F464846

General Info

Members Datasets Scaffolds Average Seq Length
570 252 1140 114

Family's Representative Sequence

Representative Sequence 3300037418|Ga0395900_0380191|Ga0395900_0380191_28_432
Length 134
Sequence MGRLLEAQTPTGPIMTKEKALARIDYVELPSATAHELTRAFYAKAFGWDFANYGPTYSATTNGTTDVGLQGDPSDALSAPLPIVRVDDLEGALDAVVKAGGTIAKPIFGFPGGRRFHFIDPSGSELAVWQSVEE

Samples

Sample ID Description Type Environment
1 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
2 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
10 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
11 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
12 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
67 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
77 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
78 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
97 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
163 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
166 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
167 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
168 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
169 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
170 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
171 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
176 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
178 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
179 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
184 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
187 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
192 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
193 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
194 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
195 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
196 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
199 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
202 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
203 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
204 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
205 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
206 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
209 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
210 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
211 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
212 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
213 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
214 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
215 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
216 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
222 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
223 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
224 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
225 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
226 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
227 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
228 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
229 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
230 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
233 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
234 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
241 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
242 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
243 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
244 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
245 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
246 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
247 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
248 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
249 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
250 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
251 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
252 2643221597 Microbacterium sp. Root180 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.63
Nodule 0
Rhizoplane 5.79
Rhizosphere 89.12
Stem 0
Stem Tuber 0
Unclassified 3.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395900_0380191 3300037418 Bacteria 1380
2 JGI24741J21665_1008233 3300001915 Bacteria 1976
3 JGI24740J21852_10000934 3300001979 Bacteria 12997
4 JGI24740J21852_10007082 3300001979 Bacteria 4594
5 JGI24739J22299_10016337 3300001989 Bacteria 2687
6 JGI24737J22298_10003999 3300001990 Bacteria 5158
7 JGI24742J22300_10013949 3300002244 Bacteria 1347
8 JGI25153J46596_10000006 3300003215 Bacteria 447760
9 rootH2_10146856 3300003320 Bacteria 4364
10 rootH2_10160292 3300003320 Unclassified 1510
11 Ga0055525_1000040 3300003759 Bacteria 286933
12 Ga0055542_1000046 3300003762 Bacteria 201922
13 Ga0055529_1000007 3300003763 Bacteria 403604
14 Ga0065165_1128787 3300005262 Bacteria 607
15 Ga0070658_10001586 3300005327 Bacteria 19238
16 Ga0070658_10008339 3300005327 Bacteria 8336
17 Ga0070658_10022146 3300005327 Bacteria 5097
18 Ga0070658_10039181 3300005327 Bacteria 3823
19 Ga0070658_10049395 3300005327 Bacteria 3408
20 Ga0070658_10549319 3300005327 Bacteria 1000
21 Ga0070658_10568875 3300005327 Bacteria 981
22 Ga0070676_10027014 3300005328 Bacteria 3252
23 Ga0070676_10158234 3300005328 Bacteria 1456
24 Ga0070676_10381566 3300005328 Bacteria 976
25 Ga0070670_100029221 3300005331 Bacteria 4744
26 Ga0070670_100081068 3300005331 Bacteria 2788
27 Ga0070670_100187796 3300005331 Bacteria 1794
28 Ga0070677_10397973 3300005333 Bacteria 725
