F464922
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 571 | 344 | 1140 | 414 |
Family's Representative Sequence
| Representative Sequence | 3300005536|Ga0070697_100053677|Ga0070697_1000536772 |
| Length | 476 |
| Sequence | LKEPVARGFQRPGVPTASAKATAVRRRPMRSRKEAADAILATRSLADAAARSVDYNSARMPIDFETTLRNYADLTVAVGLNLQPDQRLLIIGPVANGGVSLEAAPLVREVTAAAYRRGARLVETLWGDEGLLAARLQYAPRDSFDEFSAWLPGALVQHVEGGHAVLSIYANDPDQLKDAPQDLVGVVQQTTARAVRPFREYISRNQTNWGVVAAGAASWAARVFPGVEPSQQLARLWDAIVCLCRLDRPDPIAAWESHLADLAARTEHLNAKQYSALRYRGPGTDLTIGLPPGHIWVGGRSTNAAGIRFAPNLPTEEVFTMPHKDRVDGVVRSTKPLSYGGTLIEGFTLRFAQGRVLEVTAERNQSVLERLVRMDPGAARLGEIALVPHSSPVAQTGVLFYNTLFDENAASHVALGAAYKFTMRGGEAMSDEDFEQVGGNRSATHVDFMIGSAELDVHGVRPDGAVEPVMRAGEWI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 2 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 7 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 8 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 9 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 50 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 51 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 53 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 54 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 55 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 56 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 57 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 58 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 59 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 60 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 61 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 62 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 63 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 71 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 76 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 77 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 104 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 157 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 158 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 159 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 160 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 161 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 162 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 163 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 167 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 170 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 171 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 172 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 173 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 176 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 177 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 178 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 179 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 180 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 181 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 183 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 184 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 185 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 187 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 192 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 194 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 195 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 196 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 197 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 204 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 207 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 208 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 209 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 210 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 211 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 212 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 213 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 234 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 235 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 236 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 237 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 238 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 239 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 241 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 242 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 243 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 244 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 247 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 248 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 249 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 250 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 251 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 256 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 257 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 258 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 259 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 270 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 280 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 281 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 282 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 283 | 2524023129 | Paenibacillus pinihumi DSM 23905 | Isolate | Rhizosphere |
| 284 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 285 | 2554235469 | Sporolactobacillus laevolacticus DSM 442 | Isolate | Rhizosphere |
| 286 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 287 | 2571042588 | Paenibacillus zanthoxyli JH29 | Isolate | Unclassified |
| 288 | 2576861424 | Paenibacillus sabinae T27 | Isolate | Rhizosphere |
| 289 | 2579778775 | Paenibacillus durus P3L-5 | Isolate | Unclassified |
| 290 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 291 | 2593339131 | Bacillus sp. UNCCL81 | Isolate | Unclassified |
| 292 | 2619619294 | Paenibacillus durus ATCC 35681 | Isolate | Unclassified |
| 293 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 294 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 295 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 296 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 297 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 298 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 299 | 2711768088 | Sporolactobacillus terrae DSM 11697 | Isolate | Rhizosphere |
| 300 | 2738543017 | Bacillus sp. OV186 | Isolate | Unclassified |
| 301 | 2757320391 | Bacillus sp. NFR08 | Isolate | Rhizoplane |
| 302 | 2775507177 | Bacillus sp. AFS055030 | Isolate | Unclassified |
| 303 | 2775507192 | Bacillus sp. AFS041924 | Isolate | Unclassified |
| 304 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 305 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 306 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 307 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 308 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 309 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 310 | 2857460504 | Brevibacillus sp. R-74223 | Isolate | Unclassified |
| 311 | 2857472729 | Cohnella sp. R-74144 | Isolate | Unclassified |
| 312 | 2857586860 | Bacillus sp. R-71935 | Isolate | Unclassified |
| 313 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 314 | 2881636855 | Paenibacillus sp. 7197 | Isolate | Rhizosphere |
| 315 | 2889295896 | Paenibacillus sp. PvR098 | Isolate | Rhizosphere |
| 316 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 317 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 318 | 2907202186 | Paenibacillus sp. HJL G12 | Isolate | Unclassified |
| 319 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 320 | 2925326138 | Paenibacillus hemerocallicola KCTC 33185 | Isolate | Unclassified |
| 321 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 322 | 2932401849 | Devosia sp. 2618 | Isolate | Rhizosphere |
