteria 1773
286 Ga0207650_10162950 3300025925 Bacteria 1768
287 Ga0207650_10211942 3300025925 Bacteria 1556
288 Ga0207650_10502148 3300025925 Bacteria 1014
289 Ga0207700_10516925 3300025928 Bacteria 1057
290 Ga0207664_10391440 3300025929 Bacteria 1235
291 Ga0207664_10995694 3300025929 Bacteria 751
292 Ga0207644_10006527 3300025931 Bacteria 7608
293 Ga0207644_10014947 3300025931 Bacteria 5204
294 Ga0207644_10044379 3300025931 Bacteria 3158
295 Ga0207644_10048550 3300025931 Bacteria 3035
296 Ga0207690_10000336 3300025932 Bacteria 31366
297 Ga0207690_10011137 3300025932 Bacteria 5366
298 Ga0207690_10027614 3300025932 Bacteria 3588
299 Ga0207690_10152437 3300025932 Bacteria 1714
300 Ga0207690_10450866 3300025932 Bacteria 1034
301 Ga0207690_10964394 3300025932 Unclassified 709
302 Ga0207706_10000574 3300025933 Bacteria 39136
303 Ga0207706_10006309 3300025933 Bacteria 11018
304 Ga0207706_10029877 3300025933 Bacteria 4864
305 Ga0207706_10034021 3300025933 Bacteria 4535
306 Ga0207706_10057964 3300025933 Bacteria 3412
307 Ga0207706_10213954 3300025933 Bacteria 1689
308 Ga0207669_10018650 3300025937 Bacteria 3593
309 Ga0207669_10224113 3300025937 Bacteria 1382
310 Ga0207691_10038111 3300025940 Bacteria 4448
311 Ga0207691_10075463 3300025940 Bacteria 3040
312 Ga0207691_10151451 3300025940 Bacteria 2039
313 Ga0207711_10001345 3300025941 Bacteria 23197
314 Ga0207711_10008775 3300025941 Bacteria 8454
315 Ga0207711_10024098 3300025941 Bacteria 5094
316 Ga0207711_10081595 3300025941 Bacteria 2826
317 Ga0207661_10001741 3300025944 Bacteria 14901
318 Ga0207661_10540275 3300025944 Bacteria 1067
319 Ga0207661_10627941 3300025944 Unclassified 987
320 Ga0207661_11069664 3300025944 Bacteria 743
321 Ga0207679_10000167 3300025945 Bacteria 54388
322 Ga0207679_10017091 3300025945 Bacteria 4828
323 Ga0207679_10071438 3300025945 Bacteria 2618
324 Ga0207679_10209590 3300025945 Bacteria 1633
325 Ga0207679_10456329 3300025945 Bacteria 1134
326 Ga0207679_10866572 3300025945 Unclassified 825
327 Ga0207667_10077394 3300025949 Bacteria 3450
328 Ga0207667_10085990 3300025949 Bacteria 3255
329 Ga0207667_10124866 3300025949 Bacteria 2651
330 Ga0207667_10315699 3300025949 Bacteria 1596
331 Ga0207667_11146785 3300025949 Bacteria 759
332 Ga0207651_10026425 3300025960 Bacteria 3626
333 Ga0207668_10000064 3300025972 Bacteria 87025
334 Ga0207668_10019324 3300025972 Bacteria 4305
335 Ga0207640_10140077 3300025981 Bacteria 1762
336 Ga0207658_10005464 3300025986 Bacteria 8717
337 Ga0207658_10006176 3300025986 Bacteria 8179
338 Ga0207658_10022414 3300025986 Bacteria 4397
339 Ga0207658_10513621 3300025986 Unclassified 1068
340 Ga0207703_10629261 3300026035 Unclassified 1017
341 Ga0207639_10053154 3300026041 Bacteria 3089
342 Ga0207639_10063135 3300026041 Bacteria 2866
343 Ga0207639_10478375 3300026041 Bacteria 1135
344 Ga0207639_10494592 3300026041 Bacteria 1116
345 Ga0207639_10659226 3300026041 Bacteria 969
346 Ga0207639_11477603 3300026041 Unclassified 638
347 Ga0207678_10006597 3300026067 Bacteria 10291
348 Ga0207678_10010826 3300026067 Bacteria 8014
349 Ga0207678_10012165 3300026067 Bacteria 7558
350 Ga0207678_10031736 3300026067 Bacteria 4606
351 Ga0207678_10487446 3300026067 Bacteria 1074
352 Ga0207678_10838452 3300026067 Bacteria 812
353 Ga0207702_10001335 3300026078 Bacteria 24670
354 Ga0207702_10072806 3300026078 Bacteria 2962
355 Ga0207641_10001570 3300026088 Bacteria 22313