29 Ga0070666_10129087 3300005335 Bacteria 1755
30 Ga0070666_10473556 3300005335 Bacteria 906
31 Ga0070666_10779045 3300005335 Bacteria 704
32 Ga0070680_100028532 3300005336 Bacteria 4477
33 Ga0070680_100349368 3300005336 Bacteria 1257
34 Ga0070680_100549794 3300005336 Bacteria 989
35 Ga0070682_100354849 3300005337 Bacteria 1094
36 Ga0070682_101256209 3300005337 Unclassified 627
37 Ga0068868_100942274 3300005338 Bacteria 787
38 Ga0070660_100020441 3300005339 Bacteria 4864
39 Ga0070660_100593598 3300005339 Bacteria 926
40 Ga0070660_101189669 3300005339 Bacteria 646
41 Ga0070689_101069583 3300005340 Bacteria 720
42 Ga0070661_100077959 3300005344 Bacteria 2444
43 Ga0070661_100082096 3300005344 Bacteria 2380
44 Ga0070661_100113897 3300005344 Bacteria 2021
45 Ga0070661_100116444 3300005344 Bacteria 1999
46 Ga0070661_100158615 3300005344 Bacteria 1712
47 Ga0070661_100194253 3300005344 Bacteria 1549
48 Ga0070661_100482550 3300005344 Bacteria 990
49 Ga0070692_10048255 3300005345 Bacteria 2205
50 Ga0070692_10780547 3300005345 Bacteria 650
51 Ga0070669_100022141 3300005353 Bacteria 4545
52 Ga0070669_100029026 3300005353 Bacteria 3986
53 Ga0070675_100017062 3300005354 Bacteria 5771
54 Ga0070675_100342912 3300005354 Bacteria 1324
55 Ga0070671_100032608 3300005355 Bacteria 4305
56 Ga0070671_100034116 3300005355 Bacteria 4212
57 Ga0070671_100088332 3300005355 Bacteria 2594
58 Ga0070671_100116241 3300005355 Bacteria 2249
59 Ga0070671_100766142 3300005355 Bacteria 839
60 Ga0070674_100015935 3300005356 Bacteria 4704
61 Ga0070674_100265463 3300005356 Bacteria 1354
62 Ga0070673_100130715 3300005364 Bacteria 2106
63 Ga0070673_100661828 3300005364 Bacteria 957
64 Ga0070673_101064728 3300005364 Bacteria 755
65 Ga0070673_101070314 3300005364 Bacteria 753
66 Ga0070659_100059869 3300005366 Bacteria 3007
67 Ga0070659_100195702 3300005366 Bacteria 1663
68 Ga0070659_100387756 3300005366 Bacteria 1178
69 Ga0070659_100392420 3300005366 Bacteria 1170
70 Ga0070659_100744331 3300005366 Bacteria 850
71 Ga0070659_101125625 3300005366 Bacteria 692
72 Ga0070667_100266353 3300005367 Bacteria 1535
73 Ga0070714_100274209 3300005435 Bacteria 1565
74 Ga0070713_100086908 3300005436 Bacteria 2682
75 Ga0070663_100011131 3300005455 Bacteria 5633
76 Ga0070663_100012223 3300005455 Bacteria 5420
77 Ga0070663_100249196 3300005455 Bacteria 1405
78 Ga0070663_100336749 3300005455 Bacteria 1218
79 Ga0070663_100344894 3300005455 Bacteria 1204
80 Ga0070663_100705992 3300005455 Bacteria 858
81 Ga0070678_100049444 3300005456 Bacteria 3035
82 Ga0070678_100093853 3300005456 Bacteria 2308
83 Ga0070678_100836230 3300005456 Bacteria 838
84 Ga0070662_100064510 3300005457 Bacteria 2682
85 Ga0070662_100450752 3300005457 Bacteria 1068
86 Ga0070681_10085833 3300005458 Bacteria 3100
87 Ga0070681_10146657 3300005458 Bacteria 2288
88 Ga0070681_10171061 3300005458 Bacteria 2094
89 Ga0070681_10274393 3300005458 Bacteria 1597
90 Ga0068867_101353955 3300005459 Bacteria 659
91 Ga0070679_100013152 3300005530 Bacteria 7924
92 Ga0070679_100152349 3300005530 Bacteria 2288
93 Ga0070679_100218542 3300005530 Bacteria 1867
94 Ga0070679_100237555 3300005530 Bacteria 1781
95 Ga0070679_101748565 3300005530 Bacteria 570
96 Ga0070684_100073599 3300005535 Bacteria 3011
97 Ga0068853_100033437 3300005539 Bacteria 4363
98 Ga0068853_100059281 3300005539 Bacteria 3306
99 Ga0068853_100449756 3300005539 Bacteria 1211
100 Ga0068853_102200789 3300005539 Bacteria 534
101 Ga0070672_100447888 3300005543 Bacteria 1112
102 Ga0070672_100532364 3300005543 Bacteria 1019
103 Ga0070665_100000458 3300005548 Bacteria 59389
104 Ga0070665_100013438 3300005548 Bacteria 8237
105 Ga0070665_100028525 3300005548 Bacteria 5621
106 Ga0070665_100389286 3300005548 Bacteria 1402
107 Ga0070665_101284901 3300005548 Bacteria 742
108 Ga0068855_100889158 3300005563 Unclassified 942
109 Ga0070664_100001856 3300005564 Bacteria 16919
110 Ga0070664_100002946 3300005564 Bacteria 13768
111 Ga0070664_100093041 3300005564 Bacteria 2612
112 Ga0070664_100126257 3300005564 Bacteria 2244
113 Ga0070664_100556690 3300005564 Bacteria 1061
114 Ga0070664_100653229 3300005564 Bacteria 977
115 Ga0070664_101146402 3300005564 Bacteria 733
116 Ga0070664_101518574 3300005564 Bacteria 634
117 Ga0070664_101945235 3300005564 Bacteria 558
118 Ga0068857_100132784 3300005577 Bacteria 2246
119 Ga0068857_100197030 3300005577 Bacteria 1835
120 Ga0068857_101809939 3300005577 Bacteria 598
121 Ga0068854_100072310 3300005578 Bacteria 2525
122 Ga0068854_100087160 3300005578 Bacteria 2316
123 Ga0068856_100048898 3300005614 Bacteria 4168
124 Ga0068856_100122149 3300005614 Bacteria 2606
125 Ga0068856_100147808 3300005614 Bacteria 2358
126 Ga0068852_100014033 3300005616 Bacteria 6149
127 Ga0068852_100040235 3300005616 Bacteria 3942
128 Ga0068852_100118705 3300005616 Bacteria 2417
129 Ga0068852_100796742 3300005616 Bacteria 959
130 Ga0068852_101109126 3300005616 Bacteria 811
131 Ga0068852_101111432 3300005616 Unclassified 811
132 Ga0068859_100012846 3300005617 Bacteria 8410
133 Ga0068859_100276234 3300005617 Bacteria 1772
134 Ga0068864_100016289 3300005618 Bacteria 6187
135 Ga0068864_100046258 3300005618 Bacteria 3733
136 Ga0068866_10030925 3300005718 Bacteria 2574
137 Ga0068861_100458929 3300005719 Bacteria 1143
138 Ga0068861_100796501 3300005719 Bacteria 887
139 Ga0068851_10114786 3300005834 Bacteria 1441
140 Ga0068851_10273070 3300005834 Bacteria 965
141 Ga0068863_100010487 3300005841 Bacteria 9007
142 Ga0068863_100012766 3300005841 Bacteria 8101
143 Ga0068863_100052822 3300005841 Bacteria 3850
144 Ga0068863_100440318 3300005841 Bacteria 1278