| 323 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 324 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 325 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 326 | 2971403814 | Paenibacillus tritici LMG 29502 | Isolate | Unclassified |
| 327 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 328 | 2971511577 | Paenibacillus apii 7124 | Isolate | Rhizosphere |
| 329 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 330 | 2980176882 | Paenibacillus apii 7028 | Isolate | Rhizosphere |
| 331 | 2981284811 | Paenibacillus sp. PvR052 | Isolate | Rhizosphere |
| 332 | 2981289755 | Paenibacillus sp. PvR148 | Isolate | Rhizosphere |
| 333 | 2981980479 | Paenibacillus sp. PvR018 | Isolate | Rhizosphere |
| 334 | 2981985349 | Paenibacillus sp. PvR053 | Isolate | Rhizosphere |
| 335 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 336 | 2995392953 | Martelella limonii NBRC 109441 | Isolate | Unclassified |
| 337 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 338 | 3006978542 | Bacillus sp. FJAT-49705 | Isolate | Rhizosphere |
| 339 | 641228493 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 340 | 643348555 | Gluconacetobacter diazotrophicus PA1 5 | Isolate | Unclassified |
| 341 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 342 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 343 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 344 | 8057733483 | Paenibacillus apiarius MW-14 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.87 |
| Metatranscriptomes | 0 |
| Isolates | 13.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.5 |
| Nodule | 1.58 |
| Rhizoplane | 4.38 |
| Rhizosphere | 82.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.23 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070697_100053677 | 3300005536 | Bacteria | 3276 |
| 2 | JGI25158J39367_1005003 | 3300002739 | Bacteria | 1958 |
| 3 | JGI25151J46595_10001364 | 3300003187 | Bacteria | 16891 |
| 4 | rootH1_10163537 | 3300003316 | Unclassified | 1955 |
| 5 | rootH2_10211470 | 3300003320 | Bacteria | 1530 |
| 6 | rootL2_10100166 | 3300003322 | Bacteria | 3139 |
| 7 | Ga0055538_1000388 | 3300003751 | Bacteria | 17959 |
| 8 | Ga0055532_1001235 | 3300003758 | Bacteria | 7547 |
| 9 | Ga0055541_1004110 | 3300003841 | Bacteria | 2672 |
| 10 | Ga0065712_10105337 | 3300005290 | Bacteria | 1942 |
| 11 | Ga0070658_10002700 | 3300005327 | Bacteria | 14759 |
| 12 | Ga0070658_10016683 | 3300005327 | Bacteria | 5878 |
| 13 | Ga0070658_10104795 | 3300005327 | Bacteria | 2340 |
| 14 | Ga0070676_10064532 | 3300005328 | Bacteria | 2184 |
| 15 | Ga0070683_100000408 | 3300005329 | Bacteria | 29693 |
| 16 | Ga0070690_100094236 | 3300005330 | Bacteria | 1976 |
| 17 | Ga0070670_100040669 | 3300005331 | Bacteria | 3996 |
| 18 | Ga0070670_100063054 | 3300005331 | Unclassified | 3181 |
| 19 | Ga0070666_10009883 | 3300005335 | Bacteria | 5957 |
| 20 | Ga0070666_10013672 | 3300005335 | Bacteria | 5152 |
| 21 | Ga0070666_10138320 | 3300005335 | Bacteria | 1695 |
| 22 | Ga0070680_100002781 | 3300005336 | Bacteria | 12987 |
| 23 | Ga0070680_100112496 | 3300005336 | Bacteria | 2267 |
| 24 | Ga0070660_100023825 | 3300005339 | Bacteria | 4537 |
| 25 | Ga0070660_100076440 | 3300005339 | Bacteria | 2623 |
| 26 | Ga0070691_10017267 | 3300005341 | Bacteria | 3321 |
| 27 | Ga0070661_100028317 | 3300005344 | Bacteria | 4040 |
| 28 | Ga0070661_100050975 | 3300005344 | Bacteria | 3029 |
| 29 | Ga0070661_100055639 | 3300005344 | Bacteria | 2897 |
| 30 | Ga0070692_10036220 | 3300005345 | Bacteria | 2503 |
| 31 | Ga0070669_100026686 | 3300005353 | Bacteria | 4156 |
| 32 | Ga0070669_100136479 | 3300005353 | Bacteria | 1887 |
| 33 | Ga0070675_100000723 | 3300005354 | Bacteria | 22952 |
| 34 | Ga0070675_100107301 | 3300005354 | Bacteria | 2358 |
| 35 | Ga0070671_100025615 | 3300005355 | Bacteria | 4842 |
| 36 | Ga0070674_100003928 | 3300005356 | Bacteria | 8420 |
| 37 | Ga0070673_100117404 | 3300005364 | Bacteria | 2214 |
| 38 | Ga0070667_100063729 | 3300005367 | Bacteria | 3125 |
| 39 | Ga0070709_10013151 | 3300005434 | Bacteria | 4646 |
| 40 | Ga0070713_100125030 | 3300005436 | Bacteria | 2261 |
| 41 | Ga0070713_100128599 | 3300005436 | Bacteria | 2231 |
| 42 | Ga0070701_10031913 | 3300005438 | Bacteria | 2618 |
| 43 | Ga0070705_100029638 | 3300005440 | Bacteria | 3013 |
| 44 | Ga0070694_100025207 | 3300005444 | Bacteria | 3846 |
| 45 | Ga0070678_100078208 | 3300005456 | Bacteria | 2498 |
| 46 | Ga0070662_100103200 | 3300005457 | Bacteria | 2162 |
| 47 | Ga0070681_10084533 | 3300005458 | Bacteria | 3126 |
| 48 | Ga0070681_10094911 | 3300005458 | Bacteria | 2931 |
| 49 | Ga0070681_10161145 | 3300005458 | Bacteria | 2167 |
| 50 | Ga0070681_10161483 | 3300005458 | Bacteria | 2165 |
| 51 | Ga0068867_100040887 | 3300005459 | Bacteria | 3386 |
| 52 | Ga0068867_100066946 | 3300005459 | Bacteria | 2676 |
| 53 | Ga0070707_100019468 | 3300005468 | Bacteria | 6395 |
| 54 | Ga0070707_100207459 | 3300005468 | Bacteria | 1910 |
| 55 | Ga0070698_100023284 | 3300005471 | Bacteria | 6475 |
| 56 | Ga0070699_100070903 | 3300005518 | Bacteria | 3030 |
| 57 | Ga0070679_100044362 | 3300005530 | Bacteria | 4430 |
| 58 | Ga0070679_100075340 | 3300005530 | Bacteria | 3364 |
| 59 | Ga0070679_100103116 | 3300005530 | Bacteria | 2839 |
| 60 | Ga0070679_100214166 | 3300005530 | Bacteria | 1889 |
| 61 | Ga0070684_100024426 | 3300005535 | Bacteria | 5071 |
| 62 | Ga0070697_100172558 | 3300005536 | Bacteria | 1831 |
| 63 | Ga0070672_100031271 | 3300005543 | Bacteria | 4005 |
| 64 | Ga0070686_100004656 | 3300005544 | Bacteria | 7566 |
| 65 | Ga0070695_100004738 | 3300005545 | Bacteria | 8004 |
| 66 | Ga0070695_100008373 | 3300005545 | Bacteria | 6136 |
| 67 | Ga0070696_100044300 | 3300005546 | Bacteria | 3081 |
| 68 | Ga0070696_100049657 | 3300005546 | Bacteria | 2915 |
| 69 | Ga0070665_100008458 | 3300005548 | Bacteria | 10409 |
| 70 | Ga0070665_100012037 | 3300005548 | Bacteria | 8725 |
| 71 | Ga0070665_100034730 | 3300005548 | Bacteria | 5071 |
| 72 | Ga0070665_100241037 | 3300005548 | Bacteria | 1809 |
| 73 | Ga0070704_100028762 | 3300005549 | Bacteria | 3701 |
| 74 | Ga0070704_100076772 | 3300005549 | Bacteria | 2445 |
| 75 | Ga0070704_100121446 | 3300005549 | Bacteria | 2008 |
| 76 | Ga0068855_100018979 | 3300005563 | Bacteria | 8268 |
| 77 | Ga0068855_100046325 | 3300005563 | Bacteria | 5141 |
| 78 | Ga0068855_100083778 | 3300005563 | Bacteria | 3693 |
| 79 | Ga0068855_100185514 | 3300005563 | Bacteria | 2349 |
| 80 | Ga0068857_100131867 | 3300005577 | Unclassified | 2254 |
| 81 | Ga0068854_100004621 | 3300005578 | Bacteria | 8685 |
| 82 | Ga0068854_100021077 | 3300005578 | Bacteria | 4418 |
| 83 | Ga0068854_100082000 | 3300005578 | Bacteria | 2384 |
| 84 | Ga0070702_100043414 | 3300005615 | Bacteria | 2533 |
| 85 | Ga0068852_100008783 | 3300005616 | Bacteria | 7475 |
| 86 | Ga0068852_100057974 | 3300005616 | Bacteria | 3352 |
| 87 | Ga0068859_100038669 | 3300005617 | Bacteria | 4786 |
| 88 | Ga0068859_100238690 | 3300005617 | Bacteria | 1906 |
| 89 | Ga0068864_100012070 | 3300005618 | Bacteria | 7135 |
| 90 | Ga0068864_100054122 | 3300005618 | Bacteria | 3463 |
| 91 | Ga0068866_10063029 | 3300005718 | Bacteria | 1931 |
| 92 | Ga0068861_100064209 | 3300005719 | Bacteria | 2824 |
| 93 | Ga0068851_10024226 | 3300005834 | Bacteria | 2971 |
| 94 | Ga0068851_10069462 | 3300005834 | Bacteria | 1820 |
| 95 | Ga0068863_100013317 | 3300005841 | Bacteria | 7933 |
| 96 | Ga0068863_100141866 | 3300005841 | Bacteria | 2296 |
| 97 | Ga0068858_100020037 | 3300005842 | Bacteria | 6255 |
| 98 | Ga0068858_100048818 | 3300005842 | Bacteria | 3920 |
| 99 | Ga0068860_100094083 | 3300005843 | Bacteria | 2856 |
| 100 | Ga0068862_100242007 | 3300005844 | Bacteria | 1641 |
| 101 | Ga0075432_10031343 | 3300006058 | Bacteria | 1840 |
| 102 | Ga0070715_10011756 | 3300006163 | Bacteria | 3162 |
| 103 | Ga0070712_100277666 | 3300006175 | Bacteria | 1348 |
| 104 | Ga0097621_100000636 | 3300006237 | Bacteria | 24794 |
