F464922

General Info

Members Datasets Scaffolds Average Seq Length
571 344 1140 414

Family's Representative Sequence

Representative Sequence 3300005536|Ga0070697_100053677|Ga0070697_1000536772
Length 476
Sequence LKEPVARGFQRPGVPTASAKATAVRRRPMRSRKEAADAILATRSLADAAARSVDYNSARMPIDFETTLRNYADLTVAVGLNLQPDQRLLIIGPVANGGVSLEAAPLVREVTAAAYRRGARLVETLWGDEGLLAARLQYAPRDSFDEFSAWLPGALVQHVEGGHAVLSIYANDPDQLKDAPQDLVGVVQQTTARAVRPFREYISRNQTNWGVVAAGAASWAARVFPGVEPSQQLARLWDAIVCLCRLDRPDPIAAWESHLADLAARTEHLNAKQYSALRYRGPGTDLTIGLPPGHIWVGGRSTNAAGIRFAPNLPTEEVFTMPHKDRVDGVVRSTKPLSYGGTLIEGFTLRFAQGRVLEVTAERNQSVLERLVRMDPGAARLGEIALVPHSSPVAQTGVLFYNTLFDENAASHVALGAAYKFTMRGGEAMSDEDFEQVGGNRSATHVDFMIGSAELDVHGVRPDGAVEPVMRAGEWI

Samples

Sample ID Description Type Environment
1 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
2 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
8 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
9 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
33 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
34 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
35 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
36 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
53 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
76 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
77 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
84 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
104 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
151 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
156 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
157 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
158 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
159 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
160 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
161 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
162 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
163 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
167 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
171 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
172 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
173 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
178 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
179 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
180 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
181 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
185 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
186 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
192 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
193 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
194 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
195 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
196 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
198 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
204 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
207 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
212 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
213 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
214 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
215 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
218 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
219 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
222 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
223 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
224 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
225 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
228 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
229 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
230 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
231 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
232 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
233 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
234 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
235 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
236 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
237 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
238 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
239 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
240 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
241 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
242 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
243 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
244 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
247 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
248 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
249 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
250 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
251 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
256 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
257 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
258 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
259 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
262 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
272 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
273 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
274 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
275 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
276 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
277 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
278 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
279 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
280 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
281 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
282 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
283 2524023129 Paenibacillus pinihumi DSM 23905 Isolate Rhizosphere
284 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
285 2554235469 Sporolactobacillus laevolacticus DSM 442 Isolate Rhizosphere
286 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
287 2571042588 Paenibacillus zanthoxyli JH29 Isolate Unclassified
288 2576861424 Paenibacillus sabinae T27 Isolate Rhizosphere
289 2579778775 Paenibacillus durus P3L-5 Isolate Unclassified
290 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
291 2593339131 Bacillus sp. UNCCL81 Isolate Unclassified