145 Ga0068863_101817632 3300005841 Bacteria 619
146 Ga0068858_100011050 3300005842 Bacteria 8534
147 Ga0068858_100016316 3300005842 Bacteria 6977
148 Ga0068858_100411407 3300005842 Bacteria 1300
149 Ga0068860_100314511 3300005843 Bacteria 1536
150 Ga0068860_100635345 3300005843 Bacteria 1075
151 Ga0068862_100599336 3300005844 Bacteria 1057
152 Ga0070717_10059738 3300006028 Bacteria 3155
153 Ga0070716_100125892 3300006173 Bacteria 1612
154 Ga0097621_100011395 3300006237 Bacteria 6545
155 Ga0097621_100163942 3300006237 Bacteria 1912
156 Ga0068871_100138891 3300006358 Bacteria 2065
157 Ga0068871_100414820 3300006358 Bacteria 1201
158 Ga0075428_100183299 3300006844 Bacteria 2265
159 Ga0068865_100046843 3300006881 Bacteria 2968
160 Ga0068865_100357464 3300006881 Bacteria 1185
161 Ga0097620_100012846 3300006931 Bacteria 8410
162 Ga0097620_100276242 3300006931 Bacteria 1772
163 Ga0105251_10333263 3300009011 Unclassified 691
164 Ga0105240_10107467 3300009093 Bacteria 3383
165 Ga0105243_10000202 3300009148 Bacteria 69670
166 Ga0105241_10007093 3300009174 Bacteria 8252
167 Ga0105242_11433913 3300009176 Bacteria 719
168 Ga0105248_10109696 3300009177 Bacteria 3111
169 Ga0105248_10143943 3300009177 Bacteria 2690
170 Ga0105248_10443003 3300009177 Bacteria 1463
171 Ga0105248_10713939 3300009177 Bacteria 1131
172 Ga0105248_11269602 3300009177 Bacteria 833
173 Ga0105237_10049755 3300009545 Bacteria 4211
174 Ga0105237_10084102 3300009545 Bacteria 3173
175 Ga0105238_10133952 3300009551 Bacteria 2456
176 Ga0105238_12408145 3300009551 Bacteria 562
177 Ga0105249_10117044 3300009553 Bacteria 2527
178 Ga0105249_11995566 3300009553 Bacteria 653
179 Ga0105246_10479778 3300011119 Bacteria 1052
180 Ga0105246_11610603 3300011119 Bacteria 614
181 Ga0157347_1036955 3300012502 Bacteria 633
182 Ga0157327_1027615 3300012512 Bacteria 687
183 Ga0157326_1002397 3300012513 Bacteria 2008
184 Ga0157373_10017805 3300013100 Bacteria 5173
185 Ga0157373_10018852 3300013100 Bacteria 5021
186 Ga0157373_10213769 3300013100 Bacteria 1360
187 Ga0157373_10366400 3300013100 Bacteria 1029
188 Ga0157373_10901388 3300013100 Bacteria 656
189 Ga0157371_10000024 3300013102 Bacteria 281202
190 Ga0157371_10187629 3300013102 Bacteria 1480
191 Ga0157371_10615971 3300013102 Bacteria 808
192 Ga0157370_10004183 3300013104 Bacteria 16700
193 Ga0157370_11500990 3300013104 Bacteria 606
194 Ga0157369_10053972 3300013105 Bacteria 4340
195 Ga0157369_12113989 3300013105 Bacteria 571
196 Ga0157374_10093958 3300013296 Bacteria 2865
197 Ga0157374_10130764 3300013296 Bacteria 2429
198 Ga0157374_10668338 3300013296 Bacteria 1051
199 Ga0163162_10172531 3300013306 Bacteria 2287
200 Ga0163162_10992439 3300013306 Bacteria 949
201 Ga0157372_10797784 3300013307 Bacteria 1097
202 Ga0157372_11537804 3300013307 Bacteria 766
203 Ga0157375_11484798 3300013308 Bacteria 800
204 Ga0157375_13313104 3300013308 Bacteria 537
205 Ga0163163_10217754 3300014325 Bacteria 1958
206 Ga0163163_10795838 3300014325 Bacteria 1009
207 Ga0163163_10899306 3300014325 Bacteria 949
208 Ga0157380_10796601 3300014326 Bacteria 961
209 Ga0157379_10021453 3300014968 Bacteria 5718
210 Ga0157376_10847333 3300014969 Unclassified 929
211 Ga0163161_10737103 3300017792 Bacteria 823
212 Ga0213876_10287476 3300021384 Bacteria 874
213 Ga0209563_100019 3300025230 Bacteria 697828
214 Ga0209646_1005326 3300025246 Bacteria 2255
215 Ga0209026_1061376 3300025250 Unclassified 528
216 Ga0209677_120846 3300025253 Bacteria 759
217 Ga0209148_1000026 3300025254 Bacteria 629213
218 Ga0207666_1073493 3300025271 Unclassified 551
219 Ga0209455_1000005 3300025272 Bacteria 1416756
220 Ga0209758_1000001 3300025297 Bacteria 1981790
221 Ga0207697_10021788 3300025315 Bacteria 2625
222 Ga0207697_10176816 3300025315 Bacteria 935
223 Ga0207656_10000739 3300025321 Bacteria 10681
224 Ga0207656_10082759 3300025321 Bacteria 1445
225 Ga0207713_1196730 3300025735 Unclassified 620
226 Ga0207642_10022494 3300025899 Bacteria 2502
227 Ga0207688_10131891 3300025901 Bacteria 1465
228 Ga0207680_10183193 3300025903 Bacteria 1417
229 Ga0207680_10848779 3300025903 Bacteria 655
230 Ga0207680_10910979 3300025903 Bacteria 630
231 Ga0207647_10011074 3300025904 Bacteria 6338
232 Ga0207647_10021329 3300025904 Bacteria 4326
233 Ga0207647_10069902 3300025904 Bacteria 2122
234 Ga0207645_10005127 3300025907 Bacteria 9585
235 Ga0207645_10036682 3300025907 Bacteria 3148
236 Ga0207645_10907956 3300025907 Bacteria 598
237 Ga0207705_10000984 3300025909 Bacteria 23249
238 Ga0207705_10001710 3300025909 Bacteria 17412
239 Ga0207705_10004038 3300025909 Bacteria 11160
240 Ga0207705_10068214 3300025909 Bacteria 2575
241 Ga0207705_10153729 3300025909 Bacteria 1725
242 Ga0207705_10184851 3300025909 Bacteria 1574
243 Ga0207705_10280859 3300025909 Bacteria 1275
244 Ga0207705_10839452 3300025909 Bacteria 712
245 Ga0207705_11234438 3300025909 Bacteria 573
246 Ga0207654_10003556 3300025911 Bacteria 7880
247 Ga0207654_11146589 3300025911 Bacteria 566
248 Ga0207707_10197380 3300025912 Bacteria 1755
249 Ga0207707_10686813 3300025912 Bacteria 860
250 Ga0207707_10936879 3300025912 Bacteria 714
251 Ga0207695_10010615 3300025913 Bacteria 11257
252 Ga0207671_10017491 3300025914 Bacteria 5525
253 Ga0207660_10123589 3300025917 Bacteria 1963
254 Ga0207660_10182061 3300025917 Bacteria 1632
255 Ga0207660_10189863 3300025917 Bacteria 1599
256 Ga0207660_10310690 3300025917 Bacteria 1257
257 Ga0207657_10000924 3300025919 Bacteria 31097
258 Ga0207657_10009528 3300025919 Bacteria 9752
259 Ga0207657_10283693 3300025919 Bacteria 1314
260 Ga0207657_10368578 3300025919 Bacteria 1132