| 105 | Ga0097621_100007637 | 3300006237 | Bacteria | 7751 |
| 106 | Ga0097621_100010700 | 3300006237 | Bacteria | 6724 |
| 107 | Ga0097621_100029014 | 3300006237 | Bacteria | 4366 |
| 108 | Ga0097621_100339956 | 3300006237 | Bacteria | 1333 |
| 109 | Ga0075370_10004356 | 3300006353 | Bacteria | 6862 |
| 110 | Ga0068871_100003144 | 3300006358 | Bacteria | 11330 |
| 111 | Ga0068871_100021412 | 3300006358 | Bacteria | 4968 |
| 112 | Ga0075428_100122569 | 3300006844 | Bacteria | 2830 |
| 113 | Ga0075430_100067710 | 3300006846 | Bacteria | 2997 |
| 114 | Ga0075431_100064905 | 3300006847 | Bacteria | 3770 |
| 115 | Ga0075434_100005437 | 3300006871 | Bacteria | 11599 |
| 116 | Ga0075434_100007466 | 3300006871 | Bacteria | 10115 |
| 117 | Ga0075434_100085896 | 3300006871 | Bacteria | 3146 |
| 118 | Ga0075434_100151916 | 3300006871 | Bacteria | 2336 |
| 119 | Ga0068865_100022654 | 3300006881 | Bacteria | 4101 |
| 120 | Ga0075436_100001995 | 3300006914 | Bacteria | 14089 |
| 121 | Ga0075436_100007102 | 3300006914 | Bacteria | 7664 |
| 122 | Ga0097620_100038667 | 3300006931 | Bacteria | 4786 |
| 123 | Ga0097620_100186886 | 3300006931 | Bacteria | 2156 |
| 124 | Ga0097620_100238686 | 3300006931 | Bacteria | 1906 |
| 125 | Ga0079104_1000411 | 3300006946 | Bacteria | 49275 |
| 126 | Ga0079104_1004458 | 3300006946 | Bacteria | 5983 |
| 127 | Ga0075435_100000051 | 3300007076 | Bacteria | 59038 |
| 128 | Ga0075435_100001570 | 3300007076 | Bacteria | 14753 |
| 129 | Ga0075435_100005824 | 3300007076 | Bacteria | 8664 |
| 130 | Ga0075435_100006302 | 3300007076 | Bacteria | 8379 |
| 131 | Ga0075435_100013820 | 3300007076 | Bacteria | 6018 |
| 132 | Ga0075435_100018480 | 3300007076 | Bacteria | 5303 |
| 133 | Ga0105244_10013856 | 3300009036 | Bacteria | 4687 |
| 134 | Ga0105244_10034660 | 3300009036 | Bacteria | 2656 |
| 135 | Ga0105240_10018245 | 3300009093 | Bacteria | 9431 |
| 136 | Ga0105240_10020011 | 3300009093 | Bacteria | 8935 |
| 137 | Ga0105240_10182836 | 3300009093 | Bacteria | 2472 |
| 138 | Ga0105240_10472036 | 3300009093 | Bacteria | 1400 |
| 139 | Ga0111539_10005672 | 3300009094 | Bacteria | 16149 |
| 140 | Ga0111539_10058466 | 3300009094 | Bacteria | 4574 |
| 141 | Ga0105245_10034818 | 3300009098 | Bacteria | 4467 |
| 142 | Ga0105247_10167699 | 3300009101 | Bacteria | 1458 |
| 143 | Ga0114129_10000418 | 3300009147 | Bacteria | 50300 |
| 144 | Ga0114129_10004112 | 3300009147 | Bacteria | 20568 |
| 145 | Ga0114129_10010650 | 3300009147 | Bacteria | 13111 |
| 146 | Ga0114129_10016408 | 3300009147 | Bacteria | 10540 |
| 147 | Ga0114129_10153618 | 3300009147 | Bacteria | 3149 |
| 148 | Ga0105243_10005559 | 3300009148 | Bacteria | 9818 |
| 149 | Ga0105243_10016009 | 3300009148 | Bacteria | 5673 |
| 150 | Ga0105243_10061794 | 3300009148 | Bacteria | 2997 |
| 151 | Ga0105241_10000021 | 3300009174 | Bacteria | 143251 |
| 152 | Ga0105241_10025773 | 3300009174 | Bacteria | 4371 |
| 153 | Ga0105242_10085442 | 3300009176 | Bacteria | 2646 |
| 154 | Ga0105242_10112785 | 3300009176 | Bacteria | 2321 |
| 155 | Ga0105248_10001563 | 3300009177 | Bacteria | 25457 |
| 156 | Ga0105248_10036662 | 3300009177 | Bacteria | 5484 |
| 157 | Ga0105248_10154636 | 3300009177 | Bacteria | 2588 |
| 158 | Ga0105248_10198576 | 3300009177 | Bacteria | 2260 |
| 159 | Ga0105237_10105825 | 3300009545 | Bacteria | 2805 |
| 160 | Ga0105237_10145877 | 3300009545 | Bacteria | 2362 |
| 161 | Ga0105238_10014829 | 3300009551 | Bacteria | 7884 |
| 162 | Ga0105238_10033055 | 3300009551 | Bacteria | 5263 |
| 163 | Ga0105238_10088558 | 3300009551 | Bacteria | 3082 |
| 164 | Ga0105239_10004242 | 3300010375 | Bacteria | 17211 |
| 165 | Ga0105239_10213150 | 3300010375 | Bacteria | 2165 |
| 166 | Ga0105239_10264207 | 3300010375 | Unclassified | 1935 |
| 167 | Ga0105246_10122890 | 3300011119 | Bacteria | 1926 |
| 168 | Ga0157370_10041224 | 3300013104 | Bacteria | 4456 |
| 169 | Ga0157370_10315730 | 3300013104 | Bacteria | 1442 |
| 170 | Ga0157369_10001766 | 3300013105 | Bacteria | 26202 |
| 171 | Ga0157369_10163779 | 3300013105 | Bacteria | 2346 |
| 172 | Ga0157374_10044282 | 3300013296 | Bacteria | 4114 |
| 173 | Ga0157374_10080820 | 3300013296 | Bacteria | 3084 |
| 174 | Ga0157374_10267770 | 3300013296 | Unclassified | 1684 |
| 175 | Ga0157378_10047109 | 3300013297 | Bacteria | 3832 |
| 176 | Ga0157378_10383968 | 3300013297 | Bacteria | 1380 |
| 177 | Ga0163162_10022431 | 3300013306 | Bacteria | 6218 |
| 178 | Ga0157375_10049682 | 3300013308 | Bacteria | 4111 |
| 179 | Ga0157375_10069505 | 3300013308 | Bacteria | 3528 |
| 180 | Ga0163163_10012303 | 3300014325 | Bacteria | 7794 |
| 181 | Ga0163163_10030374 | 3300014325 | Bacteria | 5206 |
| 182 | Ga0157379_10105697 | 3300014968 | Bacteria | 2527 |
| 183 | Ga0157376_10022170 | 3300014969 | Bacteria | 4945 |
| 184 | Ga0157376_10091065 | 3300014969 | Bacteria | 2641 |
| 185 | Ga0209784_102072 | 3300025224 | Bacteria | 2200 |
| 186 | Ga0209566_100046 | 3300025225 | Bacteria | 247053 |
| 187 | Ga0209147_100296 | 3300025229 | Bacteria | 41239 |
| 188 | Ga0209675_1002882 | 3300025291 | Bacteria | 8529 |
| 189 | Ga0209676_1001290 | 3300025292 | Bacteria | 25803 |
| 190 | Ga0209025_1000219 | 3300025294 | Bacteria | 137235 |
| 191 | Ga0209025_1006217 | 3300025294 | Bacteria | 9368 |
| 192 | Ga0207642_10050917 | 3300025899 | Bacteria | 1871 |
| 193 | Ga0207710_10087574 | 3300025900 | Bacteria | 1453 |
| 194 | Ga0207680_10000575 | 3300025903 | Bacteria | 17326 |
| 195 | Ga0207699_10115213 | 3300025906 | Bacteria | 1729 |
| 196 | Ga0207645_10052837 | 3300025907 | Bacteria | 2597 |
| 197 | Ga0207645_10060145 | 3300025907 | Bacteria | 2426 |
| 198 | Ga0207654_10000053 | 3300025911 | Bacteria | 83591 |
| 199 | Ga0207654_10043155 | 3300025911 | Bacteria | 2555 |
| 200 | Ga0207707_10080520 | 3300025912 | Bacteria | 2844 |
| 201 | Ga0207707_10081152 | 3300025912 | Bacteria | 2831 |
| 202 | Ga0207695_10000140 | 3300025913 | Bacteria | 216271 |
| 203 | Ga0207695_10089091 | 3300025913 | Bacteria | 3104 |
| 204 | Ga0207695_10137202 | 3300025913 | Bacteria | 2398 |
| 205 | Ga0207671_10122476 | 3300025914 | Bacteria | 1989 |
| 206 | Ga0207660_10031024 | 3300025917 | Bacteria | 3677 |
| 207 | Ga0207662_10012255 | 3300025918 | Bacteria | 4773 |
| 208 | Ga0207657_10003696 | 3300025919 | Bacteria | 16270 |
| 209 | Ga0207657_10188981 | 3300025919 | Bacteria | 1663 |
| 210 | Ga0207649_10064840 | 3300025920 | Bacteria | 2311 |
| 211 | Ga0207649_10067830 | 3300025920 | Bacteria | 2266 |
| 212 | Ga0207649_10189102 | 3300025920 | Bacteria | 1446 |
| 213 | Ga0207652_10064380 | 3300025921 | Bacteria | 3172 |
| 214 | Ga0207652_10200917 | 3300025921 | Bacteria | 1794 |
| 215 | Ga0207646_10147821 | 3300025922 | Bacteria | 2118 |
| 216 | Ga0207646_10150518 | 3300025922 | Bacteria | 2098 |
| 217 | Ga0207681_10100153 | 3300025923 | Bacteria | 2088 |
| 218 | Ga0207694_10001774 | 3300025924 | Bacteria | 18034 |
| 219 | Ga0207694_10144724 | 3300025924 | Bacteria | 1913 |
| 220 | Ga0207650_10225787 | 3300025925 | Bacteria | 1509 |
| 221 | Ga0207650_10282570 | 3300025925 | Bacteria | 1352 |
| 222 | Ga0207659_10039084 | 3300025926 | Bacteria | 3306 |
| 223 | Ga0207687_10007960 | 3300025927 | Bacteria | 6938 |
| 224 | Ga0207687_10051848 | 3300025927 | Bacteria | 2861 |
| 225 | Ga0207687_10053980 | 3300025927 | Bacteria | 2810 |
| 226 | Ga0207700_10092218 | 3300025928 | Bacteria | 2394 |
| 227 | Ga0207706_10059143 | 3300025933 | Bacteria | 3375 |
| 228 | Ga0207706_10115685 | 3300025933 | Bacteria | 2359 |
| 229 | Ga0207686_10027450 | 3300025934 | Bacteria | 3334 |
| 230 | Ga0207670_10129119 | 3300025936 | Bacteria | 1849 |
| 231 | Ga0207704_10001510 | 3300025938 | Bacteria | 10444 |
| 232 | Ga0207711_10041546 | 3300025941 | Bacteria | 3916 |
| 233 | Ga0207711_10089273 | 3300025941 | Bacteria | 2707 |
| 234 | Ga0207711_10200800 | 3300025941 | Bacteria | 1819 |
| 235 | Ga0207689_10194451 | 3300025942 | Bacteria | 1674 |
| 236 | Ga0207661_10151600 | 3300025944 | Bacteria | 2004 |