292 2619619294 Paenibacillus durus ATCC 35681 Isolate Unclassified
293 2643221558 Rhizobium sp. Root149 Isolate Unclassified
294 2643221580 Devosia sp. Root635 Isolate Unclassified
295 2643221591 Devosia sp. Root685 Isolate Unclassified
296 2643221674 Devosia sp. Root436 Isolate Unclassified
297 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
298 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
299 2711768088 Sporolactobacillus terrae DSM 11697 Isolate Rhizosphere
300 2738543017 Bacillus sp. OV186 Isolate Unclassified
301 2757320391 Bacillus sp. NFR08 Isolate Rhizoplane
302 2775507177 Bacillus sp. AFS055030 Isolate Unclassified
303 2775507192 Bacillus sp. AFS041924 Isolate Unclassified
304 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
305 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
306 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
307 2818991459 Paenibacillus sp. 597 Isolate Unclassified
308 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
309 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
310 2857460504 Brevibacillus sp. R-74223 Isolate Unclassified
311 2857472729 Cohnella sp. R-74144 Isolate Unclassified
312 2857586860 Bacillus sp. R-71935 Isolate Unclassified
313 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
314 2881636855 Paenibacillus sp. 7197 Isolate Rhizosphere
315 2889295896 Paenibacillus sp. PvR098 Isolate Rhizosphere
316 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
317 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
318 2907202186 Paenibacillus sp. HJL G12 Isolate Unclassified
319 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
320 2925326138 Paenibacillus hemerocallicola KCTC 33185 Isolate Unclassified
321 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
322 2932401849 Devosia sp. 2618 Isolate Rhizosphere
323 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
324 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
325 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
326 2971403814 Paenibacillus tritici LMG 29502 Isolate Unclassified
327 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
328 2971511577 Paenibacillus apii 7124 Isolate Rhizosphere
329 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
330 2980176882 Paenibacillus apii 7028 Isolate Rhizosphere
331 2981284811 Paenibacillus sp. PvR052 Isolate Rhizosphere
332 2981289755 Paenibacillus sp. PvR148 Isolate Rhizosphere
333 2981980479 Paenibacillus sp. PvR018 Isolate Rhizosphere
334 2981985349 Paenibacillus sp. PvR053 Isolate Rhizosphere
335 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
336 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
337 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
338 3006978542 Bacillus sp. FJAT-49705 Isolate Rhizosphere
339 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
340 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
341 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
342 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
343 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
344 8057733483 Paenibacillus apiarius MW-14 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.87
Metatranscriptomes 0
Isolates 13.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.5
Nodule 1.58
Rhizoplane 4.38
Rhizosphere 82.14
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070697_100053677 3300005536 Bacteria 3276
2 JGI25158J39367_1005003 3300002739 Bacteria 1958
3 JGI25151J46595_10001364 3300003187 Bacteria 16891
4 rootH1_10163537 3300003316 Unclassified 1955
5 rootH2_10211470 3300003320 Bacteria 1530
6 rootL2_10100166 3300003322 Bacteria 3139
7 Ga0055538_1000388 3300003751 Bacteria 17959
8 Ga0055532_1001235 3300003758 Bacteria 7547
9 Ga0055541_1004110 3300003841 Bacteria 2672
10 Ga0065712_10105337 3300005290 Bacteria 1942
11 Ga0070658_10002700 3300005327 Bacteria 14759
12 Ga0070658_10016683 3300005327 Bacteria 5878
13 Ga0070658_10104795 3300005327 Bacteria 2340
14 Ga0070676_10064532 3300005328 Bacteria 2184
15 Ga0070683_100000408 3300005329 Bacteria 29693
16 Ga0070690_100094236 3300005330 Bacteria 1976
17 Ga0070670_100040669 3300005331 Bacteria 3996
18 Ga0070670_100063054 3300005331 Unclassified 3181
19 Ga0070666_10009883 3300005335 Bacteria 5957
20 Ga0070666_10013672 3300005335 Bacteria 5152
21 Ga0070666_10138320 3300005335 Bacteria 1695
22 Ga0070680_100002781 3300005336 Bacteria 12987
23 Ga0070680_100112496 3300005336 Bacteria 2267
24 Ga0070660_100023825 3300005339 Bacteria 4537
25 Ga0070660_100076440 3300005339 Bacteria 2623
26 Ga0070691_10017267 3300005341 Bacteria 3321
27 Ga0070661_100028317 3300005344 Bacteria 4040
28 Ga0070661_100050975 3300005344 Bacteria 3029
29 Ga0070661_100055639 3300005344 Bacteria 2897
30 Ga0070692_10036220 3300005345 Bacteria 2503
31 Ga0070669_100026686 3300005353 Bacteria 4156
32 Ga0070669_100136479 3300005353 Bacteria 1887
33 Ga0070675_100000723 3300005354 Bacteria 22952
34 Ga0070675_100107301 3300005354 Bacteria 2358
35 Ga0070671_100025615 3300005355 Bacteria 4842
36 Ga0070674_100003928 3300005356 Bacteria 8420
37 Ga0070673_100117404 3300005364 Bacteria 2214
38 Ga0070667_100063729 3300005367 Bacteria 3125
39 Ga0070709_10013151 3300005434 Bacteria 4646
40 Ga0070713_100125030 3300005436 Bacteria 2261
41 Ga0070713_100128599 3300005436 Bacteria 2231
42 Ga0070701_10031913 3300005438 Bacteria 2618
43 Ga0070705_100029638 3300005440 Bacteria 3013
44 Ga0070694_100025207 3300005444 Bacteria 3846
45 Ga0070678_100078208 3300005456 Bacteria 2498
46 Ga0070662_100103200 3300005457 Bacteria 2162
47 Ga0070681_10084533 3300005458 Bacteria 3126
48 Ga0070681_10094911 3300005458 Bacteria 2931
49 Ga0070681_10161145 3300005458 Bacteria 2167
50 Ga0070681_10161483 3300005458 Bacteria 2165
51 Ga0068867_100040887 3300005459 Bacteria 3386
52 Ga0068867_100066946 3300005459 Bacteria 2676
53 Ga0070707_100019468 3300005468 Bacteria 6395
54 Ga0070707_100207459 3300005468 Bacteria 1910
55 Ga0070698_100023284 3300005471 Bacteria 6475
56 Ga0070699_100070903 3300005518 Bacteria 3030
57 Ga0070679_100044362 3300005530 Bacteria 4430
58 Ga0070679_100075340 3300005530 Bacteria 3364
59 Ga0070679_100103116 3300005530 Bacteria 2839
60 Ga0070679_100214166 3300005530 Bacteria 1889
61 Ga0070684_100024426 3300005535 Bacteria 5071
62 Ga0070697_100172558 3300005536 Bacteria 1831
63 Ga0070672_100031271 3300005543 Bacteria 4005
64 Ga0070686_100004656 3300005544 Bacteria 7566