261 Ga0207657_10416363 3300025919 Bacteria 1056
262 Ga0207649_10000425 3300025920 Bacteria 30960
263 Ga0207649_10122238 3300025920 Bacteria 1757
264 Ga0207652_10053896 3300025921 Bacteria 3455
265 Ga0207652_10153491 3300025921 Bacteria 2062
266 Ga0207652_10214184 3300025921 Bacteria 1735
267 Ga0207652_10221552 3300025921 Bacteria 1705
268 Ga0207652_10620057 3300025921 Bacteria 969
269 Ga0207652_10956237 3300025921 Bacteria 754
270 Ga0207681_10031177 3300025923 Bacteria 3479
271 Ga0207681_10674660 3300025923 Bacteria 858
272 Ga0207694_10075400 3300025924 Bacteria 2640
273 Ga0207650_10024316 3300025925 Bacteria 4305
274 Ga0207650_10382471 3300025925 Bacteria 1162
275 Ga0207659_10175170 3300025926 Bacteria 1695
276 Ga0207700_10386795 3300025928 Bacteria 1224
277 Ga0207664_10061040 3300025929 Bacteria 3007
278 Ga0207644_10017761 3300025931 Bacteria 4809
279 Ga0207644_10131743 3300025931 Bacteria 1915
280 Ga0207644_10328148 3300025931 Bacteria 1238
281 Ga0207644_10333058 3300025931 Bacteria 1229
282 Ga0207644_10435831 3300025931 Unclassified 1075
283 Ga0207690_10004151 3300025932 Bacteria 8564
284 Ga0207690_10181325 3300025932 Bacteria 1586
285 Ga0207690_10194810 3300025932 Bacteria 1535
286 Ga0207690_10340347 3300025932 Bacteria 1184
287 Ga0207690_10636774 3300025932 Bacteria 873
288 Ga0207690_10938029 3300025932 Bacteria 719
289 Ga0207690_10971197 3300025932 Bacteria 706
290 Ga0207706_10006967 3300025933 Bacteria 10448
291 Ga0207706_10083692 3300025933 Bacteria 2805
292 Ga0207706_10491811 3300025933 Bacteria 1059
293 Ga0207709_10000123 3300025935 Bacteria 115697
294 Ga0207669_10000075 3300025937 Bacteria 50601
295 Ga0207704_10116068 3300025938 Bacteria 1821
296 Ga0207704_10264935 3300025938 Bacteria 1298
297 Ga0207665_10110290 3300025939 Bacteria 1932
298 Ga0207691_10148374 3300025940 Bacteria 2063
299 Ga0207691_10575495 3300025940 Bacteria 954
300 Ga0207711_10377734 3300025941 Bacteria 1315
301 Ga0207711_10450180 3300025941 Bacteria 1198
302 Ga0207711_10746154 3300025941 Bacteria 912
303 Ga0207711_11320412 3300025941 Bacteria 663
304 Ga0207661_12108428 3300025944 Unclassified 510
305 Ga0207679_10009970 3300025945 Bacteria 6104
306 Ga0207679_10046268 3300025945 Bacteria 3153
307 Ga0207679_10087696 3300025945 Bacteria 2397
308 Ga0207679_10203812 3300025945 Bacteria 1654
309 Ga0207679_10258054 3300025945 Bacteria 1485
310 Ga0207679_10349595 3300025945 Bacteria 1288
311 Ga0207679_10352660 3300025945 Bacteria 1283
312 Ga0207667_10000010 3300025949 Bacteria 477432
313 Ga0207667_11481721 3300025949 Unclassified 650
314 Ga0207651_10040247 3300025960 Bacteria 3090
315 Ga0207651_10321405 3300025960 Bacteria 1294
316 Ga0207651_10525780 3300025960 Bacteria 1026
317 Ga0207651_11298607 3300025960 Bacteria 654
318 Ga0207651_11900281 3300025960 Bacteria 535
319 Ga0207712_10184125 3300025961 Bacteria 1643
320 Ga0207668_11054231 3300025972 Bacteria 728
321 Ga0207668_12074330 3300025972 Bacteria 512
322 Ga0207640_10001127 3300025981 Bacteria 14700
323 Ga0207640_10241239 3300025981 Bacteria 1397
324 Ga0207640_10361759 3300025981 Bacteria 1169
325 Ga0207640_10411349 3300025981 Bacteria 1104
326 Ga0207640_10503212 3300025981 Bacteria 1009
327 Ga0207658_10022758 3300025986 Bacteria 4366
328 Ga0207658_10392727 3300025986 Bacteria 1218
329 Ga0207677_12010252 3300026023 Bacteria 537
330 Ga0207703_10026989 3300026035 Bacteria 4523
331 Ga0207703_10104765 3300026035 Bacteria 2403
332 Ga0207639_10027728 3300026041 Bacteria 4129
333 Ga0207639_10084572 3300026041 Bacteria 2521
334 Ga0207678_10000716 3300026067 Bacteria 30304
335 Ga0207678_10005198 3300026067 Bacteria 11663
336 Ga0207678_10042409 3300026067 Bacteria 3941
337 Ga0207678_10112471 3300026067 Bacteria 2323
338 Ga0207678_10519346 3300026067 Bacteria 1039
339 Ga0207702_10002235 3300026078 Bacteria 18571
340 Ga0207702_10267550 3300026078 Bacteria 1611
341 Ga0207702_10281170 3300026078 Bacteria 1573
342 Ga0207641_10043809 3300026088 Bacteria 3760
343 Ga0207641_10057710 3300026088 Bacteria 3302
344 Ga0207641_10417386 3300026088 Bacteria 1291
345 Ga0207641_10421234 3300026088 Bacteria 1286
346 Ga0207648_10294025 3300026089 Bacteria 1455
347 Ga0207676_10676371 3300026095 Bacteria 998
348 Ga0207674_10002883 3300026116 Bacteria 21374
349 Ga0207674_10009093 3300026116 Bacteria 11403
350 Ga0207674_10010066 3300026116 Bacteria 10751
351 Ga0207674_10017649 3300026116 Bacteria 7781
352 Ga0207674_10276261 3300026116 Bacteria 1628
353 Ga0207674_10304850 3300026116 Bacteria 1542
354 Ga0207675_100365064 3300026118 Bacteria 1417
355 Ga0207683_10010563 3300026121 Bacteria 7877
356 Ga0207683_10342866 3300026121 Bacteria 1371
357 Ga0207683_11183811 3300026121 Bacteria 708
358 Ga0207698_10080683 3300026142 Bacteria 2622
359 Ga0207698_10126968 3300026142 Bacteria 2171
360 Ga0207698_10423963 3300026142 Bacteria 1277
361 Ga0207698_10679647 3300026142 Bacteria 1022
362 Ga0207698_10792596 3300026142 Bacteria 949
363 Ga0207698_11063662 3300026142 Bacteria 821
364 Ga0209974_10177658 3300027876 Bacteria 778
365 Ga0268266_10000002 3300028379 Bacteria 3059047
366 Ga0268266_10144358 3300028379 Bacteria 2138
367 Ga0268266_11113540 3300028379 Bacteria 764
368 Ga0268265_10119491 3300028380 Bacteria 2168
369 Ga0268265_12017764 3300028380 Bacteria 584
370 Ga0268264_10546323 3300028381 Bacteria 1136
371 Ga0268264_12151692 3300028381 Bacteria 566
372 Ga0307515_10518402 3300028794 Bacteria 802
373 Ga0307408_100030521 3300031548 Bacteria 3744
374 Ga0307408_100340961 3300031548 Bacteria 1268
375 Ga0307408_100674100 3300031548 Bacteria 927
376 Ga0307408_100944370 3300031548 Bacteria 792