| 237 | Ga0207679_10052125 | 3300025945 | Bacteria | 2999 |
| 238 | Ga0207712_10044122 | 3300025961 | Bacteria | 3080 |
| 239 | Ga0207668_10222552 | 3300025972 | Bacteria | 1516 |
| 240 | Ga0207640_10004709 | 3300025981 | Bacteria | 7409 |
| 241 | Ga0207640_10040436 | 3300025981 | Bacteria | 2958 |
| 242 | Ga0207658_10004017 | 3300025986 | Bacteria | 10295 |
| 243 | Ga0207658_10073035 | 3300025986 | Bacteria | 2603 |
| 244 | Ga0207658_10078866 | 3300025986 | Bacteria | 2518 |
| 245 | Ga0207677_10173765 | 3300026023 | Bacteria | 1688 |
| 246 | Ga0207703_10017234 | 3300026035 | Bacteria | 5637 |
| 247 | Ga0207703_10075433 | 3300026035 | Bacteria | 2795 |
| 248 | Ga0207703_10327780 | 3300026035 | Bacteria | 1404 |
| 249 | Ga0207703_10329528 | 3300026035 | Bacteria | 1400 |
| 250 | Ga0207639_10070621 | 3300026041 | Bacteria | 2728 |
| 251 | Ga0207639_10086927 | 3300026041 | Bacteria | 2491 |
| 252 | Ga0207639_10163455 | 3300026041 | Bacteria | 1878 |
| 253 | Ga0207639_10217123 | 3300026041 | Bacteria | 1649 |
| 254 | Ga0207708_10046024 | 3300026075 | Bacteria | 3324 |
| 255 | Ga0207702_10025222 | 3300026078 | Bacteria | 4933 |
| 256 | Ga0207702_10082655 | 3300026078 | Bacteria | 2793 |
| 257 | Ga0207702_10209778 | 3300026078 | Bacteria | 1810 |
| 258 | Ga0207641_10000800 | 3300026088 | Bacteria | 33612 |
| 259 | Ga0207648_10010367 | 3300026089 | Bacteria | 8838 |
| 260 | Ga0207648_10019061 | 3300026089 | Bacteria | 6195 |
| 261 | Ga0207648_10063107 | 3300026089 | Bacteria | 3230 |
| 262 | Ga0207648_10120559 | 3300026089 | Bacteria | 2306 |
| 263 | Ga0207676_10031424 | 3300026095 | Bacteria | 3994 |
| 264 | Ga0207676_10114014 | 3300026095 | Bacteria | 2267 |
| 265 | Ga0207676_10271288 | 3300026095 | Bacteria | 1536 |
| 266 | Ga0207675_100001911 | 3300026118 | Bacteria | 20781 |
| 267 | Ga0207675_100041815 | 3300026118 | Bacteria | 4279 |
| 268 | Ga0207675_100070543 | 3300026118 | Bacteria | 3266 |
| 269 | Ga0207675_100073590 | 3300026118 | Bacteria | 3197 |
| 270 | Ga0207683_10068284 | 3300026121 | Bacteria | 3138 |
| 271 | Ga0207683_10099574 | 3300026121 | Bacteria | 2594 |
| 272 | Ga0207683_10141351 | 3300026121 | Bacteria | 2169 |
| 273 | Ga0207698_10003064 | 3300026142 | Bacteria | 10016 |
| 274 | Ga0209281_1000044 | 3300027111 | Bacteria | 336476 |
| 275 | Ga0209281_1004062 | 3300027111 | Bacteria | 4518 |
| 276 | Ga0209281_1004144 | 3300027111 | Bacteria | 4437 |
| 277 | Ga0207428_10020616 | 3300027907 | Bacteria | 5596 |
| 278 | Ga0207428_10077275 | 3300027907 | Bacteria | 2606 |
| 279 | Ga0268266_10006217 | 3300028379 | Bacteria | 10968 |
| 280 | Ga0268266_10079321 | 3300028379 | Bacteria | 2858 |
| 281 | Ga0268266_10131137 | 3300028379 | Bacteria | 2242 |
| 282 | Ga0268265_10023800 | 3300028380 | Bacteria | 4323 |
| 283 | Ga0268265_10167231 | 3300028380 | Bacteria | 1875 |
| 284 | Ga0268264_10116899 | 3300028381 | Bacteria | 2345 |
| 285 | Ga0268264_10131059 | 3300028381 | Bacteria | 2223 |
| 286 | Ga0265319_1000119 | 3300028563 | Bacteria | 59920 |
| 287 | Ga0265319_1007549 | 3300028563 | Bacteria | 4871 |
| 288 | Ga0265318_10003152 | 3300028577 | Bacteria | 8435 |
| 289 | Ga0265318_10003979 | 3300028577 | Bacteria | 7273 |
| 290 | Ga0265318_10018888 | 3300028577 | Bacteria | 2804 |
| 291 | Ga0265336_10009828 | 3300028666 | Bacteria | 3295 |
| 292 | Ga0265338_10000759 | 3300028800 | Bacteria | 55072 |
| 293 | Ga0265338_10010518 | 3300028800 | Bacteria | 10825 |
| 294 | Ga0265338_10066470 | 3300028800 | Unclassified | 3120 |
| 295 | Ga0265338_10101796 | 3300028800 | Bacteria | 2338 |
| 296 | Ga0265330_10014766 | 3300031235 | Bacteria | 3622 |
| 297 | Ga0265330_10035920 | 3300031235 | Bacteria | 2210 |
| 298 | Ga0265328_10040026 | 3300031239 | Bacteria | 1728 |
| 299 | Ga0265320_10071065 | 3300031240 | Bacteria | 1640 |
| 300 | Ga0265325_10001358 | 3300031241 | Bacteria | 17326 |
| 301 | Ga0265325_10006412 | 3300031241 | Bacteria | 7136 |
| 302 | Ga0265325_10079841 | 3300031241 | Bacteria | 1628 |
| 303 | Ga0265329_10038068 | 3300031242 | Unclassified | 1548 |
| 304 | Ga0265340_10025406 | 3300031247 | Bacteria | 3000 |
| 305 | Ga0265339_10000443 | 3300031249 | Bacteria | 32418 |
| 306 | Ga0265339_10008925 | 3300031249 | Bacteria | 6343 |
| 307 | Ga0265339_10046581 | 3300031249 | Bacteria | 2382 |
| 308 | Ga0265331_10004971 | 3300031250 | Bacteria | 8166 |
| 309 | Ga0265331_10037430 | 3300031250 | Bacteria | 2376 |
| 310 | Ga0265316_10040972 | 3300031344 | Bacteria | 3711 |
| 311 | Ga0265316_10048273 | 3300031344 | Bacteria | 3362 |
| 312 | Ga0265316_10074870 | 3300031344 | Bacteria | 2604 |
| 313 | Ga0265313_10000048 | 3300031595 | Bacteria | 112723 |
| 314 | Ga0265313_10025588 | 3300031595 | Bacteria | 3122 |
| 315 | Ga0307508_10000081 | 3300031616 | Bacteria | 112337 |
| 316 | Ga0316579_10037790 | 3300031691 | Bacteria | 2231 |
| 317 | Ga0265314_10000151 | 3300031711 | Bacteria | 104088 |
| 318 | Ga0265314_10004146 | 3300031711 | Bacteria | 13643 |
| 319 | Ga0265314_10005081 | 3300031711 | Bacteria | 11991 |
| 320 | Ga0265314_10014008 | 3300031711 | Bacteria | 6446 |
| 321 | Ga0265342_10036949 | 3300031712 | Bacteria | 2981 |
| 322 | Ga0316577_10079718 | 3300031733 | Bacteria | 1830 |
| 323 | Ga0307413_10094743 | 3300031824 | Bacteria | 1955 |
| 324 | Ga0307410_10196598 | 3300031852 | Bacteria | 1537 |
| 325 | Ga0307406_10072128 | 3300031901 | Bacteria | 2266 |
| 326 | Ga0307414_10007590 | 3300032004 | Bacteria | 6100 |
| 327 | Ga0307414_10063601 | 3300032004 | Bacteria | 2623 |
| 328 | Ga0307414_10153230 | 3300032004 | Bacteria | 1821 |
| 329 | Ga0373948_0002279 | 3300034817 | Bacteria | 2809 |
| 330 | Ga0373959_0001464 | 3300034820 | Bacteria | 3770 |
| 331 | Ga0373938_0000524 | 3300034957 | Bacteria | 6232 |
| 332 | Ga0373928_0003196 | 3300035084 | Bacteria | 3137 |
| 333 | Ga0373940_0005545 | 3300035088 | Bacteria | 2741 |
| 334 | Ga0373949_0006935 | 3300035090 | Bacteria | 2486 |
| 335 | Ga0373952_0000806 | 3300035092 | Bacteria | 5635 |
| 336 | Ga0373932_0009485 | 3300035112 | Bacteria | 2340 |
| 337 | Ga0373939_0000138 | 3300035114 | Bacteria | 20969 |
| 338 | Ga0373941_0000086 | 3300035115 | Bacteria | 15129 |
| 339 | Ga0373945_0036403 | 3300035116 | Bacteria | 1763 |
| 340 | Ga0373960_0013261 | 3300035121 | Bacteria | 2064 |
| 341 | Ga0373943_0032446 | 3300035170 | Bacteria | 2483 |
| 342 | Ga0373946_0002510 | 3300035171 | Bacteria | 6481 |
| 343 | Ga0373955_0028344 | 3300035172 | Bacteria | 2902 |
| 344 | Ga0373942_0001119 | 3300035207 | Bacteria | 7120 |
| 345 | Ga0373961_0003511 | 3300035241 | Bacteria | 3874 |
| 346 | Ga0316574_0098094 | 3300035398 | Bacteria | 1874 |
| 347 | Ga0373924_0031147 | 3300035410 | Bacteria | 2143 |
| 348 | Ga0373931_0002913 | 3300035691 | Bacteria | 7634 |
| 349 | Ga0373935_0013038 | 3300035692 | Bacteria | 5012 |
| 350 | Ga0373947_0003639 | 3300035725 | Bacteria | 9092 |
| 351 | Ga0373937_0038789 | 3300036401 | Bacteria | 4341 |
| 352 | Ga0373937_0084954 | 3300036401 | Bacteria | 2929 |
| 353 | Ga0316584_0088429 | 3300036712 | Bacteria | 2320 |
| 354 | Ga0316584_0088675 | 3300036712 | Bacteria | 2316 |
| 355 | Ga0373925_0040372 | 3300037068 | Bacteria | 3455 |
| 356 | Ga0373925_0092849 | 3300037068 | Bacteria | 2309 |
| 357 | Ga0395900_0044351 | 3300037418 | Bacteria | 4582 |
| 358 | Ga0395900_0069635 | 3300037418 | Bacteria | 3616 |
| 359 | Ga0316581_0029424 | 3300037588 | Bacteria | 1650 |
| 360 | Ga0395901_0028465 | 3300038443 | Bacteria | 5746 |
| 361 | Ga0395901_0230214 | 3300038443 | Bacteria | 1935 |
| 362 | Ga0400489_37695 | 3300039093 | Bacteria | 8355 |
| 363 | Ga0453683_0000599 | 3300044673 | Bacteria | 39641 |
| 364 | Ga0453683_0067773 | 3300044673 | Bacteria | 2230 |
| 365 | Ga0466963_0063022 | 3300044694 | Bacteria | 2481 |
| 366 | Ga0453684_0011234 | 3300044712 | Bacteria | 15072 |
| 367 | Ga0466957_0085015 | 3300044842 | Bacteria | 1975 |
| 368 | Ga0451576_0006905 | 3300045051 | Bacteria | 13748 |