356 Ga0207641_10664242 3300026088 Bacteria 1024
357 Ga0207676_10187367 3300026095 Bacteria 1817
358 Ga0207676_10194774 3300026095 Bacteria 1786
359 Ga0207674_10000501 3300026116 Bacteria 51694
360 Ga0207674_10075597 3300026116 Bacteria 3378
361 Ga0207674_10431082 3300026116 Bacteria 1274
362 Ga0207674_10572176 3300026116 Bacteria 1091
363 Ga0207675_100528714 3300026118 Bacteria 1176
364 Ga0207683_10003889 3300026121 Bacteria 12953
365 Ga0207683_10187405 3300026121 Bacteria 1877
366 Ga0207683_10857491 3300026121 Bacteria 843
367 Ga0207698_10000791 3300026142 Bacteria 18427
368 Ga0207698_10005426 3300026142 Bacteria 7881
369 Ga0207698_10025024 3300026142 Bacteria 4198
370 Ga0207698_10121936 3300026142 Bacteria 2208
371 Ga0207698_10201693 3300026142 Bacteria 1782
372 Ga0207698_10405831 3300026142 Unclassified 1303
373 Ga0207698_10496731 3300026142 Bacteria 1187
374 Ga0207698_10501945 3300026142 Bacteria 1181
375 Ga0209970_1036512 3300027614 Bacteria 865
376 Ga0268266_10019205 3300028379 Bacteria 5820
377 Ga0268266_10043119 3300028379 Bacteria 3855
378 Ga0268266_11766904 3300028379 Bacteria 593
379 Ga0268265_10103864 3300028380 Bacteria 2302
380 Ga0268264_10157259 3300028381 Bacteria 2044
381 Ga0268264_10901886 3300028381 Unclassified 887
382 Ga0307408_100078613 3300031548 Bacteria 2459
383 Ga0307408_100101355 3300031548 Bacteria 2194
384 Ga0307408_100420308 3300031548 Bacteria 1152
385 Ga0307408_100769436 3300031548 Bacteria 871
386 Ga0307405_10008897 3300031731 Bacteria 5120
387 Ga0307405_10101907 3300031731 Bacteria 1927
388 Ga0307405_10132876 3300031731 Bacteria 1723
389 Ga0307405_10659303 3300031731 Bacteria 862
390 Ga0307413_10007622 3300031824 Bacteria 5045
391 Ga0307413_10025745 3300031824 Bacteria 3230
392 Ga0307413_10544155 3300031824 Bacteria 940
393 Ga0307410_10008672 3300031852 Bacteria 5651
394 Ga0307410_10052874 3300031852 Bacteria 2746
395 Ga0307410_10084417 3300031852 Bacteria 2239
396 Ga0307410_10137541 3300031852 Unclassified 1802
397 Ga0307410_10191557 3300031852 Bacteria 1555
398 Ga0307410_10220218 3300031852 Bacteria 1460
399 Ga0307406_10023978 3300031901 Bacteria 3638
400 Ga0307406_10058245 3300031901 Bacteria 2482
401 Ga0307406_10070908 3300031901 Bacteria 2282
402 Ga0307407_10079368 3300031903 Bacteria 1980
403 Ga0307407_10107141 3300031903 Bacteria 1747
404 Ga0307407_10186644 3300031903 Bacteria 1378
405 Ga0307407_10876236 3300031903 Unclassified 687
406 Ga0307412_10096981 3300031911 Bacteria 2076
407 Ga0307412_10164276 3300031911 Bacteria 1653
408 Ga0307409_100001476 3300031995 Bacteria 11593
409 Ga0307409_100041841 3300031995 Bacteria 3426
410 Ga0307409_100071718 3300031995 Bacteria 2755
411 Ga0307409_100156547 3300031995 Bacteria 1986
412 Ga0307409_100698229 3300031995 Bacteria 1013
413 Ga0307409_100904873 3300031995 Unclassified 896
414 Ga0307416_100082034 3300032002 Bacteria 2730
415 Ga0307416_100131642 3300032002 Bacteria 2253
416 Ga0307416_100205904 3300032002 Bacteria 1871
417 Ga0307416_100824804 3300032002 Bacteria 1024
418 Ga0307416_101601695 3300032002 Bacteria 756
419 Ga0307416_102732499 3300032002 Bacteria 590
420 Ga0307414_10016033 3300032004 Bacteria 4542
421 Ga0307414_10035108 3300032004 Bacteria 3333
422 Ga0307411_10000291 3300032005 Bacteria 16720
423 Ga0307411_10073852 3300032005 Bacteria 2321
424 Ga0307411_10144736 3300032005 Bacteria 1757
425 Ga0307411_10218491 3300032005 Bacteria 1477