377 Ga0307408_102213798 3300031548 Bacteria 531
378 Ga0265314_10039878 3300031711 Bacteria 3377
379 Ga0307405_11207806 3300031731 Bacteria 654
380 Ga0307413_10001835 3300031824 Bacteria 8356
381 Ga0307413_10127946 3300031824 Bacteria 1733
382 Ga0307410_10081144 3300031852 Bacteria 2278
383 Ga0307410_10091355 3300031852 Bacteria 2161
384 Ga0307410_10107681 3300031852 Bacteria 2011
385 Ga0307410_11440341 3300031852 Bacteria 606
386 Ga0307406_10098916 3300031901 Bacteria 1982
387 Ga0307406_10543460 3300031901 Bacteria 949
388 Ga0307406_10962490 3300031901 Bacteria 730
389 Ga0307407_10533032 3300031903 Bacteria 865
390 Ga0307412_10123737 3300031911 Bacteria 1867
391 Ga0307412_10176310 3300031911 Bacteria 1603
392 Ga0307412_11155389 3300031911 Bacteria 691
393 Ga0307409_100094699 3300031995 Bacteria 2458
394 Ga0307409_101136667 3300031995 Bacteria 803
395 Ga0307409_101942324 3300031995 Bacteria 618
396 Ga0307416_100117276 3300032002 Bacteria 2363
397 Ga0307416_101097283 3300032002 Bacteria 900
398 Ga0307416_101119132 3300032002 Bacteria 892
399 Ga0307414_10034928 3300032004 Bacteria 3339
400 Ga0307414_11527448 3300032004 Bacteria 622
401 Ga0307411_10035791 3300032005 Bacteria 3104
402 Ga0307411_10278004 3300032005 Bacteria 1331
403 Ga0307415_101552791 3300032126 Bacteria 635
404 Ga0307415_101762300 3300032126 Unclassified 598
405 Ga0373940_0167629 3300035088 Bacteria 708
406 Ga0373923_0116163 3300035111 Bacteria 1192
407 Ga0373955_0000253 3300035172 Bacteria 22174
408 Ga0373961_0049842 3300035241 Bacteria 1239
409 Ga0373933_0133845 3300035724 Bacteria 1560
410 Ga0373937_0005450 3300036401 Bacteria 10892
411 Ga0373937_0726489 3300036401 Bacteria 940
412 Ga0395899_0000804 3300037312 Bacteria 30745
413 Ga0395899_0015688 3300037312 Bacteria 5777
414 Ga0395899_0027640 3300037312 Bacteria 4274
415 Ga0395899_0153174 3300037312 Bacteria 1633
416 Ga0395899_0192514 3300037312 Bacteria 1426
417 Ga0395900_0001255 3300037418 Bacteria 31098
418 Ga0395900_0014107 3300037418 Bacteria 8158
419 Ga0395900_0079100 3300037418 Bacteria 3378
420 Ga0395900_0079571 3300037418 Bacteria 3368
421 Ga0395900_0161986 3300037418 Bacteria 2281
422 Ga0395900_0690229 3300037418 Bacteria 955
423 Ga0395900_1215040 3300037418 Bacteria 669
424 Ga0395898_0013178 3300037466 Bacteria 8517
425 Ga0395898_0059655 3300037466 Bacteria 3710
426 Ga0395898_0363973 3300037466 Bacteria 1379
427 Ga0395898_1181272 3300037466 Bacteria 697
428 Ga0395905_0001765 3300037471 Bacteria 25140
429 Ga0395905_0039865 3300037471 Bacteria 4406
430 Ga0395905_0044295 3300037471 Bacteria 4176
431 Ga0395905_0054828 3300037471 Bacteria 3730
432 Ga0395905_0071284 3300037471 Bacteria 3258
433 Ga0395905_0150945 3300037471 Bacteria 2186
434 Ga0395905_0213449 3300037471 Bacteria 1808
435 Ga0395905_0245296 3300037471 Bacteria 1673
436 Ga0395905_0290646 3300037471 Bacteria 1521
437 Ga0395905_0294885 3300037471 Bacteria 1508
438 Ga0395905_1154333 3300037471 Bacteria 678
439 Ga0395901_0001481 3300038443 Bacteria 24431
440 Ga0395901_0014485 3300038443 Bacteria 8020
441 Ga0395901_0052884 3300038443 Bacteria 4221
442 Ga0395901_0092776 3300038443 Bacteria 3161
443 Ga0395901_0319764 3300038443 Bacteria 1606
444 Ga0395901_0726332 3300038443 Bacteria 988
445 Ga0436365_1417149 3300039437 Bacteria 742
446 Ga0436362_0466311 3300039453 Bacteria 1091
447 Ga0451807_0632196 3300041486 Bacteria 792
448 Ga0451851_1111134 3300041507 Bacteria 934
449 Ga0439462_0177259 3300042015 Bacteria 604
450 Ga0466969_0186507 3300044656 Bacteria 949
451 Ga0466972_0324479 3300044658 Bacteria 720
452 Ga0466966_0191242 3300044684 Bacteria 1240
453 Ga0466961_0119474 3300044693 Bacteria 1655
454 Ga0466963_0089995 3300044694 Bacteria 2089
455 Ga0466963_0095374 3300044694 Bacteria 2030
456 Ga0466963_0656888 3300044694 Bacteria 740
457 Ga0466970_0298635 3300044765 Bacteria 908
458 Ga0466957_0118472 3300044842 Bacteria 1686
459 Ga0466957_0362785 3300044842 Bacteria 985
460 Ga0466958_0271466 3300045836 Bacteria 1086
461 Ga0466967_0011320 3300045976 Bacteria 6747
462 Ga0466967_0022293 3300045976 Bacteria 5164
463 Ga0466967_0042968 3300045976 Bacteria 3911
464 Ga0466967_0069141 3300045976 Bacteria 3155
465 Ga0466967_0462912 3300045976 Bacteria 1241
466 Ga0466967_0521593 3300045976 Bacteria 1167
467 Ga0466967_0616820 3300045976 Bacteria 1071
468 Ga0466967_1664304 3300045976 Bacteria 636
469 Ga0495584_0097328 3300046491 Bacteria 1486
470 Ga0495596_0024179 3300046500 Bacteria 2463
471 Ga0495583_0016410 3300046506 Bacteria 3981
472 Ga0495583_0029760 3300046506 Bacteria 2668
473 Ga0495583_0050233 3300046506 Bacteria 1906
474 Ga0495583_0071836 3300046506 Bacteria 1519
475 Ga0495620_0057592 3300046515 Bacteria 1630
476 Ga0495631_0013338 3300046518 Bacteria 3991
477 Ga0495637_0029931 3300046520 Bacteria 2419
478 Ga0495648_0000166 3300046524 Bacteria 77879
479 Ga0495663_0000428 3300046525 Bacteria 15367
480 Ga0495663_0011336 3300046525 Bacteria 2482
481 Ga0495663_0212287 3300046525 Bacteria 678
482 Ga0495642_0551083 3300046528 Bacteria 511
483 Ga0495665_0077932 3300046531 Bacteria 1744
484 Ga0495598_0355652 3300046537 Bacteria 565
485 Ga0495621_0000895 3300046539 Bacteria 7597
486 Ga0495621_0094426 3300046539 Unclassified 1131
487 Ga0495621_0140426 3300046539 Bacteria 945
488 Ga0495621_0167173 3300046539 Bacteria 872
489 Ga0495667_0860108 3300046559 Bacteria 557
490 Ga0495668_0036652 3300046616 Bacteria 2747
491 Ga0495668_0040255 3300046616 Bacteria 2607
492 Ga0495668_0469452 3300046616 Bacteria 693
493 Ga0495611_0022728 3300046648 Bacteria 2715
494 Ga0495625_0000910 3300046660 Bacteria 39828