| 369 | Ga0451576_0010342 | 3300045051 | Bacteria | 10713 |
| 370 | Ga0451576_0044917 | 3300045051 | Bacteria | 4655 |
| 371 | Ga0466967_0010175 | 3300045976 | Bacteria | 7036 |
| 372 | Ga0466967_0144461 | 3300045976 | Bacteria | 2218 |
| 373 | Ga0466967_0180128 | 3300045976 | Bacteria | 1993 |
| 374 | Ga0495592_0010699 | 3300046454 | Bacteria | 6917 |
| 375 | Ga0495592_0042052 | 3300046454 | Bacteria | 3423 |
| 376 | Ga0495629_0058517 | 3300046459 | Bacteria | 2695 |
| 377 | Ga0495580_0015736 | 3300046472 | Bacteria | 5700 |
| 378 | Ga0495664_0086873 | 3300046477 | Bacteria | 1879 |
| 379 | Ga0495620_0013506 | 3300046515 | Bacteria | 4178 |
| 380 | Ga0495630_0008621 | 3300046517 | Bacteria | 7318 |
| 381 | Ga0495630_0112089 | 3300046517 | Bacteria | 2066 |
| 382 | Ga0495587_0083785 | 3300046536 | Bacteria | 1847 |
| 383 | Ga0495645_0056973 | 3300046543 | Bacteria | 2837 |
| 384 | Ga0495645_0156966 | 3300046543 | Bacteria | 1576 |
| 385 | Ga0495667_0122974 | 3300046559 | Bacteria | 1675 |
| 386 | Ga0495634_0069323 | 3300046642 | Bacteria | 2327 |
| 387 | Ga0495647_0025835 | 3300046681 | Bacteria | 2148 |
| 388 | Ga0495658_0035211 | 3300046683 | Bacteria | 2753 |
| 389 | Ga0495669_0005533 | 3300046684 | Bacteria | 5270 |
| 390 | Ga0495613_0007802 | 3300046689 | Bacteria | 7964 |
| 391 | Ga0495613_0010064 | 3300046689 | Bacteria | 7025 |
| 392 | Ga0495624_0133916 | 3300046690 | Bacteria | 1519 |
| 393 | Ga0495660_0045040 | 3300046810 | Bacteria | 2424 |
| 394 | Ga0495660_0119489 | 3300046810 | Bacteria | 1335 |
| 395 | Ga0495604_0043994 | 3300047317 | Bacteria | 3492 |
| 396 | Ga0495672_0013263 | 3300047320 | Bacteria | 5692 |
| 397 | Ga0495684_0007786 | 3300047471 | Bacteria | 8293 |
| 398 | Ga0496101_0018138 | 3300048904 | Bacteria | 4780 |
| 399 | Ga0496101_0274556 | 3300048904 | Bacteria | 1316 |
| 400 | Ga0496102_0009516 | 3300048905 | Bacteria | 8355 |
| 401 | Ga0496102_0053592 | 3300048905 | Bacteria | 3676 |
| 402 | Ga0496103_0085576 | 3300048906 | Bacteria | 1987 |
| 403 | Ga0496104_0017500 | 3300048907 | Bacteria | 6528 |
| 404 | Ga0496104_0048538 | 3300048907 | Bacteria | 4002 |
| 405 | Ga0496104_0153598 | 3300048907 | Bacteria | 2209 |
| 406 | Ga0496104_0227396 | 3300048907 | Bacteria | 1778 |
| 407 | Ga0496105_0022883 | 3300048908 | Bacteria | 5065 |
| 408 | Ga0496106_0005177 | 3300048909 | Bacteria | 9660 |
| 409 | Ga0496106_0132848 | 3300048909 | Bacteria | 1953 |
| 410 | Ga0496107_0022626 | 3300048910 | Bacteria | 4442 |
| 411 | Ga0496107_0028285 | 3300048910 | Bacteria | 3982 |
| 412 | Ga0496108_0017969 | 3300048911 | Bacteria | 5786 |
| 413 | Ga0496109_0059155 | 3300048912 | Bacteria | 3501 |
| 414 | Ga0496109_0140061 | 3300048912 | Bacteria | 2262 |
| 415 | Ga0496110_0279872 | 3300048913 | Bacteria | 1519 |
| 416 | Ga0496111_0175210 | 3300048914 | Bacteria | 1594 |
| 417 | Ga0496112_0008069 | 3300048915 | Bacteria | 9399 |
| 418 | Ga0496112_0250742 | 3300048915 | Bacteria | 1721 |
| 419 | Ga0496114_0034480 | 3300048917 | Bacteria | 4176 |
| 420 | Ga0496114_0198752 | 3300048917 | Bacteria | 1756 |
| 421 | Ga0496115_0058585 | 3300048918 | Bacteria | 3099 |
| 422 | Ga0496116_0013500 | 3300048919 | Bacteria | 6579 |
| 423 | Ga0496116_0064559 | 3300048919 | Bacteria | 2353 |
| 424 | Ga0496117_0005507 | 3300048920 | Bacteria | 13260 |
| 425 | Ga0496121_0101192 | 3300048924 | Bacteria | 2223 |
| 426 | Ga0496123_0000975 | 3300048926 | Bacteria | 44171 |
| 427 | Ga0496125_0000115 | 3300048928 | Bacteria | 181994 |
| 428 | Ga0496126_0001686 | 3300048929 | Bacteria | 32954 |
| 429 | Ga0496126_0005744 | 3300048929 | Bacteria | 14040 |
| 430 | Ga0501031_0005843 | 3300049568 | Bacteria | 8017 |
| 431 | Ga0501033_0013018 | 3300049570 | Bacteria | 6343 |
| 432 | Ga0501034_0000732 | 3300049571 | Bacteria | 49733 |
| 433 | Ga0501034_0016548 | 3300049571 | Bacteria | 7561 |
| 434 | Ga0501034_0018696 | 3300049571 | Bacteria | 7102 |
| 435 | Ga0501034_0044169 | 3300049571 | Bacteria | 4507 |
| 436 | Ga0501034_0114021 | 3300049571 | Bacteria | 2692 |
| 437 | Ga0501034_0269607 | 3300049571 | Bacteria | 1644 |
| 438 | Ga0501037_0042958 | 3300049573 | Bacteria | 3322 |
| 439 | Ga0501038_0009068 | 3300049574 | Bacteria | 9133 |
| 440 | Ga0501039_0183483 | 3300049575 | Bacteria | 1645 |
| 441 | Ga0501043_0099844 | 3300049579 | Bacteria | 2281 |
| 442 | Ga0501043_0118004 | 3300049579 | Bacteria | 2082 |
| 443 | Ga0501043_0206909 | 3300049579 | Bacteria | 1521 |
| 444 | Ga0501046_0269493 | 3300049580 | Bacteria | 1249 |
| 445 | Ga0501047_0009651 | 3300049581 | Bacteria | 9122 |
| 446 | Ga0501047_0036664 | 3300049581 | Bacteria | 4740 |
| 447 | Ga0501047_0077614 | 3300049581 | Bacteria | 3194 |
| 448 | Ga0501047_0098027 | 3300049581 | Bacteria | 2810 |
| 449 | Ga0501068_0113508 | 3300049584 | Bacteria | 1686 |
| 450 | Ga0501069_0035166 | 3300049585 | Bacteria | 2759 |
| 451 | Ga0501070_0002853 | 3300049586 | Bacteria | 15068 |
| 452 | Ga0501070_0008679 | 3300049586 | Bacteria | 8589 |
| 453 | Ga0501070_0137277 | 3300049586 | Bacteria | 2019 |
| 454 | Ga0501073_0016343 | 3300049589 | Bacteria | 5379 |
| 455 | Ga0501080_0035231 | 3300049742 | Bacteria | 4672 |
| 456 | Ga0501035_0126009 | 3300049822 | Bacteria | 2235 |
| 457 | Ga0501044_0004984 | 3300049823 | Bacteria | 14843 |
| 458 | Ga0501044_0135622 | 3300049823 | Bacteria | 2453 |
| 459 | Ga0501044_0154766 | 3300049823 | Bacteria | 2272 |
| 460 | Ga0501044_0277390 | 3300049823 | Bacteria | 1611 |
| 461 | nmdc:mga03683_1256_c1 | 3300050489 | Bacteria | 7514 |
| 462 | nmdc:mga03683_1576_c1 | 3300050489 | Bacteria | 6498 |
| 463 | nmdc:mga07m45_31693_c1 | 3300050496 | Bacteria | 2930 |
| 464 | nmdc:mga07m45_69433_c1 | 3300050496 | Bacteria | 2003 |
| 465 | nmdc:mga05p37_171059_c1 | 3300050507 | Bacteria | 2649 |
| 466 | nmdc:mga05p37_17535_c1 | 3300050507 | Bacteria | 8643 |
| 467 | nmdc:mga05p37_235895_c1 | 3300050507 | Bacteria | 2202 |
| 468 | nmdc:mga05p37_241499_c1 | 3300050507 | Bacteria | 2172 |
| 469 | nmdc:mga05p37_56333_c1 | 3300050507 | Bacteria | 4839 |
| 470 | nmdc:mga05p37_833_c1 | 3300050507 | Bacteria | 34555 |
| 471 | nmdc:mga06r32_2140_c1 | 3300050510 | Bacteria | 17651 |
| 472 | nmdc:mga08y16_26597_c1 | 3300050511 | Bacteria | 6099 |
| 473 | nmdc:mga08y16_274226_c1 | 3300050511 | Bacteria | 1741 |
| 474 | nmdc:mga08y16_66355_c1 | 3300050511 | Bacteria | 3766 |
| 475 | nmdc:mga08y16_84532_c1 | 3300050511 | Bacteria | 3308 |
| 476 | nmdc:mga0n895_117025_c1 | 3300050512 | Bacteria | 2684 |
| 477 | nmdc:mga0n895_156628_c1 | 3300050512 | Bacteria | 2309 |
| 478 | nmdc:mga0n895_165085_c1 | 3300050512 | Bacteria | 2246 |
| 479 | nmdc:mga0n895_209602_c1 | 3300050512 | Bacteria | 1979 |
| 480 | nmdc:mga0n895_41770_c1 | 3300050512 | Bacteria | 4459 |
| 481 | nmdc:mga0rr50_13287_c1 | 3300050513 | Bacteria | 5355 |
| 482 | nmdc:mga0rr50_1728_c1 | 3300050513 | Bacteria | 12046 |
| 483 | nmdc:mga0rr50_4_c1 | 3300050513 | Bacteria | 338870 |
| 484 | nmdc:mga0rr50_53362_c1 | 3300050513 | Bacteria | 3007 |
| 485 | nmdc:mga0rr50_7604_c1 | 3300050513 | Bacteria | 6698 |
| 486 | nmdc:mga08x19_5253_c1 | 3300050514 | Bacteria | 7664 |
| 487 | nmdc:mga08x19_61102_c1 | 3300050514 | Bacteria | 2442 |
| 488 | nmdc:mga0a205_21464_c1 | 3300050515 | Bacteria | 6108 |
| 489 | nmdc:mga0a205_3926_c2 | 3300050515 | Bacteria | 4182 |
| 490 | Ga0495601_0045374 | 3300053077 | Bacteria | 2763 |
| 491 | Ga0495619_0000600 | 3300053085 | Bacteria | 23899 |
| 492 | Ga0500604_0000693 | 3300053151 | Bacteria | 9230 |
| 493 | Ga0500634_0000034 | 3300053161 | Bacteria | 74144 |
| 494 | Ga0501084_0003488 | 3300054114 | Bacteria | 12782 |
| 495 | Ga0501082_0173524 | 3300060353 | Bacteria | 1875 |
| 496 | 2524191142 | 2524023129 | Bacteria | 6762600 |
| 497 | 2550902334 | 2548877040 | Bacteria | 7507281 |
| 498 | 2556062859 | 2554235469 | Bacteria | 3590176 |
| 499 | 2563927512 | 2563366752 | Bacteria | 4961801 |
| 500 | 2573037925 | 2571042588 | Bacteria | 5045676 |
| 501 | 2573037926 | 2571042588 | Bacteria | 5045676 |