65 Ga0070695_100004738 3300005545 Bacteria 8004
66 Ga0070695_100008373 3300005545 Bacteria 6136
67 Ga0070696_100044300 3300005546 Bacteria 3081
68 Ga0070696_100049657 3300005546 Bacteria 2915
69 Ga0070665_100008458 3300005548 Bacteria 10409
70 Ga0070665_100012037 3300005548 Bacteria 8725
71 Ga0070665_100034730 3300005548 Bacteria 5071
72 Ga0070665_100241037 3300005548 Bacteria 1809
73 Ga0070704_100028762 3300005549 Bacteria 3701
74 Ga0070704_100076772 3300005549 Bacteria 2445
75 Ga0070704_100121446 3300005549 Bacteria 2008
76 Ga0068855_100018979 3300005563 Bacteria 8268
77 Ga0068855_100046325 3300005563 Bacteria 5141
78 Ga0068855_100083778 3300005563 Bacteria 3693
79 Ga0068855_100185514 3300005563 Bacteria 2349
80 Ga0068857_100131867 3300005577 Unclassified 2254
81 Ga0068854_100004621 3300005578 Bacteria 8685
82 Ga0068854_100021077 3300005578 Bacteria 4418
83 Ga0068854_100082000 3300005578 Bacteria 2384
84 Ga0070702_100043414 3300005615 Bacteria 2533
85 Ga0068852_100008783 3300005616 Bacteria 7475
86 Ga0068852_100057974 3300005616 Bacteria 3352
87 Ga0068859_100038669 3300005617 Bacteria 4786
88 Ga0068859_100238690 3300005617 Bacteria 1906
89 Ga0068864_100012070 3300005618 Bacteria 7135
90 Ga0068864_100054122 3300005618 Bacteria 3463
91 Ga0068866_10063029 3300005718 Bacteria 1931
92 Ga0068861_100064209 3300005719 Bacteria 2824
93 Ga0068851_10024226 3300005834 Bacteria 2971
94 Ga0068851_10069462 3300005834 Bacteria 1820
95 Ga0068863_100013317 3300005841 Bacteria 7933
96 Ga0068863_100141866 3300005841 Bacteria 2296
97 Ga0068858_100020037 3300005842 Bacteria 6255
98 Ga0068858_100048818 3300005842 Bacteria 3920
99 Ga0068860_100094083 3300005843 Bacteria 2856
100 Ga0068862_100242007 3300005844 Bacteria 1641
101 Ga0075432_10031343 3300006058 Bacteria 1840
102 Ga0070715_10011756 3300006163 Bacteria 3162
103 Ga0070712_100277666 3300006175 Bacteria 1348
104 Ga0097621_100000636 3300006237 Bacteria 24794
105 Ga0097621_100007637 3300006237 Bacteria 7751
106 Ga0097621_100010700 3300006237 Bacteria 6724
107 Ga0097621_100029014 3300006237 Bacteria 4366
108 Ga0097621_100339956 3300006237 Bacteria 1333
109 Ga0075370_10004356 3300006353 Bacteria 6862
110 Ga0068871_100003144 3300006358 Bacteria 11330
111 Ga0068871_100021412 3300006358 Bacteria 4968
112 Ga0075428_100122569 3300006844 Bacteria 2830
113 Ga0075430_100067710 3300006846 Bacteria 2997
114 Ga0075431_100064905 3300006847 Bacteria 3770
115 Ga0075434_100005437 3300006871 Bacteria 11599
116 Ga0075434_100007466 3300006871 Bacteria 10115
117 Ga0075434_100085896 3300006871 Bacteria 3146
118 Ga0075434_100151916 3300006871 Bacteria 2336
119 Ga0068865_100022654 3300006881 Bacteria 4101
120 Ga0075436_100001995 3300006914 Bacteria 14089
121 Ga0075436_100007102 3300006914 Bacteria 7664
122 Ga0097620_100038667 3300006931 Bacteria 4786
123 Ga0097620_100186886 3300006931 Bacteria 2156
124 Ga0097620_100238686 3300006931 Bacteria 1906
125 Ga0079104_1000411 3300006946 Bacteria 49275
126 Ga0079104_1004458 3300006946 Bacteria 5983
127 Ga0075435_100000051 3300007076 Bacteria 59038
128 Ga0075435_100001570 3300007076 Bacteria 14753
129 Ga0075435_100005824 3300007076 Bacteria 8664
130 Ga0075435_100006302 3300007076 Bacteria 8379
131 Ga0075435_100013820 3300007076 Bacteria 6018
132 Ga0075435_100018480 3300007076 Bacteria 5303
133 Ga0105244_10013856 3300009036 Bacteria 4687
134 Ga0105244_10034660 3300009036 Bacteria 2656
135 Ga0105240_10018245 3300009093 Bacteria 9431
136 Ga0105240_10020011 3300009093 Bacteria 8935
137 Ga0105240_10182836 3300009093 Bacteria 2472
138 Ga0105240_10472036 3300009093 Bacteria 1400
139 Ga0111539_10005672 3300009094 Bacteria 16149
140 Ga0111539_10058466 3300009094 Bacteria 4574
141 Ga0105245_10034818 3300009098 Bacteria 4467
142 Ga0105247_10167699 3300009101 Bacteria 1458
143 Ga0114129_10000418 3300009147 Bacteria 50300
144 Ga0114129_10004112 3300009147 Bacteria 20568
145 Ga0114129_10010650 3300009147 Bacteria 13111
146 Ga0114129_10016408 3300009147 Bacteria 10540
147 Ga0114129_10153618 3300009147 Bacteria 3149
148 Ga0105243_10005559 3300009148 Bacteria 9818
149 Ga0105243_10016009 3300009148 Bacteria 5673
150 Ga0105243_10061794 3300009148 Bacteria 2997
151 Ga0105241_10000021 3300009174 Bacteria 143251
152 Ga0105241_10025773 3300009174 Bacteria 4371
153 Ga0105242_10085442 3300009176 Bacteria 2646
154 Ga0105242_10112785 3300009176 Bacteria 2321
155 Ga0105248_10001563 3300009177 Bacteria 25457
156 Ga0105248_10036662 3300009177 Bacteria 5484
157 Ga0105248_10154636 3300009177 Bacteria 2588
158 Ga0105248_10198576 3300009177 Bacteria 2260
159 Ga0105237_10105825 3300009545 Bacteria 2805
160 Ga0105237_10145877 3300009545 Bacteria 2362
161 Ga0105238_10014829 3300009551 Bacteria 7884
162 Ga0105238_10033055 3300009551 Bacteria 5263
163 Ga0105238_10088558 3300009551 Bacteria 3082
164 Ga0105239_10004242 3300010375 Bacteria 17211
165 Ga0105239_10213150 3300010375 Bacteria 2165
166 Ga0105239_10264207 3300010375 Unclassified 1935
167 Ga0105246_10122890 3300011119 Bacteria 1926
168 Ga0157370_10041224 3300013104 Bacteria 4456
169 Ga0157370_10315730 3300013104 Bacteria 1442
170 Ga0157369_10001766 3300013105 Bacteria 26202
171 Ga0157369_10163779 3300013105 Bacteria 2346
172 Ga0157374_10044282 3300013296 Bacteria 4114
173 Ga0157374_10080820 3300013296 Bacteria 3084
174 Ga0157374_10267770 3300013296 Unclassified 1684
175 Ga0157378_10047109 3300013297 Bacteria 3832
176 Ga0157378_10383968 3300013297 Bacteria 1380
177 Ga0163162_10022431 3300013306 Bacteria 6218
178 Ga0157375_10049682 3300013308 Bacteria 4111
179 Ga0157375_10069505 3300013308 Bacteria 3528
180 Ga0163163_10012303 3300014325 Bacteria 7794
181 Ga0163163_10030374 3300014325 Bacteria 5206
182 Ga0157379_10105697 3300014968 Bacteria 2527
183 Ga0157376_10022170 3300014969 Bacteria 4945
184 Ga0157376_10091065 3300014969 Bacteria 2641
185 Ga0209784_102072 3300025224 Bacteria 2200
186 Ga0209566_100046 3300025225 Bacteria 247053
187 Ga0209147_100296 3300025229 Bacteria 41239
188 Ga0209675_1002882 3300025291 Bacteria 8529
189 Ga0209676_1001290 3300025292 Bacteria 25803
190 Ga0209025_1000219 3300025294 Bacteria 137235
191 Ga0209025_1006217 3300025294 Bacteria 9368
192 Ga0207642_10050917 3300025899 Bacteria 1871
193 Ga0207710_10087574 3300025900 Bacteria 1453
194 Ga0207680_10000575 3300025903 Bacteria 17326
195 Ga0207699_10115213 3300025906 Bacteria 1729
196 Ga0207645_10052837 3300025907 Bacteria 2597