426 Ga0307411_10673505 3300032005 Bacteria 898
427 Ga0307411_11380594 3300032005 Unclassified 644
428 Ga0307415_100100063 3300032126 Bacteria 2123
429 Ga0307415_100170979 3300032126 Bacteria 1694
430 Ga0307415_100372389 3300032126 Bacteria 1210
431 Ga0373938_0052857 3300034957 Unclassified 932
432 Ga0373960_0218554 3300035121 Unclassified 681
433 Ga0373961_0013148 3300035241 Bacteria 2082
434 Ga0373931_0001620 3300035691 Bacteria 9743
435 Ga0395899_0000641 3300037312 Bacteria 36112
436 Ga0395899_0001653 3300037312 Bacteria 18590
437 Ga0395899_0031609 3300037312 Bacteria 3978
438 Ga0395899_0305790 3300037312 Unclassified 1075
439 Ga0395899_0358303 3300037312 Bacteria 974
440 Ga0395900_0000238 3300037418 Bacteria 86469
441 Ga0395900_0001814 3300037418 Bacteria 24441
442 Ga0395900_0054864 3300037418 Bacteria 4103
443 Ga0395900_0068230 3300037418 Bacteria 3654
444 Ga0395900_0416941 3300037418 Unclassified 1304
445 Ga0395900_0465882 3300037418 Bacteria 1218
446 Ga0395900_0592785 3300037418 Bacteria 1049
447 Ga0395900_0668147 3300037418 Bacteria 974
448 Ga0395900_0856581 3300037418 Bacteria 834
449 Ga0395900_0996577 3300037418 Unclassified 758
450 Ga0395898_0000245 3300037466 Bacteria 136315
451 Ga0395898_0022305 3300037466 Bacteria 6412
452 Ga0395898_0091508 3300037466 Bacteria 2926
453 Ga0395898_0105646 3300037466 Bacteria 2700
454 Ga0395898_0109237 3300037466 Bacteria 2652
455 Ga0395898_0109958 3300037466 Bacteria 2642
456 Ga0395898_0167656 3300037466 Bacteria 2099
457 Ga0395898_0182850 3300037466 Bacteria 2003
458 Ga0395898_0416624 3300037466 Unclassified 1280
459 Ga0395898_0717510 3300037466 Bacteria 941
460 Ga0395905_0000006 3300037471 Bacteria 549428
461 Ga0395905_0001434 3300037471 Bacteria 28687
462 Ga0395905_0003593 3300037471 Bacteria 16500
463 Ga0395905_0004221 3300037471 Bacteria 15022
464 Ga0395905_0005557 3300037471 Bacteria 12851
465 Ga0395905_0009273 3300037471 Bacteria 9626
466 Ga0395905_0045386 3300037471 Bacteria 4122
467 Ga0395905_0102720 3300037471 Bacteria 2684
468 Ga0395905_0133900 3300037471 Bacteria 2331
469 Ga0395905_0148611 3300037471 Bacteria 2204
470 Ga0395905_0449105 3300037471 Bacteria 1187
471 Ga0395905_0575543 3300037471 Bacteria 1027
472 Ga0395905_0603907 3300037471 Bacteria 999
473 Ga0395901_0000156 3300038443 Bacteria 88513
474 Ga0395901_0000707 3300038443 Bacteria 38127
475 Ga0395901_0017367 3300038443 Bacteria 7345
476 Ga0395901_0031470 3300038443 Bacteria 5471
477 Ga0395901_0081593 3300038443 Bacteria 3378
478 Ga0395901_0102797 3300038443 Bacteria 2998
479 Ga0395901_0270472 3300038443 Bacteria 1767
480 Ga0395901_0362842 3300038443 Bacteria 1493
481 Ga0395901_0390052 3300038443 Bacteria 1432
482 Ga0395901_0626984 3300038443 Bacteria 1081
483 Ga0395901_0678486 3300038443 Unclassified 1030
484 Ga0395901_0833102 3300038443 Bacteria 909
485 Ga0395901_1329968 3300038443 Bacteria 679
486 Ga0451853_3848214 3300041512 Bacteria 1057
487 Ga0439432_003506 3300042006 Bacteria 5811
488 Ga0439449_0053578 3300042007 Bacteria 1491
489 Ga0450890_004808 3300042127 Bacteria 1754
490 Ga0450889_002011 3300042144 Bacteria 2039
491 Ga0439458_0000727 3300042157 Bacteria 8482
492 Ga0466969_0018583 3300044656 Bacteria 3620
493 Ga0466972_0357126 3300044658 Bacteria 683
494 Ga0466965_0108203 3300044683 Bacteria 1427
495 Ga0466966_0007703 3300044684 Bacteria 7130
496 Ga0466966_0068286 3300044684 Bacteria 2232