| 502 | 2578336867 | 2576861424 | Bacteria | 5270569 |
| 503 | 2578336971 | 2576861424 | Bacteria | 5270569 |
| 504 | 2578336972 | 2576861424 | Bacteria | 5270569 |
| 505 | 2580930820 | 2579778775 | Bacteria | 5360914 |
| 506 | 2580930821 | 2579778775 | Bacteria | 5360914 |
| 507 | 2587744396 | 2585428059 | Bacteria | 8696589 |
| 508 | 2595089802 | 2593339131 | Bacteria | 5116855 |
| 509 | 2621275069 | 2619619294 | Bacteria | 5575484 |
| 510 | 2621275214 | 2619619294 | Bacteria | 5575484 |
| 511 | 2621275215 | 2619619294 | Bacteria | 5575484 |
| 512 | 2643812580 | 2643221558 | Bacteria | 5460675 |
| 513 | 2643912700 | 2643221580 | Bacteria | 3816678 |
| 514 | 2643966212 | 2643221591 | Bacteria | 4397626 |
| 515 | 2644413297 | 2643221674 | Bacteria | 3919126 |
| 516 | 2644422801 | 2643221676 | Bacteria | 8119172 |
| 517 | 2657682840 | 2657244999 | Bacteria | 5946535 |
| 518 | 2712198052 | 2711768088 | Bacteria | 3195027 |
| 519 | 2739270918 | 2738543017 | Bacteria | 4271950 |
| 520 | 2757568306 | 2757320391 | Bacteria | 4746095 |
| 521 | 2777762617 | 2775507177 | Bacteria | 4384303 |
| 522 | 2777839738 | 2775507192 | Bacteria | 4622234 |
| 523 | 2792621033 | 2791355091 | Bacteria | 6135441 |
| 524 | 2792625248 | 2791355092 | Bacteria | 6248105 |
| 525 | 2804754060 | 2802429268 | Bacteria | 6094027 |
| 526 | 2819674200 | 2818991459 | Bacteria | 8736032 |
| 527 | 2855877829 | 2855872281 | Bacteria | 6964271 |
| 528 | 2857457629 | 2857453340 | Bacteria | 8090534 |
| 529 | 2857463326 | 2857460504 | Bacteria | 5194327 |
| 530 | 2857474404 | 2857472729 | Bacteria | 6568124 |
| 531 | 2857590839 | 2857586860 | Bacteria | 4354574 |
| 532 | 2864998565 | 2864997549 | Bacteria | 5139696 |
| 533 | 2881637736 | 2881636855 | Bacteria | 5205297 |
| 534 | 2881637737 | 2881636855 | Bacteria | 5205297 |
| 535 | 2881637870 | 2881636855 | Bacteria | 5205297 |
| 536 | 2889298663 | 2889295896 | Bacteria | 4704906 |
| 537 | 2891051035 | 2891048133 | Bacteria | 4447501 |
| 538 | 2904762531 | 2904755435 | Bacteria | 7986759 |
| 539 | 2907202586 | 2907202186 | Bacteria | 6632024 |
| 540 | 2907206515 | 2907202186 | Bacteria | 6632024 |
| 541 | 2919432674 | 2919425241 | Bacteria | 8055701 |
| 542 | 2925327305 | 2925326138 | Bacteria | 9652120 |
| 543 | 2929210011 | 2929206907 | Bacteria | 5918291 |
| 544 | 2932404854 | 2932401849 | Bacteria | 4262978 |
| 545 | 2936340873 | 2936340661 | Bacteria | 5139038 |
| 546 | 2938655458 | 2938649242 | Bacteria | 7118381 |
| 547 | 2968559620 | 2968558590 | Bacteria | 6956864 |
| 548 | 2971404190 | 2971403814 | Bacteria | 7370929 |
| 549 | 2971413593 | 2971410472 | Bacteria | 8311090 |
| 550 | 2971515471 | 2971511577 | Bacteria | 5404012 |
| 551 | 2971516379 | 2971511577 | Bacteria | 5404012 |
| 552 | 2971516380 | 2971511577 | Bacteria | 5404012 |
| 553 | 2980130912 | 2980125574 | Bacteria | 5567337 |
| 554 | 2980179853 | 2980176882 | Bacteria | 5397533 |
| 555 | 2980179854 | 2980176882 | Bacteria | 5397533 |
| 556 | 2980179973 | 2980176882 | Bacteria | 5397533 |
| 557 | 2981288300 | 2981284811 | Bacteria | 4641497 |
| 558 | 2981293121 | 2981289755 | Bacteria | 4641509 |
| 559 | 2981983738 | 2981980479 | Bacteria | 4641628 |
| 560 | 2981988657 | 2981985349 | Bacteria | 4641497 |
| 561 | 2988229550 | 2988225383 | Bacteria | 7221625 |
| 562 | 2995395298 | 2995392953 | Bacteria | 4539380 |
| 563 | 2996634645 | 2996632988 | Bacteria | 6921523 |
| 564 | 3006982797 | 3006978542 | Bacteria | 5328100 |
| 565 | 641336331 | 641228493 | Bacteria | 3999591 |
| 566 | 643390153 | 643348555 | Bacteria | 3914947 |
| 567 | 8018152637 | 8018150411 | Bacteria | 5549903 |
| 568 | 8054797885 | 8054795415 | Bacteria | 9785225 |
| 569 | 8056536764 | 8056533031 | Bacteria | 8964429 |
| 570 | 8057734523 | 8057733483 | Bacteria | 6578323 |
| 571 | Ga0070697_100053677 | |||
| 572 | JGI25158J39367_1005003 | |||
| 573 | JGI25151J46595_10001364 | |||
| 574 | rootH1_10163537 | |||
| 575 | rootH2_10211470 | |||
| 576 | rootL2_10100166 | |||
| 577 | Ga0055538_1000388 | |||
| 578 | Ga0055532_1001235 | |||
| 579 | Ga0055541_1004110 | |||
| 580 | Ga0065712_10105337 | |||
| 581 | Ga0070658_10002700 | |||
| 582 | Ga0070658_10016683 | |||
| 583 | Ga0070658_10104795 | |||
| 584 | Ga0070676_10064532 | |||
| 585 | Ga0070683_100000408 | |||
| 586 | Ga0070690_100094236 | |||
| 587 | Ga0070670_100040669 | |||
| 588 | Ga0070670_100063054 | |||
| 589 | Ga0070666_10009883 | |||
| 590 | Ga0070666_10013672 | |||
| 591 | Ga0070666_10138320 | |||
| 592 | Ga0070680_100002781 | |||
| 593 | Ga0070680_100112496 | |||
| 594 | Ga0070660_100023825 | |||
| 595 | Ga0070660_100076440 | |||
| 596 | Ga0070691_10017267 | |||
| 597 | Ga0070661_100028317 | |||
| 598 | Ga0070661_100050975 | |||
| 599 | Ga0070661_100055639 | |||
| 600 | Ga0070692_10036220 | |||
| 601 | Ga0070669_100026686 | |||
| 602 | Ga0070669_100136479 | |||
| 603 | Ga0070675_100000723 | |||
| 604 | Ga0070675_100107301 | |||
| 605 | Ga0070671_100025615 | |||
| 606 | Ga0070674_100003928 | |||
| 607 | Ga0070673_100117404 | |||
| 608 | Ga0070667_100063729 | |||
| 609 | Ga0070709_10013151 | |||
| 610 | Ga0070713_100125030 | |||
| 611 | Ga0070713_100128599 | |||
| 612 | Ga0070701_10031913 | |||
| 613 | Ga0070705_100029638 | |||
| 614 | Ga0070694_100025207 | |||
| 615 | Ga0070678_100078208 | |||
| 616 | Ga0070662_100103200 | |||
| 617 | Ga0070681_10084533 | |||
| 618 | Ga0070681_10094911 | |||
| 619 | Ga0070681_10161145 | |||
| 620 | Ga0070681_10161483 | |||
| 621 | Ga0068867_100040887 | |||
| 622 | Ga0068867_100066946 | |||
| 623 | Ga0070707_100019468 | |||
| 624 | Ga0070707_100207459 | |||
| 625 | Ga0070698_100023284 | |||
| 626 | Ga0070699_100070903 | |||
| 627 | Ga0070679_100044362 | |||
| 628 | Ga0070679_100075340 | |||
| 629 | Ga0070679_100103116 | |||
| 630 | Ga0070679_100214166 | |||
| 631 | Ga0070684_100024426 | |||
| 632 | Ga0070697_100172558 | |||
| 633 | Ga0070672_100031271 | |||
| 634 | Ga0070686_100004656 | |||
| 635 | Ga0070695_100004738 | |||
| 636 | Ga0070695_100008373 | |||
| 637 | Ga0070696_100044300 | |||
| 638 | Ga0070696_100049657 | |||
| 639 | Ga0070665_100008458 | |||
| 640 | Ga0070665_100012037 | |||
| 641 | Ga0070665_100034730 | |||
| 642 | Ga0070665_100241037 | |||
| 643 | Ga0070704_100028762 | |||
| 644 | Ga0070704_100076772 | |||
| 645 | Ga0070704_100121446 | |||
| 646 | Ga0068855_100018979 | |||
| 647 | Ga0068855_100046325 | |||
| 648 | Ga0068855_100083778 | |||
| 649 | Ga0068855_100185514 | |||
| 650 | Ga0068857_100131867 | |||
| 651 | Ga0068854_100004621 | |||
| 652 | Ga0068854_100021077 | |||
| 653 | Ga0068854_100082000 | |||
| 654 | Ga0070702_100043414 | |||
| 655 | Ga0068852_100008783 | |||
| 656 | Ga0068852_100057974 | |||
| 657 | Ga0068859_100038669 | |||
| 658 | Ga0068859_100238690 | |||
| 659 | Ga0068864_100012070 | |||
| 660 | Ga0068864_100054122 | |||
| 661 | Ga0068866_10063029 | |||
| 662 | Ga0068861_100064209 | |||
| 663 | Ga0068851_10024226 | |||
| 664 | Ga0068851_10069462 | |||
| 665 | Ga0068863_100013317 | |||
| 666 | Ga0068863_100141866 | |||
| 667 | Ga0068858_100020037 | |||
| 668 | Ga0068858_100048818 | |||
| 669 | Ga0068860_100094083 | |||
| 670 | Ga0068862_100242007 | |||
| 671 | Ga0075432_10031343 | |||
| 672 | Ga0070715_10011756 | |||
| 673 | Ga0070712_100277666 | |||
| 674 | Ga0097621_100000636 | |||
| 675 | Ga0097621_100007637 | |||
| 676 | Ga0097621_100010700 | |||
| 677 | Ga0097621_100029014 | |||
| 678 | Ga0097621_100339956 | |||
| 679 | Ga0075370_10004356 | |||
| 680 | Ga0068871_100003144 | |||
| 681 | Ga0068871_100021412 | |||
| 682 | Ga0075428_100122569 | |||
| 683 | Ga0075430_100067710 | |||
| 684 | Ga0075431_100064905 | |||
| 685 | Ga0075434_100005437 | |||
| 686 | Ga0075434_100007466 | |||
| 687 | Ga0075434_100085896 | |||
| 688 | Ga0075434_100151916 | |||
| 689 | Ga0068865_100022654 | |||
| 690 | Ga0075436_100001995 | |||
| 691 | Ga0075436_100007102 | |||
| 692 | Ga0097620_100038667 | |||
| 693 | Ga0097620_100186886 | |||
| 694 | Ga0097620_100238686 | |||