197 Ga0207645_10060145 3300025907 Bacteria 2426
198 Ga0207654_10000053 3300025911 Bacteria 83591
199 Ga0207654_10043155 3300025911 Bacteria 2555
200 Ga0207707_10080520 3300025912 Bacteria 2844
201 Ga0207707_10081152 3300025912 Bacteria 2831
202 Ga0207695_10000140 3300025913 Bacteria 216271
203 Ga0207695_10089091 3300025913 Bacteria 3104
204 Ga0207695_10137202 3300025913 Bacteria 2398
205 Ga0207671_10122476 3300025914 Bacteria 1989
206 Ga0207660_10031024 3300025917 Bacteria 3677
207 Ga0207662_10012255 3300025918 Bacteria 4773
208 Ga0207657_10003696 3300025919 Bacteria 16270
209 Ga0207657_10188981 3300025919 Bacteria 1663
210 Ga0207649_10064840 3300025920 Bacteria 2311
211 Ga0207649_10067830 3300025920 Bacteria 2266
212 Ga0207649_10189102 3300025920 Bacteria 1446
213 Ga0207652_10064380 3300025921 Bacteria 3172
214 Ga0207652_10200917 3300025921 Bacteria 1794
215 Ga0207646_10147821 3300025922 Bacteria 2118
216 Ga0207646_10150518 3300025922 Bacteria 2098
217 Ga0207681_10100153 3300025923 Bacteria 2088
218 Ga0207694_10001774 3300025924 Bacteria 18034
219 Ga0207694_10144724 3300025924 Bacteria 1913
220 Ga0207650_10225787 3300025925 Bacteria 1509
221 Ga0207650_10282570 3300025925 Bacteria 1352
222 Ga0207659_10039084 3300025926 Bacteria 3306
223 Ga0207687_10007960 3300025927 Bacteria 6938
224 Ga0207687_10051848 3300025927 Bacteria 2861
225 Ga0207687_10053980 3300025927 Bacteria 2810
226 Ga0207700_10092218 3300025928 Bacteria 2394
227 Ga0207706_10059143 3300025933 Bacteria 3375
228 Ga0207706_10115685 3300025933 Bacteria 2359
229 Ga0207686_10027450 3300025934 Bacteria 3334
230 Ga0207670_10129119 3300025936 Bacteria 1849
231 Ga0207704_10001510 3300025938 Bacteria 10444
232 Ga0207711_10041546 3300025941 Bacteria 3916
233 Ga0207711_10089273 3300025941 Bacteria 2707
234 Ga0207711_10200800 3300025941 Bacteria 1819
235 Ga0207689_10194451 3300025942 Bacteria 1674
236 Ga0207661_10151600 3300025944 Bacteria 2004
237 Ga0207679_10052125 3300025945 Bacteria 2999
238 Ga0207712_10044122 3300025961 Bacteria 3080
239 Ga0207668_10222552 3300025972 Bacteria 1516
240 Ga0207640_10004709 3300025981 Bacteria 7409
241 Ga0207640_10040436 3300025981 Bacteria 2958
242 Ga0207658_10004017 3300025986 Bacteria 10295
243 Ga0207658_10073035 3300025986 Bacteria 2603
244 Ga0207658_10078866 3300025986 Bacteria 2518
245 Ga0207677_10173765 3300026023 Bacteria 1688
246 Ga0207703_10017234 3300026035 Bacteria 5637
247 Ga0207703_10075433 3300026035 Bacteria 2795
248 Ga0207703_10327780 3300026035 Bacteria 1404
249 Ga0207703_10329528 3300026035 Bacteria 1400
250 Ga0207639_10070621 3300026041 Bacteria 2728
251 Ga0207639_10086927 3300026041 Bacteria 2491
252 Ga0207639_10163455 3300026041 Bacteria 1878
253 Ga0207639_10217123 3300026041 Bacteria 1649
254 Ga0207708_10046024 3300026075 Bacteria 3324
255 Ga0207702_10025222 3300026078 Bacteria 4933
256 Ga0207702_10082655 3300026078 Bacteria 2793
257 Ga0207702_10209778 3300026078 Bacteria 1810
258 Ga0207641_10000800 3300026088 Bacteria 33612
259 Ga0207648_10010367 3300026089 Bacteria 8838
260 Ga0207648_10019061 3300026089 Bacteria 6195
261 Ga0207648_10063107 3300026089 Bacteria 3230
262 Ga0207648_10120559 3300026089 Bacteria 2306
263 Ga0207676_10031424 3300026095 Bacteria 3994
264 Ga0207676_10114014 3300026095 Bacteria 2267
265 Ga0207676_10271288 3300026095 Bacteria 1536
266 Ga0207675_100001911 3300026118 Bacteria 20781
267 Ga0207675_100041815 3300026118 Bacteria 4279
268 Ga0207675_100070543 3300026118 Bacteria 3266
269 Ga0207675_100073590 3300026118 Bacteria 3197
270 Ga0207683_10068284 3300026121 Bacteria 3138
271 Ga0207683_10099574 3300026121 Bacteria 2594
272 Ga0207683_10141351 3300026121 Bacteria 2169
273 Ga0207698_10003064 3300026142 Bacteria 10016
274 Ga0209281_1000044 3300027111 Bacteria 336476
275 Ga0209281_1004062 3300027111 Bacteria 4518
276 Ga0209281_1004144 3300027111 Bacteria 4437
277 Ga0207428_10020616 3300027907 Bacteria 5596
278 Ga0207428_10077275 3300027907 Bacteria 2606
279 Ga0268266_10006217 3300028379 Bacteria 10968
280 Ga0268266_10079321 3300028379 Bacteria 2858
281 Ga0268266_10131137 3300028379 Bacteria 2242
282 Ga0268265_10023800 3300028380 Bacteria 4323
283 Ga0268265_10167231 3300028380 Bacteria 1875
284 Ga0268264_10116899 3300028381 Bacteria 2345
285 Ga0268264_10131059 3300028381 Bacteria 2223
286 Ga0265319_1000119 3300028563 Bacteria 59920
287 Ga0265319_1007549 3300028563 Bacteria 4871
288 Ga0265318_10003152 3300028577 Bacteria 8435
289 Ga0265318_10003979 3300028577 Bacteria 7273
290 Ga0265318_10018888 3300028577 Bacteria 2804
291 Ga0265336_10009828 3300028666 Bacteria 3295
292 Ga0265338_10000759 3300028800 Bacteria 55072
293 Ga0265338_10010518 3300028800 Bacteria 10825
294 Ga0265338_10066470 3300028800 Unclassified 3120
295 Ga0265338_10101796 3300028800 Bacteria 2338
296 Ga0265330_10014766 3300031235 Bacteria 3622
297 Ga0265330_10035920 3300031235 Bacteria 2210
298 Ga0265328_10040026 3300031239 Bacteria 1728
299 Ga0265320_10071065 3300031240 Bacteria 1640
300 Ga0265325_10001358 3300031241 Bacteria 17326
301 Ga0265325_10006412 3300031241 Bacteria 7136
302 Ga0265325_10079841 3300031241 Bacteria 1628
303 Ga0265329_10038068 3300031242 Unclassified 1548
304 Ga0265340_10025406 3300031247 Bacteria 3000
305 Ga0265339_10000443 3300031249 Bacteria 32418
306 Ga0265339_10008925 3300031249 Bacteria 6343
307 Ga0265339_10046581 3300031249 Bacteria 2382
308 Ga0265331_10004971 3300031250 Bacteria 8166
309 Ga0265331_10037430 3300031250 Bacteria 2376
310 Ga0265316_10040972 3300031344 Bacteria 3711
311 Ga0265316_10048273 3300031344 Bacteria 3362
312 Ga0265316_10074870 3300031344 Bacteria 2604
313 Ga0265313_10000048 3300031595 Bacteria 112723
314 Ga0265313_10025588 3300031595 Bacteria 3122
315 Ga0307508_10000081 3300031616 Bacteria 112337
316 Ga0316579_10037790 3300031691 Bacteria 2231
317 Ga0265314_10000151 3300031711 Bacteria 104088
318 Ga0265314_10004146 3300031711 Bacteria 13643
319 Ga0265314_10005081 3300031711 Bacteria 11991
320 Ga0265314_10014008 3300031711 Bacteria 6446
321 Ga0265342_10036949 3300031712 Bacteria 2981
322 Ga0316577_10079718 3300031733 Bacteria 1830
323 Ga0307413_10094743 3300031824 Bacteria 1955
324 Ga0307410_10196598 3300031852 Bacteria 1537
325 Ga0307406_10072128 3300031901 Bacteria 2266
326 Ga0307414_10007590 3300032004 Bacteria 6100
327 Ga0307414_10063601 3300032004 Bacteria 2623
328 Ga0307414_10153230 3300032004 Bacteria 1821