495 Ga0495625_0020402 3300046660 Bacteria 5117
496 Ga0495625_0034731 3300046660 Bacteria 3719
497 Ga0495625_0310169 3300046660 Bacteria 1007
498 Ga0495669_0000144 3300046684 Bacteria 45112
499 Ga0495669_0000398 3300046684 Bacteria 21390
500 Ga0495669_0003971 3300046684 Bacteria 6086
501 Ga0495669_0008645 3300046684 Bacteria 4285
502 Ga0495669_0028606 3300046684 Bacteria 2442
503 Ga0495669_0072529 3300046684 Bacteria 1571
504 Ga0495669_0148589 3300046684 Bacteria 1108
505 Ga0495669_0175948 3300046684 Bacteria 1019
506 Ga0495669_0271384 3300046684 Bacteria 815
507 Ga0495670_0524302 3300046691 Bacteria 644
508 Ga0495649_0307001 3300046694 Bacteria 807
509 Ga0495660_0038387 3300046810 Bacteria 2663
510 Ga0495683_0002205 3300047323 Bacteria 11930
511 Ga0495687_000683 3300047443 Bacteria 38503
512 Ga0495687_004109 3300047443 Bacteria 10067
513 Ga0495675_0423853 3300047444 Bacteria 773
514 Ga0495677_0052003 3300047445 Bacteria 1509
515 Ga0495677_0057649 3300047445 Bacteria 1436
516 Ga0495677_0087921 3300047445 Bacteria 1169
517 Ga0495677_0185458 3300047445 Bacteria 807
518 Ga0495677_0317745 3300047445 Bacteria 613
519 Ga0495681_0026687 3300047470 Bacteria 3001
520 Ga0495602_0014256 3300048088 Bacteria 8076
521 Ga0496100_1162856 3300048903 Bacteria 608
522 Ga0496101_0051028 3300048904 Bacteria 2980
523 Ga0496101_0318604 3300048904 Bacteria 1220
524 Ga0496101_0421665 3300048904 Bacteria 1052
525 Ga0496103_0141061 3300048906 Bacteria 1541
526 Ga0496104_0666526 3300048907 Bacteria 949
527 Ga0496106_0427910 3300048909 Bacteria 1064
528 Ga0496107_0073298 3300048910 Bacteria 2490
529 Ga0496107_0600418 3300048910 Bacteria 813
530 Ga0496107_1314845 3300048910 Bacteria 517
531 Ga0496108_0019917 3300048911 Bacteria 5510
532 Ga0496108_0397565 3300048911 Bacteria 1203
533 Ga0496108_0701855 3300048911 Bacteria 877
534 Ga0496108_1603374 3300048911 Unclassified 538
535 Ga0496109_0023291 3300048912 Bacteria 5494
536 Ga0496109_0204901 3300048912 Bacteria 1855
537 Ga0496109_0296463 3300048912 Bacteria 1524
538 Ga0496109_0630945 3300048912 Bacteria 1008
539 Ga0496109_0808985 3300048912 Bacteria 875
540 Ga0496109_1196017 3300048912 Bacteria 697
541 Ga0496110_0035943 3300048913 Bacteria 4301
542 Ga0496110_0962678 3300048913 Unclassified 760
543 Ga0496111_0008533 3300048914 Bacteria 6789
544 Ga0496112_0296680 3300048915 Bacteria 1562
545 Ga0496112_0396740 3300048915 Bacteria 1319
546 Ga0496112_0475106 3300048915 Bacteria 1187
547 Ga0496112_1069141 3300048915 Bacteria 725
548 Ga0496113_0013385 3300048916 Bacteria 5555
549 Ga0496113_0156608 3300048916 Bacteria 1799
550 Ga0496113_0629848 3300048916 Bacteria 858
551 Ga0496114_0100090 3300048917 Bacteria 2473
552 Ga0496115_0013131 3300048918 Bacteria 6255
553 Ga0496119_0418843 3300048922 Unclassified 636
554 Ga0496122_0038014 3300048925 Bacteria 3864
555 Ga0496123_0067043 3300048926 Bacteria 2269
556 Ga0496125_0002814 3300048928 Bacteria 21955
557 Ga0496126_0048266 3300048929 Bacteria 3892
558 Ga0501039_1232247 3300049575 Bacteria 578
559 Ga0501067_0044149 3300049583 Bacteria 2477
560 Ga0501069_0180787 3300049585 Bacteria 1219
561 Ga0501258_042804 3300049687 Unclassified 610
562 Ga0501234_083430 3300049707 Unclassified 566
563 Ga0495612_0149855 3300053078 Bacteria 1015
564 Ga0500610_0054004 3300053079 Bacteria 2094
565 Ga0495655_0005531 3300053083 Bacteria 2238
566 Ga0500642_0002737 3300053130 Bacteria 5223
567 Ga0500559_0478526 3300053136 Unclassified 574
568 Ga0500636_0082352 3300053177 Bacteria 1852
569 Ga0500645_000062 3300053730 Bacteria 85561
570 2643997067 2643221597 Bacteria 3347721
571 Ga0395900_0380191
572 JGI24741J21665_1008233
573 JGI24740J21852_10000934
574 JGI24740J21852_10007082
575 JGI24739J22299_10016337
576 JGI24737J22298_10003999
577 JGI24742J22300_10013949
578 JGI25153J46596_10000006
579 rootH2_10146856
580 rootH2_10160292
581 Ga0055525_1000040
582 Ga0055542_1000046
583 Ga0055529_1000007
584 Ga0065165_1128787
585 Ga0070658_10001586
586 Ga0070658_10008339
587 Ga0070658_10022146
588 Ga0070658_10039181
589 Ga0070658_10049395
590 Ga0070658_10549319
591 Ga0070658_10568875
592 Ga0070676_10027014
593 Ga0070676_10158234
594 Ga0070676_10381566
595 Ga0070670_100029221
596 Ga0070670_100081068
597 Ga0070670_100187796
598 Ga0070677_10397973
599 Ga0070666_10129087
600 Ga0070666_10473556
601 Ga0070666_10779045
602 Ga0070680_100028532
603 Ga0070680_100349368
604 Ga0070680_100549794
605 Ga0070682_100354849
606 Ga0070682_101256209
607 Ga0068868_100942274
608 Ga0070660_100020441
609 Ga0070660_100593598
610 Ga0070660_101189669
611 Ga0070689_101069583
612 Ga0070661_100077959
613 Ga0070661_100082096
614 Ga0070661_100113897
615 Ga0070661_100116444
616 Ga0070661_100158615
617 Ga0070661_100194253
618 Ga0070661_100482550
619 Ga0070692_10048255
620 Ga0070692_10780547
621 Ga0070669_100022141
622 Ga0070669_100029026
623 Ga0070675_100017062
624 Ga0070675_100342912
625 Ga0070671_100032608
626 Ga0070671_100034116
627 Ga0070671_100088332
628 Ga0070671_100116241
629 Ga0070671_100766142
630 Ga0070674_100015935
631 Ga0070674_100265463
632 Ga0070673_100130715
633 Ga0070673_100661828
634 Ga0070673_101064728
635 Ga0070673_101070314
636 Ga0070659_100059869
637 Ga0070659_100195702
638 Ga0070659_100387756
639 Ga0070659_100392420
640 Ga0070659_100744331
641 Ga0070659_101125625
642 Ga0070667_100266353
643 Ga0070714_100274209
644 Ga0070713_100086908
645 Ga0070663_100011131
646 Ga0070663_100012223
647 Ga0070663_100249196
648 Ga0070663_100336749
649 Ga0070663_100344894
650 Ga0070663_100705992
651 Ga0070678_100049444
652 Ga0070678_100093853
653 Ga0070678_100836230
654 Ga0070662_100064510