| 695 | Ga0079104_1000411 | |||
| 696 | Ga0079104_1004458 | |||
| 697 | Ga0075435_100000051 | |||
| 698 | Ga0075435_100001570 | |||
| 699 | Ga0075435_100005824 | |||
| 700 | Ga0075435_100006302 | |||
| 701 | Ga0075435_100013820 | |||
| 702 | Ga0075435_100018480 | |||
| 703 | Ga0105244_10013856 | |||
| 704 | Ga0105244_10034660 | |||
| 705 | Ga0105240_10018245 | |||
| 706 | Ga0105240_10020011 | |||
| 707 | Ga0105240_10182836 | |||
| 708 | Ga0105240_10472036 | |||
| 709 | Ga0111539_10005672 | |||
| 710 | Ga0111539_10058466 | |||
| 711 | Ga0105245_10034818 | |||
| 712 | Ga0105247_10167699 | |||
| 713 | Ga0114129_10000418 | |||
| 714 | Ga0114129_10004112 | |||
| 715 | Ga0114129_10010650 | |||
| 716 | Ga0114129_10016408 | |||
| 717 | Ga0114129_10153618 | |||
| 718 | Ga0105243_10005559 | |||
| 719 | Ga0105243_10016009 | |||
| 720 | Ga0105243_10061794 | |||
| 721 | Ga0105241_10000021 | |||
| 722 | Ga0105241_10025773 | |||
| 723 | Ga0105242_10085442 | |||
| 724 | Ga0105242_10112785 | |||
| 725 | Ga0105248_10001563 | |||
| 726 | Ga0105248_10036662 | |||
| 727 | Ga0105248_10154636 | |||
| 728 | Ga0105248_10198576 | |||
| 729 | Ga0105237_10105825 | |||
| 730 | Ga0105237_10145877 | |||
| 731 | Ga0105238_10014829 | |||
| 732 | Ga0105238_10033055 | |||
| 733 | Ga0105238_10088558 | |||
| 734 | Ga0105239_10004242 | |||
| 735 | Ga0105239_10213150 | |||
| 736 | Ga0105239_10264207 | |||
| 737 | Ga0105246_10122890 | |||
| 738 | Ga0157370_10041224 | |||
| 739 | Ga0157370_10315730 | |||
| 740 | Ga0157369_10001766 | |||
| 741 | Ga0157369_10163779 | |||
| 742 | Ga0157374_10044282 | |||
| 743 | Ga0157374_10080820 | |||
| 744 | Ga0157374_10267770 | |||
| 745 | Ga0157378_10047109 | |||
| 746 | Ga0157378_10383968 | |||
| 747 | Ga0163162_10022431 | |||
| 748 | Ga0157375_10049682 | |||
| 749 | Ga0157375_10069505 | |||
| 750 | Ga0163163_10012303 | |||
| 751 | Ga0163163_10030374 | |||
| 752 | Ga0157379_10105697 | |||
| 753 | Ga0157376_10022170 | |||
| 754 | Ga0157376_10091065 | |||
| 755 | Ga0209784_102072 | |||
| 756 | Ga0209566_100046 | |||
| 757 | Ga0209147_100296 | |||
| 758 | Ga0209675_1002882 | |||
| 759 | Ga0209676_1001290 | |||
| 760 | Ga0209025_1000219 | |||
| 761 | Ga0209025_1006217 | |||
| 762 | Ga0207642_10050917 | |||
| 763 | Ga0207710_10087574 | |||
| 764 | Ga0207680_10000575 | |||
| 765 | Ga0207699_10115213 | |||
| 766 | Ga0207645_10052837 | |||
| 767 | Ga0207645_10060145 | |||
| 768 | Ga0207654_10000053 | |||
| 769 | Ga0207654_10043155 | |||
| 770 | Ga0207707_10080520 | |||
| 771 | Ga0207707_10081152 | |||
| 772 | Ga0207695_10000140 | |||
| 773 | Ga0207695_10089091 | |||
| 774 | Ga0207695_10137202 | |||
| 775 | Ga0207671_10122476 | |||
| 776 | Ga0207660_10031024 | |||
| 777 | Ga0207662_10012255 | |||
| 778 | Ga0207657_10003696 | |||
| 779 | Ga0207657_10188981 | |||
| 780 | Ga0207649_10064840 | |||
| 781 | Ga0207649_10067830 | |||
| 782 | Ga0207649_10189102 | |||
| 783 | Ga0207652_10064380 | |||
| 784 | Ga0207652_10200917 | |||
| 785 | Ga0207646_10147821 | |||
| 786 | Ga0207646_10150518 | |||
| 787 | Ga0207681_10100153 | |||
| 788 | Ga0207694_10001774 | |||
| 789 | Ga0207694_10144724 | |||
| 790 | Ga0207650_10225787 | |||
| 791 | Ga0207650_10282570 | |||
| 792 | Ga0207659_10039084 | |||
| 793 | Ga0207687_10007960 | |||
| 794 | Ga0207687_10051848 | |||
| 795 | Ga0207687_10053980 | |||
| 796 | Ga0207700_10092218 | |||
| 797 | Ga0207706_10059143 | |||
| 798 | Ga0207706_10115685 | |||
| 799 | Ga0207686_10027450 | |||
| 800 | Ga0207670_10129119 | |||
| 801 | Ga0207704_10001510 | |||
| 802 | Ga0207711_10041546 | |||
| 803 | Ga0207711_10089273 | |||
| 804 | Ga0207711_10200800 | |||
| 805 | Ga0207689_10194451 | |||
| 806 | Ga0207661_10151600 | |||
| 807 | Ga0207679_10052125 | |||
| 808 | Ga0207712_10044122 | |||
| 809 | Ga0207668_10222552 | |||
| 810 | Ga0207640_10004709 | |||
| 811 | Ga0207640_10040436 | |||
| 812 | Ga0207658_10004017 | |||
| 813 | Ga0207658_10073035 | |||
| 814 | Ga0207658_10078866 | |||
| 815 | Ga0207677_10173765 | |||
| 816 | Ga0207703_10017234 | |||
| 817 | Ga0207703_10075433 | |||
| 818 | Ga0207703_10327780 | |||
| 819 | Ga0207703_10329528 | |||
| 820 | Ga0207639_10070621 | |||
| 821 | Ga0207639_10086927 | |||
| 822 | Ga0207639_10163455 | |||
| 823 | Ga0207639_10217123 | |||
| 824 | Ga0207708_10046024 | |||
| 825 | Ga0207702_10025222 | |||
| 826 | Ga0207702_10082655 | |||
| 827 | Ga0207702_10209778 | |||
| 828 | Ga0207641_10000800 | |||
| 829 | Ga0207648_10010367 | |||
| 830 | Ga0207648_10019061 | |||
| 831 | Ga0207648_10063107 | |||
| 832 | Ga0207648_10120559 | |||
| 833 | Ga0207676_10031424 | |||
| 834 | Ga0207676_10114014 | |||
| 835 | Ga0207676_10271288 | |||
| 836 | Ga0207675_100001911 | |||
| 837 | Ga0207675_100041815 | |||
| 838 | Ga0207675_100070543 | |||
| 839 | Ga0207675_100073590 | |||
| 840 | Ga0207683_10068284 | |||
| 841 | Ga0207683_10099574 | |||
| 842 | Ga0207683_10141351 | |||
| 843 | Ga0207698_10003064 | |||
| 844 | Ga0209281_1000044 | |||
| 845 | Ga0209281_1004062 | |||
| 846 | Ga0209281_1004144 | |||
| 847 | Ga0207428_10020616 | |||
| 848 | Ga0207428_10077275 | |||
| 849 | Ga0268266_10006217 | |||
| 850 | Ga0268266_10079321 | |||
| 851 | Ga0268266_10131137 | |||
| 852 | Ga0268265_10023800 | |||
| 853 | Ga0268265_10167231 | |||
| 854 | Ga0268264_10116899 | |||
| 855 | Ga0268264_10131059 | |||
| 856 | Ga0265319_1000119 | |||
| 857 | Ga0265319_1007549 | |||
| 858 | Ga0265318_10003152 | |||
| 859 | Ga0265318_10003979 | |||
| 860 | Ga0265318_10018888 | |||
| 861 | Ga0265336_10009828 | |||
| 862 | Ga0265338_10000759 | |||
| 863 | Ga0265338_10010518 | |||
| 864 | Ga0265338_10066470 | |||
| 865 | Ga0265338_10101796 | |||
| 866 | Ga0265330_10014766 | |||
| 867 | Ga0265330_10035920 | |||
| 868 | Ga0265328_10040026 | |||
| 869 | Ga0265320_10071065 | |||
| 870 | Ga0265325_10001358 | |||
| 871 | Ga0265325_10006412 | |||
| 872 | Ga0265325_10079841 | |||
| 873 | Ga0265329_10038068 | |||
| 874 | Ga0265340_10025406 | |||
| 875 | Ga0265339_10000443 | |||
| 876 | Ga0265339_10008925 | |||
| 877 | Ga0265339_10046581 | |||
| 878 | Ga0265331_10004971 | |||
| 879 | Ga0265331_10037430 | |||
| 880 | Ga0265316_10040972 | |||
| 881 | Ga0265316_10048273 | |||
| 882 | Ga0265316_10074870 | |||
| 883 | Ga0265313_10000048 | |||
| 884 | Ga0265313_10025588 | |||
| 885 | Ga0307508_10000081 | |||
| 886 | Ga0316579_10037790 | |||
| 887 | Ga0265314_10000151 | |||
| 888 | Ga0265314_10004146 | |||
| 889 | Ga0265314_10005081 | |||
| 890 | Ga0265314_10014008 | |||
| 891 | Ga0265342_10036949 | |||
| 892 | Ga0316577_10079718 | |||
| 893 | Ga0307413_10094743 | |||
| 894 | Ga0307410_10196598 | |||
| 895 | Ga0307406_10072128 | |||
| 896 | Ga0307414_10007590 | |||
| 897 | Ga0307414_10063601 | |||
| 898 | Ga0307414_10153230 | |||
| 899 | Ga0373948_0002279 | |||
| 900 | Ga0373959_0001464 | |||
| 901 | Ga0373938_0000524 | |||
| 902 | Ga0373928_0003196 | |||
| 903 | Ga0373940_0005545 | |||
| 904 | Ga0373949_0006935 | |||
| 905 | Ga0373952_0000806 | |||
| 906 | Ga0373932_0009485 | |||
| 907 | Ga0373939_0000138 | |||
| 908 | Ga0373941_0000086 | |||
| 909 | Ga0373945_0036403 | |||
| 910 | Ga0373960_0013261 | |||
| 911 | Ga0373943_0032446 | |||
| 912 | Ga0373946_0002510 | |||
| 913 | Ga0373955_0028344 | |||
| 914 | Ga0373942_0001119 | |||
| 915 | Ga0373961_0003511 | |||
| 916 | Ga0316574_0098094 | |||
| 917 | Ga0373924_0031147 | |||
| 918 | Ga0373931_0002913 | |||
| 919 | Ga0373935_0013038 | |||
| 920 | Ga0373947_0003639 | |||
| 921 | Ga0373937_0038789 | |||
| 922 | Ga0373937_0084954 | |||
| 923 | Ga0316584_0088429 | |||
| 924 | Ga0316584_0088675 | |||
| 925 | Ga0373925_0040372 | |||
| 926 | Ga0373925_0092849 | |||
| 927 | Ga0395900_0044351 | |||
| 928 | Ga0395900_0069635 | |||
| 929 | Ga0316581_0029424 | |||
| 930 | Ga0395901_0028465 | |||
| 931 | Ga0395901_0230214 | |||
| 932 | Ga0400489_37695 | |||
| 933 | Ga0453683_0000599 | |||
| 934 | Ga0453683_0067773 | |||
| 935 | Ga0466963_0063022 | |||
| 936 | Ga0453684_0011234 | |||
| 937 | Ga0466957_0085015 | |||