329 Ga0373948_0002279 3300034817 Bacteria 2809
330 Ga0373959_0001464 3300034820 Bacteria 3770
331 Ga0373938_0000524 3300034957 Bacteria 6232
332 Ga0373928_0003196 3300035084 Bacteria 3137
333 Ga0373940_0005545 3300035088 Bacteria 2741
334 Ga0373949_0006935 3300035090 Bacteria 2486
335 Ga0373952_0000806 3300035092 Bacteria 5635
336 Ga0373932_0009485 3300035112 Bacteria 2340
337 Ga0373939_0000138 3300035114 Bacteria 20969
338 Ga0373941_0000086 3300035115 Bacteria 15129
339 Ga0373945_0036403 3300035116 Bacteria 1763
340 Ga0373960_0013261 3300035121 Bacteria 2064
341 Ga0373943_0032446 3300035170 Bacteria 2483
342 Ga0373946_0002510 3300035171 Bacteria 6481
343 Ga0373955_0028344 3300035172 Bacteria 2902
344 Ga0373942_0001119 3300035207 Bacteria 7120
345 Ga0373961_0003511 3300035241 Bacteria 3874
346 Ga0316574_0098094 3300035398 Bacteria 1874
347 Ga0373924_0031147 3300035410 Bacteria 2143
348 Ga0373931_0002913 3300035691 Bacteria 7634
349 Ga0373935_0013038 3300035692 Bacteria 5012
350 Ga0373947_0003639 3300035725 Bacteria 9092
351 Ga0373937_0038789 3300036401 Bacteria 4341
352 Ga0373937_0084954 3300036401 Bacteria 2929
353 Ga0316584_0088429 3300036712 Bacteria 2320
354 Ga0316584_0088675 3300036712 Bacteria 2316
355 Ga0373925_0040372 3300037068 Bacteria 3455
356 Ga0373925_0092849 3300037068 Bacteria 2309
357 Ga0395900_0044351 3300037418 Bacteria 4582
358 Ga0395900_0069635 3300037418 Bacteria 3616
359 Ga0316581_0029424 3300037588 Bacteria 1650
360 Ga0395901_0028465 3300038443 Bacteria 5746
361 Ga0395901_0230214 3300038443 Bacteria 1935
362 Ga0400489_37695 3300039093 Bacteria 8355
363 Ga0453683_0000599 3300044673 Bacteria 39641
364 Ga0453683_0067773 3300044673 Bacteria 2230
365 Ga0466963_0063022 3300044694 Bacteria 2481
366 Ga0453684_0011234 3300044712 Bacteria 15072
367 Ga0466957_0085015 3300044842 Bacteria 1975
368 Ga0451576_0006905 3300045051 Bacteria 13748
369 Ga0451576_0010342 3300045051 Bacteria 10713
370 Ga0451576_0044917 3300045051 Bacteria 4655
371 Ga0466967_0010175 3300045976 Bacteria 7036
372 Ga0466967_0144461 3300045976 Bacteria 2218
373 Ga0466967_0180128 3300045976 Bacteria 1993
374 Ga0495592_0010699 3300046454 Bacteria 6917
375 Ga0495592_0042052 3300046454 Bacteria 3423
376 Ga0495629_0058517 3300046459 Bacteria 2695
377 Ga0495580_0015736 3300046472 Bacteria 5700
378 Ga0495664_0086873 3300046477 Bacteria 1879
379 Ga0495620_0013506 3300046515 Bacteria 4178
380 Ga0495630_0008621 3300046517 Bacteria 7318
381 Ga0495630_0112089 3300046517 Bacteria 2066
382 Ga0495587_0083785 3300046536 Bacteria 1847
383 Ga0495645_0056973 3300046543 Bacteria 2837
384 Ga0495645_0156966 3300046543 Bacteria 1576
385 Ga0495667_0122974 3300046559 Bacteria 1675
386 Ga0495634_0069323 3300046642 Bacteria 2327
387 Ga0495647_0025835 3300046681 Bacteria 2148
388 Ga0495658_0035211 3300046683 Bacteria 2753
389 Ga0495669_0005533 3300046684 Bacteria 5270
390 Ga0495613_0007802 3300046689 Bacteria 7964
391 Ga0495613_0010064 3300046689 Bacteria 7025
392 Ga0495624_0133916 3300046690 Bacteria 1519
393 Ga0495660_0045040 3300046810 Bacteria 2424
394 Ga0495660_0119489 3300046810 Bacteria 1335
395 Ga0495604_0043994 3300047317 Bacteria 3492
396 Ga0495672_0013263 3300047320 Bacteria 5692
397 Ga0495684_0007786 3300047471 Bacteria 8293
398 Ga0496101_0018138 3300048904 Bacteria 4780
399 Ga0496101_0274556 3300048904 Bacteria 1316
400 Ga0496102_0009516 3300048905 Bacteria 8355
401 Ga0496102_0053592 3300048905 Bacteria 3676
402 Ga0496103_0085576 3300048906 Bacteria 1987
403 Ga0496104_0017500 3300048907 Bacteria 6528
404 Ga0496104_0048538 3300048907 Bacteria 4002
405 Ga0496104_0153598 3300048907 Bacteria 2209
406 Ga0496104_0227396 3300048907 Bacteria 1778
407 Ga0496105_0022883 3300048908 Bacteria 5065
408 Ga0496106_0005177 3300048909 Bacteria 9660
409 Ga0496106_0132848 3300048909 Bacteria 1953
410 Ga0496107_0022626 3300048910 Bacteria 4442
411 Ga0496107_0028285 3300048910 Bacteria 3982
412 Ga0496108_0017969 3300048911 Bacteria 5786
413 Ga0496109_0059155 3300048912 Bacteria 3501
414 Ga0496109_0140061 3300048912 Bacteria 2262
415 Ga0496110_0279872 3300048913 Bacteria 1519
416 Ga0496111_0175210 3300048914 Bacteria 1594
417 Ga0496112_0008069 3300048915 Bacteria 9399
418 Ga0496112_0250742 3300048915 Bacteria 1721
419 Ga0496114_0034480 3300048917 Bacteria 4176
420 Ga0496114_0198752 3300048917 Bacteria 1756
421 Ga0496115_0058585 3300048918 Bacteria 3099
422 Ga0496116_0013500 3300048919 Bacteria 6579
423 Ga0496116_0064559 3300048919 Bacteria 2353
424 Ga0496117_0005507 3300048920 Bacteria 13260
425 Ga0496121_0101192 3300048924 Bacteria 2223
426 Ga0496123_0000975 3300048926 Bacteria 44171
427 Ga0496125_0000115 3300048928 Bacteria 181994
428 Ga0496126_0001686 3300048929 Bacteria 32954
429 Ga0496126_0005744 3300048929 Bacteria 14040
430 Ga0501031_0005843 3300049568 Bacteria 8017
431 Ga0501033_0013018 3300049570 Bacteria 6343
432 Ga0501034_0000732 3300049571 Bacteria 49733
433 Ga0501034_0016548 3300049571 Bacteria 7561
434 Ga0501034_0018696 3300049571 Bacteria 7102
435 Ga0501034_0044169 3300049571 Bacteria 4507
436 Ga0501034_0114021 3300049571 Bacteria 2692
437 Ga0501034_0269607 3300049571 Bacteria 1644
438 Ga0501037_0042958 3300049573 Bacteria 3322
439 Ga0501038_0009068 3300049574 Bacteria 9133
440 Ga0501039_0183483 3300049575 Bacteria 1645
441 Ga0501043_0099844 3300049579 Bacteria 2281
442 Ga0501043_0118004 3300049579 Bacteria 2082
443 Ga0501043_0206909 3300049579 Bacteria 1521
444 Ga0501046_0269493 3300049580 Bacteria 1249
445 Ga0501047_0009651 3300049581 Bacteria 9122
446 Ga0501047_0036664 3300049581 Bacteria 4740
447 Ga0501047_0077614 3300049581 Bacteria 3194
448 Ga0501047_0098027 3300049581 Bacteria 2810
449 Ga0501068_0113508 3300049584 Bacteria 1686
450 Ga0501069_0035166 3300049585 Bacteria 2759
451 Ga0501070_0002853 3300049586 Bacteria 15068
452 Ga0501070_0008679 3300049586 Bacteria 8589
453 Ga0501070_0137277 3300049586 Bacteria 2019
454 Ga0501073_0016343 3300049589 Bacteria 5379
455 Ga0501080_0035231 3300049742 Bacteria 4672
456 Ga0501035_0126009 3300049822 Bacteria 2235
457 Ga0501044_0004984 3300049823 Bacteria 14843
458 Ga0501044_0135622 3300049823 Bacteria 2453
459 Ga0501044_0154766 3300049823 Bacteria 2272
460 Ga0501044_0277390 3300049823 Bacteria 1611
461 nmdc:mga03683_1256_c1 3300050489 Bacteria 7514
462 nmdc:mga03683_1576_c1 3300050489 Bacteria 6498
463 nmdc:mga07m45_31693_c1 3300050496 Bacteria 2930