497 Ga0466961_0013245 3300044693 Bacteria 5276
498 Ga0466961_0088190 3300044693 Bacteria 1960
499 Ga0466961_0158118 3300044693 Unclassified 1413
500 Ga0466963_0114851 3300044694 Bacteria 1850
501 Ga0466963_0337476 3300044694 Bacteria 1061
502 Ga0466964_0012901 3300044706 Bacteria 3165
503 Ga0466971_0115553 3300044719 Bacteria 1240
504 Ga0466971_0142379 3300044719 Unclassified 1117
505 Ga0466968_0051756 3300044735 Bacteria 1755
506 Ga0466957_0009266 3300044842 Bacteria 5617
507 Ga0466957_0170175 3300044842 Bacteria 1419
508 Ga0466957_0456521 3300044842 Bacteria 881
509 Ga0466960_0390226 3300044901 Unclassified 800
510 Ga0466959_0038457 3300045049 Bacteria 3536
511 Ga0466959_0163182 3300045049 Bacteria 1566
512 Ga0466959_0208031 3300045049 Bacteria 1360
513 Ga0466958_0000776 3300045836 Bacteria 14042
514 Ga0466958_0009717 3300045836 Bacteria 5367
515 Ga0466967_0006385 3300045976 Bacteria 8332
516 Ga0466967_0037032 3300045976 Bacteria 4171
517 Ga0466967_0039565 3300045976 Bacteria 4054
518 Ga0466967_0043909 3300045976 Bacteria 3873
519 Ga0466967_0242900 3300045976 Bacteria 1718
520 Ga0466967_0273790 3300045976 Bacteria 1618
521 Ga0466967_0277173 3300045976 Bacteria 1608
522 Ga0466967_0426447 3300045976 Bacteria 1293
523 Ga0466967_0994165 3300045976 Bacteria 835
524 Ga0495663_0006403 3300046525 Bacteria 3250
525 Ga0495663_0032838 3300046525 Bacteria 1547
526 Ga0495598_0000231 3300046537 Bacteria 9952
527 Ga0495621_0000597 3300046539 Bacteria 9014
528 Ga0495633_0010977 3300046558 Bacteria 4918
529 Ga0495656_0349056 3300046615 Unclassified 766
530 Ga0495668_0302022 3300046616 Bacteria 878
531 Ga0495661_0057455 3300046665 Bacteria 2323
532 Ga0495669_0002190 3300046684 Bacteria 8018
533 Ga0495669_0065604 3300046684 Bacteria 1648
534 Ga0495669_0095163 3300046684 Bacteria 1379
535 Ga0495670_0003874 3300046691 Bacteria 7349
536 Ga0495677_0007384 3300047445 Bacteria 4112
537 Ga0495677_0009588 3300047445 Bacteria 3575
538 Ga0496100_0024125 3300048903 Bacteria 3705
539 Ga0496100_0626903 3300048903 Unclassified 836
540 Ga0496101_0097523 3300048904 Bacteria 2195
541 Ga0496102_0719930 3300048905 Bacteria 921
542 Ga0496104_0286421 3300048907 Bacteria 1560
543 Ga0496104_1224693 3300048907 Bacteria 654
544 Ga0496106_0221311 3300048909 Bacteria 1510
545 Ga0496106_0832226 3300048909 Unclassified 731
546 Ga0496107_0478416 3300048910 Bacteria 924
547 Ga0496108_0011610 3300048911 Bacteria 7165
548 Ga0496109_0018275 3300048912 Bacteria 6157
549 Ga0496109_0177787 3300048912 Bacteria 1998
550 Ga0496109_0285811 3300048912 Bacteria 1554
551 Ga0496109_0907965 3300048912 Unclassified 819
552 Ga0496110_0568661 3300048913 Bacteria 1029
553 Ga0496110_0771704 3300048913 Bacteria 865
554 Ga0496111_0071900 3300048914 Bacteria 2517
555 Ga0496111_1002938 3300048914 Unclassified 598
556 Ga0496112_0113169 3300048915 Bacteria 2684
557 Ga0496112_0223621 3300048915 Bacteria 1838
558 Ga0496113_0027883 3300048916 Bacteria 4054
559 Ga0496114_0027706 3300048917 Bacteria 4644
560 Ga0496115_0073229 3300048918 Bacteria 2780
561 Ga0501068_0026955 3300049584 Bacteria 3391
562 Ga0501069_0046378 3300049585 Bacteria 2411
563 Ga0501230_027946 3300049667 Bacteria 1034
564 Ga0501242_007775 3300049674 Bacteria 1243
565 Ga0501221_125445 3300049704 Bacteria 660
566 Ga0501225_0080562 3300049705 Bacteria 935
567 nmdc:mga05p37_509448_c1 3300050507 Bacteria 1379
568 Ga0466962_0055499 3300061719 Unclassified 1893