| 938 | Ga0451576_0006905 | |||
| 939 | Ga0451576_0010342 | |||
| 940 | Ga0451576_0044917 | |||
| 941 | Ga0466967_0010175 | |||
| 942 | Ga0466967_0144461 | |||
| 943 | Ga0466967_0180128 | |||
| 944 | Ga0495592_0010699 | |||
| 945 | Ga0495592_0042052 | |||
| 946 | Ga0495629_0058517 | |||
| 947 | Ga0495580_0015736 | |||
| 948 | Ga0495664_0086873 | |||
| 949 | Ga0495620_0013506 | |||
| 950 | Ga0495630_0008621 | |||
| 951 | Ga0495630_0112089 | |||
| 952 | Ga0495587_0083785 | |||
| 953 | Ga0495645_0056973 | |||
| 954 | Ga0495645_0156966 | |||
| 955 | Ga0495667_0122974 | |||
| 956 | Ga0495634_0069323 | |||
| 957 | Ga0495647_0025835 | |||
| 958 | Ga0495658_0035211 | |||
| 959 | Ga0495669_0005533 | |||
| 960 | Ga0495613_0007802 | |||
| 961 | Ga0495613_0010064 | |||
| 962 | Ga0495624_0133916 | |||
| 963 | Ga0495660_0045040 | |||
| 964 | Ga0495660_0119489 | |||
| 965 | Ga0495604_0043994 | |||
| 966 | Ga0495672_0013263 | |||
| 967 | Ga0495684_0007786 | |||
| 968 | Ga0496101_0018138 | |||
| 969 | Ga0496101_0274556 | |||
| 970 | Ga0496102_0009516 | |||
| 971 | Ga0496102_0053592 | |||
| 972 | Ga0496103_0085576 | |||
| 973 | Ga0496104_0017500 | |||
| 974 | Ga0496104_0048538 | |||
| 975 | Ga0496104_0153598 | |||
| 976 | Ga0496104_0227396 | |||
| 977 | Ga0496105_0022883 | |||
| 978 | Ga0496106_0005177 | |||
| 979 | Ga0496106_0132848 | |||
| 980 | Ga0496107_0022626 | |||
| 981 | Ga0496107_0028285 | |||
| 982 | Ga0496108_0017969 | |||
| 983 | Ga0496109_0059155 | |||
| 984 | Ga0496109_0140061 | |||
| 985 | Ga0496110_0279872 | |||
| 986 | Ga0496111_0175210 | |||
| 987 | Ga0496112_0008069 | |||
| 988 | Ga0496112_0250742 | |||
| 989 | Ga0496114_0034480 | |||
| 990 | Ga0496114_0198752 | |||
| 991 | Ga0496115_0058585 | |||
| 992 | Ga0496116_0013500 | |||
| 993 | Ga0496116_0064559 | |||
| 994 | Ga0496117_0005507 | |||
| 995 | Ga0496121_0101192 | |||
| 996 | Ga0496123_0000975 | |||
| 997 | Ga0496125_0000115 | |||
| 998 | Ga0496126_0001686 | |||
| 999 | Ga0496126_0005744 | |||
| 1000 | Ga0501031_0005843 | |||
| 1001 | Ga0501033_0013018 | |||
| 1002 | Ga0501034_0000732 | |||
| 1003 | Ga0501034_0016548 | |||
| 1004 | Ga0501034_0018696 | |||
| 1005 | Ga0501034_0044169 | |||
| 1006 | Ga0501034_0114021 | |||
| 1007 | Ga0501034_0269607 | |||
| 1008 | Ga0501037_0042958 | |||
| 1009 | Ga0501038_0009068 | |||
| 1010 | Ga0501039_0183483 | |||
| 1011 | Ga0501043_0099844 | |||
| 1012 | Ga0501043_0118004 | |||
| 1013 | Ga0501043_0206909 | |||
| 1014 | Ga0501046_0269493 | |||
| 1015 | Ga0501047_0009651 | |||
| 1016 | Ga0501047_0036664 | |||
| 1017 | Ga0501047_0077614 | |||
| 1018 | Ga0501047_0098027 | |||
| 1019 | Ga0501068_0113508 | |||
| 1020 | Ga0501069_0035166 | |||
| 1021 | Ga0501070_0002853 | |||
| 1022 | Ga0501070_0008679 | |||
| 1023 | Ga0501070_0137277 | |||
| 1024 | Ga0501073_0016343 | |||
| 1025 | Ga0501080_0035231 | |||
| 1026 | Ga0501035_0126009 | |||
| 1027 | Ga0501044_0004984 | |||
| 1028 | Ga0501044_0135622 | |||
| 1029 | Ga0501044_0154766 | |||
| 1030 | Ga0501044_0277390 | |||
| 1031 | nmdc:mga03683_1256_c1 | |||
| 1032 | nmdc:mga03683_1576_c1 | |||
| 1033 | nmdc:mga07m45_31693_c1 | |||
| 1034 | nmdc:mga07m45_69433_c1 | |||
| 1035 | nmdc:mga05p37_171059_c1 | |||
| 1036 | nmdc:mga05p37_17535_c1 | |||
| 1037 | nmdc:mga05p37_235895_c1 | |||
| 1038 | nmdc:mga05p37_241499_c1 | |||
| 1039 | nmdc:mga05p37_56333_c1 | |||
| 1040 | nmdc:mga05p37_833_c1 | |||
| 1041 | nmdc:mga06r32_2140_c1 | |||
| 1042 | nmdc:mga08y16_26597_c1 | |||
| 1043 | nmdc:mga08y16_274226_c1 | |||
| 1044 | nmdc:mga08y16_66355_c1 | |||
| 1045 | nmdc:mga08y16_84532_c1 | |||
| 1046 | nmdc:mga0n895_117025_c1 | |||
| 1047 | nmdc:mga0n895_156628_c1 | |||
| 1048 | nmdc:mga0n895_165085_c1 | |||
| 1049 | nmdc:mga0n895_209602_c1 | |||
| 1050 | nmdc:mga0n895_41770_c1 | |||
| 1051 | nmdc:mga0rr50_13287_c1 | |||
| 1052 | nmdc:mga0rr50_1728_c1 | |||
| 1053 | nmdc:mga0rr50_4_c1 | |||
| 1054 | nmdc:mga0rr50_53362_c1 | |||
| 1055 | nmdc:mga0rr50_7604_c1 | |||
| 1056 | nmdc:mga08x19_5253_c1 | |||
| 1057 | nmdc:mga08x19_61102_c1 | |||
| 1058 | nmdc:mga0a205_21464_c1 | |||
| 1059 | nmdc:mga0a205_3926_c2 | |||
| 1060 | Ga0495601_0045374 | |||
| 1061 | Ga0495619_0000600 | |||
| 1062 | Ga0500604_0000693 | |||
| 1063 | Ga0500634_0000034 | |||
| 1064 | Ga0501084_0003488 | |||
| 1065 | Ga0501082_0173524 | |||
| 1066 | 2524191142 | |||
| 1067 | 2550902334 | |||
| 1068 | 2556062859 | |||
| 1069 | 2563927512 | |||
| 1070 | 2573037925 | |||
| 1071 | 2573037926 | |||
| 1072 | 2578336867 | |||
| 1073 | 2578336971 | |||
| 1074 | 2578336972 | |||
| 1075 | 2580930820 | |||
| 1076 | 2580930821 | |||
| 1077 | 2587744396 | |||
| 1078 | 2595089802 | |||
| 1079 | 2621275069 | |||
| 1080 | 2621275214 | |||
| 1081 | 2621275215 | |||
| 1082 | 2643812580 | |||
| 1083 | 2643912700 | |||
| 1084 | 2643966212 | |||
| 1085 | 2644413297 | |||
| 1086 | 2644422801 | |||
| 1087 | 2657682840 | |||
| 1088 | 2712198052 | |||
| 1089 | 2739270918 | |||
| 1090 | 2757568306 | |||
| 1091 | 2777762617 | |||
| 1092 | 2777839738 | |||
| 1093 | 2792621033 | |||
| 1094 | 2792625248 | |||
| 1095 | 2804754060 | |||
| 1096 | 2819674200 | |||
| 1097 | 2855877829 | |||
| 1098 | 2857457629 | |||
| 1099 | 2857463326 | |||
| 1100 | 2857474404 | |||
| 1101 | 2857590839 | |||
| 1102 | 2864998565 | |||
| 1103 | 2881637736 | |||
| 1104 | 2881637737 | |||
| 1105 | 2881637870 | |||
| 1106 | 2889298663 | |||
| 1107 | 2891051035 | |||
| 1108 | 2904762531 | |||
| 1109 | 2907202586 | |||
| 1110 | 2907206515 | |||
| 1111 | 2919432674 | |||
| 1112 | 2925327305 | |||
| 1113 | 2929210011 | |||
| 1114 | 2932404854 | |||
| 1115 | 2936340873 | |||
| 1116 | 2938655458 | |||
| 1117 | 2968559620 | |||
| 1118 | 2971404190 | |||
| 1119 | 2971413593 | |||
| 1120 | 2971515471 | |||
| 1121 | 2971516379 | |||
| 1122 | 2971516380 | |||
| 1123 | 2980130912 | |||
| 1124 | 2980179853 | |||
| 1125 | 2980179854 | |||
| 1126 | 2980179973 | |||
| 1127 | 2981288300 | |||
| 1128 | 2981293121 | |||
| 1129 | 2981983738 | |||
| 1130 | 2981988657 | |||
| 1131 | 2988229550 | |||
| 1132 | 2995395298 | |||
| 1133 | 2996634645 | |||
| 1134 | 3006982797 | |||
| 1135 | 641336331 | |||
| 1136 | 643390153 | |||
| 1137 | 8018152637 | |||
| 1138 | 8054797885 | |||
| 1139 | 8056536764 | |||
| 1140 | 8057734523 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1zjc-assembly1.cif.gz_A-2 | aminopeptidase s from s. aureus | 0.9085 | 15 | 383 |
| 2ayi-assembly1.cif.gz_A | wild-type ampt from thermus thermophilus | 0.9006 | 15 | 383 |
| 4icq-assembly1.cif.gz_B | structural basis for substrate recognition and reaction mechanism of bacterial aminopeptidase peps | 0.894 | 13 | 383 |
| 4ics-assembly1.cif.gz_B | crystal structure of peps from streptococcus pneumoniae in complex with a substrate | 0.8924 | 15 | 383 |
| 1zjc-assembly1.cif.gz_A-2 | aminopeptidase s from s. aureus | 0.8741 | 15 | 383 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P46846_104_226_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.8643 | 32 | 67 | 3.40.50.2020 |
| 4icsB01 | Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) | 0.8332 | 15 | 154 | 3.40.1830.10 |
| 1zjcA01 | Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) | 0.818 | 15 | 154 | 3.40.1830.10 |
| 2ayiA01 | Alpha Beta;3-Layer(aba) Sandwich;Thermophilic metalloprotease-like;Thermophilic metalloprotease (M29) | 0.8094 | 15 | 151 | 3.40.1830.10 |
| af_Q2G056_117_224_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.7911 | 32 | 67 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A526YI52-F1-model_v4 | Aminopeptidase | 0.9993 | 140 | 285 |
GO:0004177
GO:0006508 GO:0046872 |
| AF-A0A531M5R0-F1-model_v4 | Aminopeptidase | 0.9989 | 145 | 314 |
GO:0004177
GO:0006508 GO:0046872 |
| AF-A0A243VCH4-F1-model_v4 | deleted | 0.9973 | 236 | 324 |
|
| AF-A0A3C0SU46-F1-model_v4 | Aminopeptidase | 0.9948 | 222 | 296 |
GO:0004177
GO:0006508 GO:0046872 |
| AF-A0A436W773-F1-model_v4 | Aminopeptidase | 0.994 | 123 | 383 |
GO:0004177
GO:0006508 GO:0046872 |