464 nmdc:mga07m45_69433_c1 3300050496 Bacteria 2003
465 nmdc:mga05p37_171059_c1 3300050507 Bacteria 2649
466 nmdc:mga05p37_17535_c1 3300050507 Bacteria 8643
467 nmdc:mga05p37_235895_c1 3300050507 Bacteria 2202
468 nmdc:mga05p37_241499_c1 3300050507 Bacteria 2172
469 nmdc:mga05p37_56333_c1 3300050507 Bacteria 4839
470 nmdc:mga05p37_833_c1 3300050507 Bacteria 34555
471 nmdc:mga06r32_2140_c1 3300050510 Bacteria 17651
472 nmdc:mga08y16_26597_c1 3300050511 Bacteria 6099
473 nmdc:mga08y16_274226_c1 3300050511 Bacteria 1741
474 nmdc:mga08y16_66355_c1 3300050511 Bacteria 3766
475 nmdc:mga08y16_84532_c1 3300050511 Bacteria 3308
476 nmdc:mga0n895_117025_c1 3300050512 Bacteria 2684
477 nmdc:mga0n895_156628_c1 3300050512 Bacteria 2309
478 nmdc:mga0n895_165085_c1 3300050512 Bacteria 2246
479 nmdc:mga0n895_209602_c1 3300050512 Bacteria 1979
480 nmdc:mga0n895_41770_c1 3300050512 Bacteria 4459
481 nmdc:mga0rr50_13287_c1 3300050513 Bacteria 5355
482 nmdc:mga0rr50_1728_c1 3300050513 Bacteria 12046
483 nmdc:mga0rr50_4_c1 3300050513 Bacteria 338870
484 nmdc:mga0rr50_53362_c1 3300050513 Bacteria 3007
485 nmdc:mga0rr50_7604_c1 3300050513 Bacteria 6698
486 nmdc:mga08x19_5253_c1 3300050514 Bacteria 7664
487 nmdc:mga08x19_61102_c1 3300050514 Bacteria 2442
488 nmdc:mga0a205_21464_c1 3300050515 Bacteria 6108
489 nmdc:mga0a205_3926_c2 3300050515 Bacteria 4182
490 Ga0495601_0045374 3300053077 Bacteria 2763
491 Ga0495619_0000600 3300053085 Bacteria 23899
492 Ga0500604_0000693 3300053151 Bacteria 9230
493 Ga0500634_0000034 3300053161 Bacteria 74144
494 Ga0501084_0003488 3300054114 Bacteria 12782
495 Ga0501082_0173524 3300060353 Bacteria 1875
496 2524191142 2524023129 Bacteria 6762600
497 2550902334 2548877040 Bacteria 7507281
498 2556062859 2554235469 Bacteria 3590176
499 2563927512 2563366752 Bacteria 4961801
500 2573037925 2571042588 Bacteria 5045676
501 2573037926 2571042588 Bacteria 5045676
502 2578336867 2576861424 Bacteria 5270569
503 2578336971 2576861424 Bacteria 5270569
504 2578336972 2576861424 Bacteria 5270569
505 2580930820 2579778775 Bacteria 5360914
506 2580930821 2579778775 Bacteria 5360914
507 2587744396 2585428059 Bacteria 8696589
508 2595089802 2593339131 Bacteria 5116855
509 2621275069 2619619294 Bacteria 5575484
510 2621275214 2619619294 Bacteria 5575484
511 2621275215 2619619294 Bacteria 5575484
512 2643812580 2643221558 Bacteria 5460675
513 2643912700 2643221580 Bacteria 3816678
514 2643966212 2643221591 Bacteria 4397626
515 2644413297 2643221674 Bacteria 3919126
516 2644422801 2643221676 Bacteria 8119172
517 2657682840 2657244999 Bacteria 5946535
518 2712198052 2711768088 Bacteria 3195027
519 2739270918 2738543017 Bacteria 4271950
520 2757568306 2757320391 Bacteria 4746095
521 2777762617 2775507177 Bacteria 4384303
522 2777839738 2775507192 Bacteria 4622234
523 2792621033 2791355091 Bacteria 6135441
524 2792625248 2791355092 Bacteria 6248105
525 2804754060 2802429268 Bacteria 6094027
526 2819674200 2818991459 Bacteria 8736032
527 2855877829 2855872281 Bacteria 6964271
528 2857457629 2857453340 Bacteria 8090534
529 2857463326 2857460504 Bacteria 5194327
530 2857474404 2857472729 Bacteria 6568124
531 2857590839 2857586860 Bacteria 4354574
532 2864998565 2864997549 Bacteria 5139696
533 2881637736 2881636855 Bacteria 5205297
534 2881637737 2881636855 Bacteria 5205297
535 2881637870 2881636855 Bacteria 5205297
536 2889298663 2889295896 Bacteria 4704906
537 2891051035 2891048133 Bacteria 4447501
538 2904762531 2904755435 Bacteria 7986759
539 2907202586 2907202186 Bacteria 6632024
540 2907206515 2907202186 Bacteria 6632024
541 2919432674 2919425241 Bacteria 8055701
542 2925327305 2925326138 Bacteria 9652120
543 2929210011 2929206907 Bacteria 5918291
544 2932404854 2932401849 Bacteria 4262978
545 2936340873 2936340661 Bacteria 5139038
546 2938655458 2938649242 Bacteria 7118381
547 2968559620 2968558590 Bacteria 6956864
548 2971404190 2971403814 Bacteria 7370929
549 2971413593 2971410472 Bacteria 8311090
550 2971515471 2971511577 Bacteria 5404012
551 2971516379 2971511577 Bacteria 5404012
552 2971516380 2971511577 Bacteria 5404012
553 2980130912 2980125574 Bacteria 5567337
554 2980179853 2980176882 Bacteria 5397533
555 2980179854 2980176882 Bacteria 5397533
556 2980179973 2980176882 Bacteria 5397533
557 2981288300 2981284811 Bacteria 4641497
558 2981293121 2981289755 Bacteria 4641509
559 2981983738 2981980479 Bacteria 4641628
560 2981988657 2981985349 Bacteria 4641497
561 2988229550 2988225383 Bacteria 7221625
562 2995395298 2995392953 Bacteria 4539380
563 2996634645 2996632988 Bacteria 6921523
564 3006982797 3006978542 Bacteria 5328100
565 641336331 641228493 Bacteria 3999591
566 643390153 643348555 Bacteria 3914947
567 8018152637 8018150411 Bacteria 5549903
568 8054797885 8054795415 Bacteria 9785225
569 8056536764 8056533031 Bacteria 8964429
570 8057734523 8057733483 Bacteria 6578323
571 Ga0070697_100053677
572 JGI25158J39367_1005003
573 JGI25151J46595_10001364
574 rootH1_10163537
575 rootH2_10211470
576 rootL2_10100166
577 Ga0055538_1000388
578 Ga0055532_1001235
579 Ga0055541_1004110
580 Ga0065712_10105337
581 Ga0070658_10002700
582 Ga0070658_10016683
583 Ga0070658_10104795
584 Ga0070676_10064532
585 Ga0070683_100000408
586 Ga0070690_100094236
587 Ga0070670_100040669
588 Ga0070670_100063054
589 Ga0070666_10009883
590 Ga0070666_10013672
591 Ga0070666_10138320
592 Ga0070680_100002781
593 Ga0070680_100112496
594 Ga0070660_100023825
595 Ga0070660_100076440
596 Ga0070691_10017267
597 Ga0070661_100028317
598 Ga0070661_100050975
599 Ga0070661_100055639
600 Ga0070692_10036220
601 Ga0070669_100026686
602 Ga0070669_100136479
603 Ga0070675_100000723
604 Ga0070675_100107301
605 Ga0070671_100025615
606 Ga0070674_100003928
607 Ga0070673_100117404
608 Ga0070667_100063729
609 Ga0070709_10013151
610 Ga0070713_100125030
611 Ga0070713_100128599
612 Ga0070701_10031913
613 Ga0070705_100029638
614 Ga0070694_100025207
615 Ga0070678_100078208
616 Ga0070662_100103200
617 Ga0070681_10084533
618 Ga0070681_10094911
619 Ga0070681_10161145
620 Ga0070681_10161483
621 Ga0068867_100040887
622 Ga0068867_100066946
623 Ga0070707_100019468
624 Ga0070707_100207459
625 Ga0070698_100023284
626 Ga0070699_100070903
627 Ga0070679_100044362
628 Ga0070679_100075340
629 Ga0070679_100103116
630 Ga0070679_100214166
631 Ga0070684_100024426
632 Ga0070697_100172558
633 Ga0070672_100031271
634 Ga0070686_100004656
635 Ga0070695_100004738