655 Ga0070662_100450752
656 Ga0070681_10085833
657 Ga0070681_10146657
658 Ga0070681_10171061
659 Ga0070681_10274393
660 Ga0068867_101353955
661 Ga0070679_100013152
662 Ga0070679_100152349
663 Ga0070679_100218542
664 Ga0070679_100237555
665 Ga0070679_101748565
666 Ga0070684_100073599
667 Ga0068853_100033437
668 Ga0068853_100059281
669 Ga0068853_100449756
670 Ga0068853_102200789
671 Ga0070672_100447888
672 Ga0070672_100532364
673 Ga0070665_100000458
674 Ga0070665_100013438
675 Ga0070665_100028525
676 Ga0070665_100389286
677 Ga0070665_101284901
678 Ga0068855_100889158
679 Ga0070664_100001856
680 Ga0070664_100002946
681 Ga0070664_100093041
682 Ga0070664_100126257
683 Ga0070664_100556690
684 Ga0070664_100653229
685 Ga0070664_101146402
686 Ga0070664_101518574
687 Ga0070664_101945235
688 Ga0068857_100132784
689 Ga0068857_100197030
690 Ga0068857_101809939
691 Ga0068854_100072310
692 Ga0068854_100087160
693 Ga0068856_100048898
694 Ga0068856_100122149
695 Ga0068856_100147808
696 Ga0068852_100014033
697 Ga0068852_100040235
698 Ga0068852_100118705
699 Ga0068852_100796742
700 Ga0068852_101109126
701 Ga0068852_101111432
702 Ga0068859_100012846
703 Ga0068859_100276234
704 Ga0068864_100016289
705 Ga0068864_100046258
706 Ga0068866_10030925
707 Ga0068861_100458929
708 Ga0068861_100796501
709 Ga0068851_10114786
710 Ga0068851_10273070
711 Ga0068863_100010487
712 Ga0068863_100012766
713 Ga0068863_100052822
714 Ga0068863_100440318
715 Ga0068863_101817632
716 Ga0068858_100011050
717 Ga0068858_100016316
718 Ga0068858_100411407
719 Ga0068860_100314511
720 Ga0068860_100635345
721 Ga0068862_100599336
722 Ga0070717_10059738
723 Ga0070716_100125892
724 Ga0097621_100011395
725 Ga0097621_100163942
726 Ga0068871_100138891
727 Ga0068871_100414820
728 Ga0075428_100183299
729 Ga0068865_100046843
730 Ga0068865_100357464
731 Ga0097620_100012846
732 Ga0097620_100276242
733 Ga0105251_10333263
734 Ga0105240_10107467
735 Ga0105243_10000202
736 Ga0105241_10007093
737 Ga0105242_11433913
738 Ga0105248_10109696
739 Ga0105248_10143943
740 Ga0105248_10443003
741 Ga0105248_10713939
742 Ga0105248_11269602
743 Ga0105237_10049755
744 Ga0105237_10084102
745 Ga0105238_10133952
746 Ga0105238_12408145
747 Ga0105249_10117044
748 Ga0105249_11995566
749 Ga0105246_10479778
750 Ga0105246_11610603
751 Ga0157347_1036955
752 Ga0157327_1027615
753 Ga0157326_1002397
754 Ga0157373_10017805
755 Ga0157373_10018852
756 Ga0157373_10213769
757 Ga0157373_10366400
758 Ga0157373_10901388
759 Ga0157371_10000024
760 Ga0157371_10187629
761 Ga0157371_10615971
762 Ga0157370_10004183
763 Ga0157370_11500990
764 Ga0157369_10053972
765 Ga0157369_12113989
766 Ga0157374_10093958
767 Ga0157374_10130764
768 Ga0157374_10668338
769 Ga0163162_10172531
770 Ga0163162_10992439
771 Ga0157372_10797784
772 Ga0157372_11537804
773 Ga0157375_11484798
774 Ga0157375_13313104
775 Ga0163163_10217754
776 Ga0163163_10795838
777 Ga0163163_10899306
778 Ga0157380_10796601
779 Ga0157379_10021453
780 Ga0157376_10847333
781 Ga0163161_10737103
782 Ga0213876_10287476
783 Ga0209563_100019
784 Ga0209646_1005326
785 Ga0209026_1061376
786 Ga0209677_120846
787 Ga0209148_1000026
788 Ga0207666_1073493
789 Ga0209455_1000005
790 Ga0209758_1000001
791 Ga0207697_10021788
792 Ga0207697_10176816
793 Ga0207656_10000739
794 Ga0207656_10082759
795 Ga0207713_1196730
796 Ga0207642_10022494
797 Ga0207688_10131891
798 Ga0207680_10183193
799 Ga0207680_10848779
800 Ga0207680_10910979
801 Ga0207647_10011074
802 Ga0207647_10021329
803 Ga0207647_10069902
804 Ga0207645_10005127
805 Ga0207645_10036682
806 Ga0207645_10907956
807 Ga0207705_10000984
808 Ga0207705_10001710
809 Ga0207705_10004038
810 Ga0207705_10068214
811 Ga0207705_10153729
812 Ga0207705_10184851
813 Ga0207705_10280859
814 Ga0207705_10839452
815 Ga0207705_11234438
816 Ga0207654_10003556
817 Ga0207654_11146589
818 Ga0207707_10197380
819 Ga0207707_10686813
820 Ga0207707_10936879
821 Ga0207695_10010615
822 Ga0207671_10017491
823 Ga0207660_10123589
824 Ga0207660_10182061
825 Ga0207660_10189863
826 Ga0207660_10310690
827 Ga0207657_10000924
828 Ga0207657_10009528
829 Ga0207657_10283693
830 Ga0207657_10368578
831 Ga0207657_10416363
832 Ga0207649_10000425
833 Ga0207649_10122238
834 Ga0207652_10053896
835 Ga0207652_10153491
836 Ga0207652_10214184
837 Ga0207652_10221552
838 Ga0207652_10620057
839 Ga0207652_10956237
840 Ga0207681_10031177
841 Ga0207681_10674660
842 Ga0207694_10075400
843 Ga0207650_10024316
844 Ga0207650_10382471
845 Ga0207659_10175170
846 Ga0207700_10386795
847 Ga0207664_10061040
848 Ga0207644_10017761
849 Ga0207644_10131743
850 Ga0207644_10328148
851 Ga0207644_10333058
852 Ga0207644_10435831
853 Ga0207690_10004151
854 Ga0207690_10181325
855 Ga0207690_10194810
856 Ga0207690_10340347
857 Ga0207690_10636774
858 Ga0207690_10938029
859 Ga0207690_10971197
860 Ga0207706_10006967
861 Ga0207706_10083692
862 Ga0207706_10491811
863 Ga0207709_10000123
864 Ga0207669_10000075
865 Ga0207704_10116068
866 Ga0207704_10264935
867 Ga0207665_10110290
868 Ga0207691_10148374
869 Ga0207691_10575495
870 Ga0207711_10377734
871 Ga0207711_10450180
872 Ga0207711_10746154
873 Ga0207711_11320412
874 Ga0207661_12108428
875 Ga0207679_10009970
876 Ga0207679_10046268
877 Ga0207679_10087696
878 Ga0207679_10203812
879 Ga0207679_10258054
880 Ga0207679_10349595
881 Ga0207679_10352660
882 Ga0207667_10000010
883 Ga0207667_11481721
884 Ga0207651_10040247
885 Ga0207651_10321405
886 Ga0207651_10525780
887 Ga0207651_11298607
888 Ga0207651_11900281
889 Ga0207712_10184125
890 Ga0207668_11054231
891 Ga0207668_12074330
892 Ga0207640_10001127
893 Ga0207640_10241239
894 Ga0207640_10361759