569 Ga0466962_0084617 3300061719 Bacteria 1518
570 Ga0466962_0119831 3300061719 Bacteria 1269
571 Ga0466962_0310084 3300061719 Bacteria 782
572 Ga0466967_0133714
573 JGI24752J21851_1018455
574 JGI24740J21852_10031858
575 JGI24739J22299_10031112
576 JGI24739J22299_10042498
577 JGI24737J22298_10000640
578 JGI24737J22298_10004080
579 JGI24735J21928_10015924
580 JGI24735J21928_10027835
581 JGI24735J21928_10097395
582 JGI24738J21930_10000976
583 JGI24744J21845_10000093
584 JGI24742J22300_10030502
585 Ga0070658_10000590
586 Ga0070658_10083991
587 Ga0070658_10255723
588 Ga0070676_10018137
589 Ga0070676_10033595
590 Ga0070683_100032804
591 Ga0070683_100078608
592 Ga0070690_100102418
593 Ga0070670_100004598
594 Ga0070670_100024374
595 Ga0070670_100059654
596 Ga0070670_100110654
597 Ga0070670_100131296
598 Ga0070677_10022527
599 Ga0070677_10027729
600 Ga0068869_100485260
601 Ga0070666_10003731
602 Ga0070666_10005609
603 Ga0070666_10036604
604 Ga0070680_100003865
605 Ga0070680_100028300
606 Ga0070680_100061175
607 Ga0070680_100066112
608 Ga0070680_100306844
609 Ga0070682_100037532
610 Ga0070660_100000033
611 Ga0070660_100009941
612 Ga0070660_100011523
613 Ga0070660_100040475
614 Ga0070660_100070801
615 Ga0070660_100141712
616 Ga0070660_100146667
617 Ga0070660_100552610
618 Ga0070691_10265906
619 Ga0070661_100000547
620 Ga0070661_100024506
621 Ga0070661_100069821
622 Ga0070661_100099443
623 Ga0070661_100148385
624 Ga0070661_100331366
625 Ga0070692_10003701
626 Ga0070692_10020328
627 Ga0070692_10190669
628 Ga0070668_100257244
629 Ga0070668_100292660
630 Ga0070669_100540492
631 Ga0070675_100498954
632 Ga0070671_100099582
633 Ga0070671_100240098
634 Ga0070671_100771943
635 Ga0070674_100011974
636 Ga0070674_100058633
637 Ga0070674_100263900
638 Ga0070674_100390007
639 Ga0070673_100016115
640 Ga0070659_100000433
641 Ga0070659_100115045
642 Ga0070659_100135435
643 Ga0070659_101612000
644 Ga0070667_100005129
645 Ga0070667_100016916
646 Ga0070667_100017782
647 Ga0070667_100019495
648 Ga0070667_100241608
649 Ga0070667_100568868
650 Ga0070714_100093979
651 Ga0070714_100106786
652 Ga0070714_100315435
653 Ga0070694_100025724
654 Ga0070663_100004999
655 Ga0070663_100012882
656 Ga0070663_100015833
657 Ga0070663_100070596
658 Ga0070678_100001396
659 Ga0070678_100013753
660 Ga0070678_100268551
661 Ga0070662_100000522
662 Ga0070662_100003549
663 Ga0070662_100039372
664 Ga0070662_100101050
665 Ga0070662_100329794
666 Ga0070681_10028840
667 Ga0070681_10068580
668 Ga0070679_100026078
669 Ga0070679_100045186
670 Ga0070679_100339249
671 Ga0070679_100373941
672 Ga0070684_100372562
673 Ga0068853_100006622
674 Ga0068853_100024702
675 Ga0068853_100070155
676 Ga0068853_100075035
677 Ga0068853_100233048
678 Ga0068853_100536654
679 Ga0068853_101186028
680 Ga0070672_100222709
681 Ga0070672_100234712
682 Ga0070695_100010625
683 Ga0070696_100009154
684 Ga0070696_100232309
685 Ga0070696_100409765
686 Ga0070696_100438045
687 Ga0070693_100002317
688 Ga0070693_100026610
689 Ga0070693_100065759
690 Ga0070665_100009480
691 Ga0070665_100017292
692 Ga0070665_100895261
693 Ga0068855_100013548
694 Ga0068855_100035598
695 Ga0068855_100071761
696 Ga0068855_100081713
697 Ga0068855_100123750
698 Ga0070664_100000822
699 Ga0070664_100038334
700 Ga0070664_100073306
701 Ga0070664_100121721
702 Ga0070664_100177533
703 Ga0070664_100179436
704 Ga0070664_100186826
705 Ga0068857_100006795