636 Ga0070695_100008373
637 Ga0070696_100044300
638 Ga0070696_100049657
639 Ga0070665_100008458
640 Ga0070665_100012037
641 Ga0070665_100034730
642 Ga0070665_100241037
643 Ga0070704_100028762
644 Ga0070704_100076772
645 Ga0070704_100121446
646 Ga0068855_100018979
647 Ga0068855_100046325
648 Ga0068855_100083778
649 Ga0068855_100185514
650 Ga0068857_100131867
651 Ga0068854_100004621
652 Ga0068854_100021077
653 Ga0068854_100082000
654 Ga0070702_100043414
655 Ga0068852_100008783
656 Ga0068852_100057974
657 Ga0068859_100038669
658 Ga0068859_100238690
659 Ga0068864_100012070
660 Ga0068864_100054122
661 Ga0068866_10063029
662 Ga0068861_100064209
663 Ga0068851_10024226
664 Ga0068851_10069462
665 Ga0068863_100013317
666 Ga0068863_100141866
667 Ga0068858_100020037
668 Ga0068858_100048818
669 Ga0068860_100094083
670 Ga0068862_100242007
671 Ga0075432_10031343
672 Ga0070715_10011756
673 Ga0070712_100277666
674 Ga0097621_100000636
675 Ga0097621_100007637
676 Ga0097621_100010700
677 Ga0097621_100029014
678 Ga0097621_100339956
679 Ga0075370_10004356
680 Ga0068871_100003144
681 Ga0068871_100021412
682 Ga0075428_100122569
683 Ga0075430_100067710
684 Ga0075431_100064905
685 Ga0075434_100005437
686 Ga0075434_100007466
687 Ga0075434_100085896
688 Ga0075434_100151916
689 Ga0068865_100022654
690 Ga0075436_100001995
691 Ga0075436_100007102
692 Ga0097620_100038667
693 Ga0097620_100186886
694 Ga0097620_100238686
695 Ga0079104_1000411
696 Ga0079104_1004458
697 Ga0075435_100000051
698 Ga0075435_100001570
699 Ga0075435_100005824
700 Ga0075435_100006302
701 Ga0075435_100013820
702 Ga0075435_100018480
703 Ga0105244_10013856
704 Ga0105244_10034660
705 Ga0105240_10018245
706 Ga0105240_10020011
707 Ga0105240_10182836
708 Ga0105240_10472036
709 Ga0111539_10005672
710 Ga0111539_10058466
711 Ga0105245_10034818
712 Ga0105247_10167699
713 Ga0114129_10000418
714 Ga0114129_10004112
715 Ga0114129_10010650
716 Ga0114129_10016408
717 Ga0114129_10153618
718 Ga0105243_10005559
719 Ga0105243_10016009
720 Ga0105243_10061794
721 Ga0105241_10000021
722 Ga0105241_10025773
723 Ga0105242_10085442
724 Ga0105242_10112785
725 Ga0105248_10001563
726 Ga0105248_10036662
727 Ga0105248_10154636
728 Ga0105248_10198576
729 Ga0105237_10105825
730 Ga0105237_10145877
731 Ga0105238_10014829
732 Ga0105238_10033055
733 Ga0105238_10088558
734 Ga0105239_10004242
735 Ga0105239_10213150
736 Ga0105239_10264207
737 Ga0105246_10122890
738 Ga0157370_10041224
739 Ga0157370_10315730
740 Ga0157369_10001766
741 Ga0157369_10163779
742 Ga0157374_10044282
743 Ga0157374_10080820
744 Ga0157374_10267770
745 Ga0157378_10047109
746 Ga0157378_10383968
747 Ga0163162_10022431
748 Ga0157375_10049682
749 Ga0157375_10069505
750 Ga0163163_10012303
751 Ga0163163_10030374
752 Ga0157379_10105697
753 Ga0157376_10022170
754 Ga0157376_10091065
755 Ga0209784_102072
756 Ga0209566_100046
757 Ga0209147_100296
758 Ga0209675_1002882
759 Ga0209676_1001290
760 Ga0209025_1000219
761 Ga0209025_1006217
762 Ga0207642_10050917
763 Ga0207710_10087574
764 Ga0207680_10000575
765 Ga0207699_10115213
766 Ga0207645_10052837
767 Ga0207645_10060145
768 Ga0207654_10000053
769 Ga0207654_10043155
770 Ga0207707_10080520
771 Ga0207707_10081152
772 Ga0207695_10000140
773 Ga0207695_10089091
774 Ga0207695_10137202
775 Ga0207671_10122476
776 Ga0207660_10031024
777 Ga0207662_10012255
778 Ga0207657_10003696
779 Ga0207657_10188981
780 Ga0207649_10064840
781 Ga0207649_10067830
782 Ga0207649_10189102
783 Ga0207652_10064380
784 Ga0207652_10200917
785 Ga0207646_10147821
786 Ga0207646_10150518
787 Ga0207681_10100153
788 Ga0207694_10001774
789 Ga0207694_10144724
790 Ga0207650_10225787
791 Ga0207650_10282570
792 Ga0207659_10039084
793 Ga0207687_10007960
794 Ga0207687_10051848
795 Ga0207687_10053980
796 Ga0207700_10092218
797 Ga0207706_10059143
798 Ga0207706_10115685
799 Ga0207686_10027450
800 Ga0207670_10129119
801 Ga0207704_10001510
802 Ga0207711_10041546
803 Ga0207711_10089273
804 Ga0207711_10200800
805 Ga0207689_10194451
806 Ga0207661_10151600
807 Ga0207679_10052125
808 Ga0207712_10044122
809 Ga0207668_10222552
810 Ga0207640_10004709
811 Ga0207640_10040436
812 Ga0207658_10004017
813 Ga0207658_10073035
814 Ga0207658_10078866
815 Ga0207677_10173765
816 Ga0207703_10017234
817 Ga0207703_10075433
818 Ga0207703_10327780
819 Ga0207703_10329528
820 Ga0207639_10070621
821 Ga0207639_10086927
822 Ga0207639_10163455
823 Ga0207639_10217123
824 Ga0207708_10046024
825 Ga0207702_10025222
826 Ga0207702_10082655
827 Ga0207702_10209778
828 Ga0207641_10000800
829 Ga0207648_10010367
830 Ga0207648_10019061
831 Ga0207648_10063107
832 Ga0207648_10120559
833 Ga0207676_10031424
834 Ga0207676_10114014
835 Ga0207676_10271288
836 Ga0207675_100001911
837 Ga0207675_100041815
838 Ga0207675_100070543
839 Ga0207675_100073590
840 Ga0207683_10068284
841 Ga0207683_10099574
842 Ga0207683_10141351
843 Ga0207698_10003064
844 Ga0209281_1000044
845 Ga0209281_1004062
846 Ga0209281_1004144
847 Ga0207428_10020616
848 Ga0207428_10077275
849 Ga0268266_10006217
850 Ga0268266_10079321
851 Ga0268266_10131137
852 Ga0268265_10023800
853 Ga0268265_10167231
854 Ga0268264_10116899
855 Ga0268264_10131059
856 Ga0265319_1000119
857 Ga0265319_1007549
858 Ga0265318_10003152
859 Ga0265318_10003979
860 Ga0265318_10018888
861 Ga0265336_10009828
862 Ga0265338_10000759
863 Ga0265338_10010518
864 Ga0265338_10066470
865 Ga0265338_10101796
866 Ga0265330_10014766
867 Ga0265330_10035920
868 Ga0265328_10040026
869 Ga0265320_10071065
870 Ga0265325_10001358
871 Ga0265325_10006412
872 Ga0265325_10079841
873 Ga0265329_10038068
874 Ga0265340_10025406
875 Ga0265339_10000443
876 Ga0265339_10008925
877 Ga0265339_10046581
878 Ga0265331_10004971
879 Ga0265331_10037430
880 Ga0265316_10040972
881 Ga0265316_10048273
882 Ga0265316_10074870
883 Ga0265313_10000048
884 Ga0265313_10025588
885 Ga0307508_10000081
886 Ga0316579_10037790
887 Ga0265314_10000151
888 Ga0265314_10004146
889 Ga0265314_10005081
890 Ga0265314_10014008
891 Ga0265342_10036949
892 Ga0316577_10079718
893 Ga0307413_10094743
894 Ga0307410_10196598
895 Ga0307406_10072128
896 Ga0307414_10007590
897 Ga0307414_10063601
898 Ga0307414_10153230
899 Ga0373948_0002279
900 Ga0373959_0001464
901 Ga0373938_0000524
902 Ga0373928_0003196
903 Ga0373940_0005545
904 Ga0373949_0006935
905 Ga0373952_0000806
906 Ga0373932_0009485
907 Ga0373939_0000138
908 Ga0373941_0000086
909 Ga0373945_0036403
910 Ga0373960_0013261
911 Ga0373943_0032446
912 Ga0373946_0002510