706 Ga0068857_100239144
707 Ga0068854_100168933
708 Ga0068854_100282092
709 Ga0068854_100394038
710 Ga0068854_100907381
711 Ga0068856_100001471
712 Ga0068856_100054489
713 Ga0068856_100064770
714 Ga0070702_100036380
715 Ga0068852_100002526
716 Ga0068852_100002763
717 Ga0068852_100011623
718 Ga0068852_100024573
719 Ga0068852_100164666
720 Ga0068852_100344975
721 Ga0068852_100383894
722 Ga0068859_100511502
723 Ga0068864_100021810
724 Ga0068864_100026583
725 Ga0068866_10006055
726 Ga0068851_10021238
727 Ga0068851_10030876
728 Ga0068851_10102809
729 Ga0068851_10417229
730 Ga0068863_100004110
731 Ga0068863_100034058
732 Ga0068863_101132436
733 Ga0068858_100008591
734 Ga0068858_100556086
735 Ga0068858_100568006
736 Ga0068860_100048298
737 Ga0068860_100388764
738 Ga0068862_100123192
739 Ga0081539_10015777
740 Ga0070712_101124190
741 Ga0097621_100010323
742 Ga0097621_100343012
743 Ga0068871_100021332
744 Ga0068871_100150289
745 Ga0068871_100203371
746 Ga0075428_100267279
747 Ga0075431_100554626
748 Ga0075429_100286963
749 Ga0068865_100310925
750 Ga0097620_100511536
751 Ga0111539_10211783
752 Ga0114129_10559401
753 Ga0105243_10250387
754 Ga0105241_10347185
755 Ga0105241_10556124
756 Ga0105248_10000182
757 Ga0105248_10018014
758 Ga0105248_10039198
759 Ga0105238_10104825
760 Ga0105238_10468263
761 Ga0105238_10605344
762 Ga0105246_10861824
763 Ga0157373_10095271
764 Ga0157373_10244315
765 Ga0157371_10001754
766 Ga0157371_10043667
767 Ga0157371_10073360
768 Ga0157371_10085651
769 Ga0157370_10068246
770 Ga0157370_10100316
771 Ga0157370_11174997
772 Ga0157369_10025584
773 Ga0157369_10222850
774 Ga0157369_10386409
775 Ga0157369_10718546
776 Ga0157369_11016706
777 Ga0157374_10013976
778 Ga0157374_10115685
779 Ga0157374_10214919
780 Ga0157378_10054144
781 Ga0163162_10019626
782 Ga0157372_10129918
783 Ga0157372_10421238
784 Ga0157372_10557610
785 Ga0157372_10760289
786 Ga0157372_10806371
787 Ga0157372_10948803
788 Ga0157375_10018221
789 Ga0157375_10632333
790 Ga0157375_11278231
791 Ga0163163_10000058
792 Ga0163163_10002256
793 Ga0163163_10022712
794 Ga0157377_10074149
795 Ga0157379_10036006
796 Ga0157379_10113020
797 Ga0197907_11388595
798 Ga0206356_10816572
799 Ga0206349_1922197
800 Ga0206351_10678103
801 Ga0206352_10015386
802 Ga0206350_10587277
803 Ga0206354_10311629
804 Ga0206354_10313717
805 Ga0206353_10822112
806 Ga0224712_10129282
807 Ga0207656_10003002
808 Ga0207682_10029207
809 Ga0207682_10097742
810 Ga0207688_10059838
811 Ga0207688_10522112
812 Ga0207680_10005665
813 Ga0207680_10027312
814 Ga0207680_10057350
815 Ga0207647_10026241
816 Ga0207647_10034734
817 Ga0207647_10301359
818 Ga0207645_10014955
819 Ga0207705_10000074
820 Ga0207705_10006427
821 Ga0207705_10019676
822 Ga0207705_10041259
823 Ga0207684_10637549
824 Ga0207654_10012125
825 Ga0207654_10265858
826 Ga0207707_10078574
827 Ga0207707_10158382
828 Ga0207707_10247449
829 Ga0207707_10398385
830 Ga0207707_10529311
831 Ga0207707_10794359
832 Ga0207660_10008550
833 Ga0207660_10036434
834 Ga0207657_10000572
835 Ga0207657_10008868
836 Ga0207657_10011404
837 Ga0207657_10074379
838 Ga0207657_10095569
839 Ga0207657_10099248
840 Ga0207657_10558677
841 Ga0207649_10000701
842 Ga0207649_10005877
843 Ga0207649_10120325
844 Ga0207649_10376924
845 Ga0207649_10381780
846 Ga0207649_10619336
847 Ga0207652_10007093
848 Ga0207652_10018468
849 Ga0207652_10281594
850 Ga0207652_10758902
851 Ga0207681_10563784