913 Ga0373955_0028344
914 Ga0373942_0001119
915 Ga0373961_0003511
916 Ga0316574_0098094
917 Ga0373924_0031147
918 Ga0373931_0002913
919 Ga0373935_0013038
920 Ga0373947_0003639
921 Ga0373937_0038789
922 Ga0373937_0084954
923 Ga0316584_0088429
924 Ga0316584_0088675
925 Ga0373925_0040372
926 Ga0373925_0092849
927 Ga0395900_0044351
928 Ga0395900_0069635
929 Ga0316581_0029424
930 Ga0395901_0028465
931 Ga0395901_0230214
932 Ga0400489_37695
933 Ga0453683_0000599
934 Ga0453683_0067773
935 Ga0466963_0063022
936 Ga0453684_0011234
937 Ga0466957_0085015
938 Ga0451576_0006905
939 Ga0451576_0010342
940 Ga0451576_0044917
941 Ga0466967_0010175
942 Ga0466967_0144461
943 Ga0466967_0180128
944 Ga0495592_0010699
945 Ga0495592_0042052
946 Ga0495629_0058517
947 Ga0495580_0015736
948 Ga0495664_0086873
949 Ga0495620_0013506
950 Ga0495630_0008621
951 Ga0495630_0112089
952 Ga0495587_0083785
953 Ga0495645_0056973
954 Ga0495645_0156966
955 Ga0495667_0122974
956 Ga0495634_0069323
957 Ga0495647_0025835
958 Ga0495658_0035211
959 Ga0495669_0005533
960 Ga0495613_0007802
961 Ga0495613_0010064
962 Ga0495624_0133916
963 Ga0495660_0045040
964 Ga0495660_0119489
965 Ga0495604_0043994
966 Ga0495672_0013263
967 Ga0495684_0007786
968 Ga0496101_0018138
969 Ga0496101_0274556
970 Ga0496102_0009516
971 Ga0496102_0053592
972 Ga0496103_0085576
973 Ga0496104_0017500
974 Ga0496104_0048538
975 Ga0496104_0153598
976 Ga0496104_0227396
977 Ga0496105_0022883
978 Ga0496106_0005177
979 Ga0496106_0132848
980 Ga0496107_0022626
981 Ga0496107_0028285
982 Ga0496108_0017969
983 Ga0496109_0059155
984 Ga0496109_0140061
985 Ga0496110_0279872
986 Ga0496111_0175210
987 Ga0496112_0008069
988 Ga0496112_0250742
989 Ga0496114_0034480
990 Ga0496114_0198752
991 Ga0496115_0058585
992 Ga0496116_0013500
993 Ga0496116_0064559
994 Ga0496117_0005507
995 Ga0496121_0101192
996 Ga0496123_0000975
997 Ga0496125_0000115
998 Ga0496126_0001686
999 Ga0496126_0005744
1000 Ga0501031_0005843
1001 Ga0501033_0013018
1002 Ga0501034_0000732
1003 Ga0501034_0016548
1004 Ga0501034_0018696
1005 Ga0501034_0044169
1006 Ga0501034_0114021
1007 Ga0501034_0269607
1008 Ga0501037_0042958
1009 Ga0501038_0009068
1010 Ga0501039_0183483
1011 Ga0501043_0099844
1012 Ga0501043_0118004
1013 Ga0501043_0206909
1014 Ga0501046_0269493
1015 Ga0501047_0009651
1016 Ga0501047_0036664
1017 Ga0501047_0077614
1018 Ga0501047_0098027
1019 Ga0501068_0113508
1020 Ga0501069_0035166
1021 Ga0501070_0002853
1022 Ga0501070_0008679
1023 Ga0501070_0137277
1024 Ga0501073_0016343
1025 Ga0501080_0035231
1026 Ga0501035_0126009
1027 Ga0501044_0004984
1028 Ga0501044_0135622
1029 Ga0501044_0154766
1030 Ga0501044_0277390
1031 nmdc:mga03683_1256_c1
1032 nmdc:mga03683_1576_c1
1033 nmdc:mga07m45_31693_c1
1034 nmdc:mga07m45_69433_c1
1035 nmdc:mga05p37_171059_c1
1036 nmdc:mga05p37_17535_c1
1037 nmdc:mga05p37_235895_c1
1038 nmdc:mga05p37_241499_c1
1039 nmdc:mga05p37_56333_c1
1040 nmdc:mga05p37_833_c1
1041 nmdc:mga06r32_2140_c1
1042 nmdc:mga08y16_26597_c1
1043 nmdc:mga08y16_274226_c1
1044 nmdc:mga08y16_66355_c1
1045 nmdc:mga08y16_84532_c1
1046 nmdc:mga0n895_117025_c1
1047 nmdc:mga0n895_156628_c1
1048 nmdc:mga0n895_165085_c1
1049 nmdc:mga0n895_209602_c1
1050 nmdc:mga0n895_41770_c1
1051 nmdc:mga0rr50_13287_c1
1052 nmdc:mga0rr50_1728_c1
1053 nmdc:mga0rr50_4_c1
1054 nmdc:mga0rr50_53362_c1
1055 nmdc:mga0rr50_7604_c1
1056 nmdc:mga08x19_5253_c1
1057 nmdc:mga08x19_61102_c1
1058 nmdc:mga0a205_21464_c1
1059 nmdc:mga0a205_3926_c2
1060 Ga0495601_0045374
1061 Ga0495619_0000600
1062 Ga0500604_0000693
1063 Ga0500634_0000034
1064 Ga0501084_0003488
1065 Ga0501082_0173524
1066 2524191142
1067 2550902334
1068 2556062859
1069 2563927512
1070 2573037925
1071 2573037926
1072 2578336867
1073 2578336971
1074 2578336972
1075 2580930820
1076 2580930821
1077 2587744396
1078 2595089802
1079 2621275069
1080 2621275214
1081 2621275215
1082 2643812580
1083 2643912700
1084 2643966212
1085 2644413297
1086 2644422801
1087 2657682840
1088 2712198052
1089 2739270918
1090 2757568306
1091 2777762617
1092 2777839738
1093 2792621033
1094 2792625248
1095 2804754060
1096 2819674200
1097 2855877829
1098 2857457629
1099 2857463326
1100 2857474404
1101 2857590839
1102 2864998565
1103 2881637736
1104 2881637737
1105 2881637870
1106 2889298663
1107 2891051035
1108 2904762531
1109 2907202586
1110 2907206515
1111 2919432674
1112 2925327305
1113 2929210011
1114 2932404854
1115 2936340873
1116 2938655458
1117 2968559620
1118 2971404190
1119 2971413593
1120 2971515471
1121 2971516379
1122 2971516380
1123 2980130912
1124 2980179853
1125 2980179854
1126 2980179973
1127 2981288300
1128 2981293121
1129 2981983738
1130 2981988657
1131 2988229550
1132 2995395298
1133 2996634645
1134 3006982797
1135 641336331
1136 643390153
1137 8018152637
1138 8054797885
1139 8056536764
1140 8057734523

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02073

Peptidase_M29

Thermophilic metalloprotease (M29)

64

475

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1zjc-assembly1.cif.gz_A-2 aminopeptidase s from s. aureus 0.9085 15 383
2ayi-assembly1.cif.gz_A wild-type ampt from thermus thermophilus 0.9006 15 383
4icq-assembly1.cif.gz_B structural basis for substrate recognition and reaction mechanism of bacterial aminopeptidase peps 0.894 13 383
4ics-assembly1.cif.gz_B crystal structure of peps from streptococcus pneumoniae in complex with a substrate 0.8924 15 383
1zjc-assembly1.cif.gz_A-2 aminopeptidase s from s. aureus 0.8741 15 383
ID Description Score Start End Superfamily
af_P46846_104_226_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8643 32 67 3.40.50.2020
4icsB01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.8332 15 154 3.40.1830.10
1zjcA01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.818 15 154 3.40.1830.10
2ayiA01 Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) 0.8094 15 151 3.40.1830.10
af_Q2G056_117_224_3.40.50.2020 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7911 32 67 3.40.50.2020
ID Description Score Start End GO Terms
AF-A0A526YI52-F1-model_v4 Aminopeptidase 0.9993 140 285 GO:0004177
GO:0006508
GO:0046872
AF-A0A531M5R0-F1-model_v4 Aminopeptidase 0.9989 145 314 GO:0004177
GO:0006508
GO:0046872
AF-A0A243VCH4-F1-model_v4 deleted 0.9973 236 324
AF-A0A3C0SU46-F1-model_v4 Aminopeptidase 0.9948 222 296 GO:0004177
GO:0006508
GO:0046872
AF-A0A436W773-F1-model_v4 Aminopeptidase 0.994 123 383 GO:0004177
GO:0006508
GO:0046872

Map