852 Ga0207694_10017073
853 Ga0207650_10006180
854 Ga0207650_10078948
855 Ga0207650_10117225
856 Ga0207650_10161942
857 Ga0207650_10162950
858 Ga0207650_10211942
859 Ga0207650_10502148
860 Ga0207700_10516925
861 Ga0207664_10391440
862 Ga0207664_10995694
863 Ga0207644_10006527
864 Ga0207644_10014947
865 Ga0207644_10044379
866 Ga0207644_10048550
867 Ga0207690_10000336
868 Ga0207690_10011137
869 Ga0207690_10027614
870 Ga0207690_10152437
871 Ga0207690_10450866
872 Ga0207690_10964394
873 Ga0207706_10000574
874 Ga0207706_10006309
875 Ga0207706_10029877
876 Ga0207706_10034021
877 Ga0207706_10057964
878 Ga0207706_10213954
879 Ga0207669_10018650
880 Ga0207669_10224113
881 Ga0207691_10038111
882 Ga0207691_10075463
883 Ga0207691_10151451
884 Ga0207711_10001345
885 Ga0207711_10008775
886 Ga0207711_10024098
887 Ga0207711_10081595
888 Ga0207661_10001741
889 Ga0207661_10540275
890 Ga0207661_10627941
891 Ga0207661_11069664
892 Ga0207679_10000167
893 Ga0207679_10017091
894 Ga0207679_10071438
895 Ga0207679_10209590
896 Ga0207679_10456329
897 Ga0207679_10866572
898 Ga0207667_10077394
899 Ga0207667_10085990
900 Ga0207667_10124866
901 Ga0207667_10315699
902 Ga0207667_11146785
903 Ga0207651_10026425
904 Ga0207668_10000064
905 Ga0207668_10019324
906 Ga0207640_10140077
907 Ga0207658_10005464
908 Ga0207658_10006176
909 Ga0207658_10022414
910 Ga0207658_10513621
911 Ga0207703_10629261
912 Ga0207639_10053154
913 Ga0207639_10063135
914 Ga0207639_10478375
915 Ga0207639_10494592
916 Ga0207639_10659226
917 Ga0207639_11477603
918 Ga0207678_10006597
919 Ga0207678_10010826
920 Ga0207678_10012165
921 Ga0207678_10031736
922 Ga0207678_10487446
923 Ga0207678_10838452
924 Ga0207702_10001335
925 Ga0207702_10072806
926 Ga0207641_10001570
927 Ga0207641_10664242
928 Ga0207676_10187367
929 Ga0207676_10194774
930 Ga0207674_10000501
931 Ga0207674_10075597
932 Ga0207674_10431082
933 Ga0207674_10572176
934 Ga0207675_100528714
935 Ga0207683_10003889
936 Ga0207683_10187405
937 Ga0207683_10857491
938 Ga0207698_10000791
939 Ga0207698_10005426
940 Ga0207698_10025024
941 Ga0207698_10121936
942 Ga0207698_10201693
943 Ga0207698_10405831
944 Ga0207698_10496731
945 Ga0207698_10501945
946 Ga0209970_1036512
947 Ga0268266_10019205
948 Ga0268266_10043119
949 Ga0268266_11766904
950 Ga0268265_10103864
951 Ga0268264_10157259
952 Ga0268264_10901886
953 Ga0307408_100078613
954 Ga0307408_100101355
955 Ga0307408_100420308
956 Ga0307408_100769436
957 Ga0307405_10008897
958 Ga0307405_10101907
959 Ga0307405_10132876
960 Ga0307405_10659303
961 Ga0307413_10007622
962 Ga0307413_10025745
963 Ga0307413_10544155
964 Ga0307410_10008672
965 Ga0307410_10052874
966 Ga0307410_10084417
967 Ga0307410_10137541
968 Ga0307410_10191557
969 Ga0307410_10220218
970 Ga0307406_10023978
971 Ga0307406_10058245
972 Ga0307406_10070908
973 Ga0307407_10079368
974 Ga0307407_10107141
975 Ga0307407_10186644
976 Ga0307407_10876236
977 Ga0307412_10096981
978 Ga0307412_10164276
979 Ga0307409_100001476
980 Ga0307409_100041841
981 Ga0307409_100071718
982 Ga0307409_100156547
983 Ga0307409_100698229
984 Ga0307409_100904873
985 Ga0307416_100082034
986 Ga0307416_100131642
987 Ga0307416_100205904
988 Ga0307416_100824804
989 Ga0307416_101601695
990 Ga0307416_102732499
991 Ga0307414_10016033
992 Ga0307414_10035108
993 Ga0307411_10000291
994 Ga0307411_10073852
995 Ga0307411_10144736
996 Ga0307411_10218491
997 Ga0307411_10673505
998 Ga0307411_11380594
999 Ga0307415_100100063
1000 Ga0307415_100170979
1001 Ga0307415_100372389
1002 Ga0373938_0052857
1003 Ga0373960_0218554
1004 Ga0373961_0013148
1005 Ga0373931_0001620
1006 Ga0395899_0000641
1007 Ga0395899_0001653
1008 Ga0395899_0031609
1009 Ga0395899_0305790
1010 Ga0395899_0358303
1011 Ga0395900_0000238
1012 Ga0395900_0001814
1013 Ga0395900_0054864
1014 Ga0395900_0068230
1015 Ga0395900_0416941
1016 Ga0395900_0465882
1017 Ga0395900_0592785
1018 Ga0395900_0668147
1019 Ga0395900_0856581
1020 Ga0395900_0996577
1021 Ga0395898_0000245
1022 Ga0395898_0022305
1023 Ga0395898_0091508
1024 Ga0395898_0105646
1025 Ga0395898_0109237
1026 Ga0395898_0109958
1027 Ga0395898_0167656
1028 Ga0395898_0182850
1029 Ga0395898_0416624
1030 Ga0395898_0717510
1031 Ga0395905_0000006
1032 Ga0395905_0001434
1033 Ga0395905_0003593
1034 Ga0395905_0004221
1035 Ga0395905_0005557
1036 Ga0395905_0009273
1037 Ga0395905_0045386
1038 Ga0395905_0102720
1039 Ga0395905_0133900
1040 Ga0395905_0148611
1041 Ga0395905_0449105
1042 Ga0395905_0575543
1043 Ga0395905_0603907
1044 Ga0395901_0000156
1045 Ga0395901_0000707
1046 Ga0395901_0017367
1047 Ga0395901_0031470
1048 Ga0395901_0081593
1049 Ga0395901_0102797
1050 Ga0395901_0270472
1051 Ga0395901_0362842
1052 Ga0395901_0390052
1053 Ga0395901_0626984
1054 Ga0395901_0678486
1055 Ga0395901_0833102
1056 Ga0395901_1329968
1057 Ga0451853_3848214
1058 Ga0439432_003506
1059 Ga0439449_0053578
1060 Ga0450890_004808
1061 Ga0450889_002011
1062 Ga0439458_0000727
1063 Ga0466969_0018583
1064 Ga0466972_0357126
1065 Ga0466965_0108203
1066 Ga0466966_0007703
1067 Ga0466966_0068286
1068 Ga0466961_0013245
1069 Ga0466961_0088190
1070 Ga0466961_0158118
1071 Ga0466963_0114851
1072 Ga0466963_0337476
1073 Ga0466964_0012901
1074 Ga0466971_0115553
1075 Ga0466971_0142379
1076 Ga0466968_0051756
1077 Ga0466957_0009266
1078 Ga0466957_0170175
1079 Ga0466957_0456521
1080 Ga0466960_0390226
1081 Ga0466959_0038457
1082 Ga0466959_0163182
1083 Ga0466959_0208031
1084 Ga0466958_0000776
1085 Ga0466958_0009717
1086 Ga0466967_0006385
1087 Ga0466967_0037032
1088 Ga0466967_0039565
1089 Ga0466967_0043909
1090 Ga0466967_0242900
1091 Ga0466967_0273790
1092 Ga0466967_0277173
1093 Ga0466967_0426447
1094 Ga0466967_0994165
1095 Ga0495663_0006403
1096 Ga0495663_0032838
1097 Ga0495598_0000231
1098 Ga0495621_0000597
1099 Ga0495633_0010977
1100 Ga0495656_0349056
1101 Ga0495668_0302022
1102 Ga0495661_0057455
1103 Ga0495669_0002190
1104 Ga0495669_0065604
1105 Ga0495669_0095163
1106 Ga0495670_0003874
1107 Ga0495677_0007384
1108 Ga0495677_0009588
1109 Ga0496100_0024125
1110 Ga0496100_0626903
1111 Ga0496101_0097523
1112 Ga0496102_0719930
1113 Ga0496104_0286421
1114 Ga0496104_1224693
1115 Ga0496106_0221311
1116 Ga0496106_0832226
1117 Ga0496107_0478416
1118 Ga0496108_0011610
1119 Ga0496109_0018275
1120 Ga0496109_0177787
1121 Ga0496109_0285811
1122 Ga0496109_0907965
1123 Ga0496110_0568661
1124 Ga0496110_0771704
1125 Ga0496111_0071900
1126 Ga0496111_1002938
1127 Ga0496112_0113169
1128 Ga0496112_0223621
1129 Ga0496113_0027883
1130 Ga0496114_0027706
1131 Ga0496115_0073229
1132 Ga0501068_0026955
1133 Ga0501069_0046378
1134 Ga0501230_027946
1135 Ga0501242_007775
1136 Ga0501221_125445
1137 Ga0501225_0080562
1138 nmdc:mga05p37_509448_c1
1139 Ga0466962_0055499
1140 Ga0466962_0084617
1141 Ga0466962_0119831
1142 Ga0466962_0310084

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map