895 Ga0207640_10411349
896 Ga0207640_10503212
897 Ga0207658_10022758
898 Ga0207658_10392727
899 Ga0207677_12010252
900 Ga0207703_10026989
901 Ga0207703_10104765
902 Ga0207639_10027728
903 Ga0207639_10084572
904 Ga0207678_10000716
905 Ga0207678_10005198
906 Ga0207678_10042409
907 Ga0207678_10112471
908 Ga0207678_10519346
909 Ga0207702_10002235
910 Ga0207702_10267550
911 Ga0207702_10281170
912 Ga0207641_10043809
913 Ga0207641_10057710
914 Ga0207641_10417386
915 Ga0207641_10421234
916 Ga0207648_10294025
917 Ga0207676_10676371
918 Ga0207674_10002883
919 Ga0207674_10009093
920 Ga0207674_10010066
921 Ga0207674_10017649
922 Ga0207674_10276261
923 Ga0207674_10304850
924 Ga0207675_100365064
925 Ga0207683_10010563
926 Ga0207683_10342866
927 Ga0207683_11183811
928 Ga0207698_10080683
929 Ga0207698_10126968
930 Ga0207698_10423963
931 Ga0207698_10679647
932 Ga0207698_10792596
933 Ga0207698_11063662
934 Ga0209974_10177658
935 Ga0268266_10000002
936 Ga0268266_10144358
937 Ga0268266_11113540
938 Ga0268265_10119491
939 Ga0268265_12017764
940 Ga0268264_10546323
941 Ga0268264_12151692
942 Ga0307515_10518402
943 Ga0307408_100030521
944 Ga0307408_100340961
945 Ga0307408_100674100
946 Ga0307408_100944370
947 Ga0307408_102213798
948 Ga0265314_10039878
949 Ga0307405_11207806
950 Ga0307413_10001835
951 Ga0307413_10127946
952 Ga0307410_10081144
953 Ga0307410_10091355
954 Ga0307410_10107681
955 Ga0307410_11440341
956 Ga0307406_10098916
957 Ga0307406_10543460
958 Ga0307406_10962490
959 Ga0307407_10533032
960 Ga0307412_10123737
961 Ga0307412_10176310
962 Ga0307412_11155389
963 Ga0307409_100094699
964 Ga0307409_101136667
965 Ga0307409_101942324
966 Ga0307416_100117276
967 Ga0307416_101097283
968 Ga0307416_101119132
969 Ga0307414_10034928
970 Ga0307414_11527448
971 Ga0307411_10035791
972 Ga0307411_10278004
973 Ga0307415_101552791
974 Ga0307415_101762300
975 Ga0373940_0167629
976 Ga0373923_0116163
977 Ga0373955_0000253
978 Ga0373961_0049842
979 Ga0373933_0133845
980 Ga0373937_0005450
981 Ga0373937_0726489
982 Ga0395899_0000804
983 Ga0395899_0015688
984 Ga0395899_0027640
985 Ga0395899_0153174
986 Ga0395899_0192514
987 Ga0395900_0001255
988 Ga0395900_0014107
989 Ga0395900_0079100
990 Ga0395900_0079571
991 Ga0395900_0161986
992 Ga0395900_0690229
993 Ga0395900_1215040
994 Ga0395898_0013178
995 Ga0395898_0059655
996 Ga0395898_0363973
997 Ga0395898_1181272
998 Ga0395905_0001765
999 Ga0395905_0039865
1000 Ga0395905_0044295
1001 Ga0395905_0054828
1002 Ga0395905_0071284
1003 Ga0395905_0150945
1004 Ga0395905_0213449
1005 Ga0395905_0245296
1006 Ga0395905_0290646
1007 Ga0395905_0294885
1008 Ga0395905_1154333
1009 Ga0395901_0001481
1010 Ga0395901_0014485
1011 Ga0395901_0052884
1012 Ga0395901_0092776
1013 Ga0395901_0319764
1014 Ga0395901_0726332
1015 Ga0436365_1417149
1016 Ga0436362_0466311
1017 Ga0451807_0632196
1018 Ga0451851_1111134
1019 Ga0439462_0177259
1020 Ga0466969_0186507
1021 Ga0466972_0324479
1022 Ga0466966_0191242
1023 Ga0466961_0119474
1024 Ga0466963_0089995
1025 Ga0466963_0095374
1026 Ga0466963_0656888
1027 Ga0466970_0298635
1028 Ga0466957_0118472
1029 Ga0466957_0362785
1030 Ga0466958_0271466
1031 Ga0466967_0011320
1032 Ga0466967_0022293
1033 Ga0466967_0042968
1034 Ga0466967_0069141
1035 Ga0466967_0462912
1036 Ga0466967_0521593
1037 Ga0466967_0616820
1038 Ga0466967_1664304
1039 Ga0495584_0097328
1040 Ga0495596_0024179
1041 Ga0495583_0016410
1042 Ga0495583_0029760
1043 Ga0495583_0050233
1044 Ga0495583_0071836
1045 Ga0495620_0057592
1046 Ga0495631_0013338
1047 Ga0495637_0029931
1048 Ga0495648_0000166
1049 Ga0495663_0000428
1050 Ga0495663_0011336
1051 Ga0495663_0212287
1052 Ga0495642_0551083
1053 Ga0495665_0077932
1054 Ga0495598_0355652
1055 Ga0495621_0000895
1056 Ga0495621_0094426
1057 Ga0495621_0140426
1058 Ga0495621_0167173
1059 Ga0495667_0860108
1060 Ga0495668_0036652
1061 Ga0495668_0040255
1062 Ga0495668_0469452
1063 Ga0495611_0022728
1064 Ga0495625_0000910
1065 Ga0495625_0020402
1066 Ga0495625_0034731
1067 Ga0495625_0310169
1068 Ga0495669_0000144
1069 Ga0495669_0000398
1070 Ga0495669_0003971
1071 Ga0495669_0008645
1072 Ga0495669_0028606
1073 Ga0495669_0072529
1074 Ga0495669_0148589
1075 Ga0495669_0175948
1076 Ga0495669_0271384
1077 Ga0495670_0524302
1078 Ga0495649_0307001
1079 Ga0495660_0038387
1080 Ga0495683_0002205
1081 Ga0495687_000683
1082 Ga0495687_004109
1083 Ga0495675_0423853
1084 Ga0495677_0052003
1085 Ga0495677_0057649
1086 Ga0495677_0087921
1087 Ga0495677_0185458
1088 Ga0495677_0317745
1089 Ga0495681_0026687
1090 Ga0495602_0014256
1091 Ga0496100_1162856
1092 Ga0496101_0051028
1093 Ga0496101_0318604
1094 Ga0496101_0421665
1095 Ga0496103_0141061
1096 Ga0496104_0666526
1097 Ga0496106_0427910
1098 Ga0496107_0073298
1099 Ga0496107_0600418
1100 Ga0496107_1314845
1101 Ga0496108_0019917
1102 Ga0496108_0397565
1103 Ga0496108_0701855
1104 Ga0496108_1603374
1105 Ga0496109_0023291
1106 Ga0496109_0204901
1107 Ga0496109_0296463
1108 Ga0496109_0630945
1109 Ga0496109_0808985
1110 Ga0496109_1196017
1111 Ga0496110_0035943
1112 Ga0496110_0962678
1113 Ga0496111_0008533
1114 Ga0496112_0296680
1115 Ga0496112_0396740
1116 Ga0496112_0475106
1117 Ga0496112_1069141
1118 Ga0496113_0013385
1119 Ga0496113_0156608
1120 Ga0496113_0629848
1121 Ga0496114_0100090
1122 Ga0496115_0013131
1123 Ga0496119_0418843
1124 Ga0496122_0038014
1125 Ga0496123_0067043
1126 Ga0496125_0002814
1127 Ga0496126_0048266
1128 Ga0501039_1232247
1129 Ga0501067_0044149
1130 Ga0501069_0180787
1131 Ga0501258_042804
1132 Ga0501234_083430
1133 Ga0495612_0149855
1134 Ga0500610_0054004
1135 Ga0495655_0005531
1136 Ga0500642_0002737
1137 Ga0500559_0478526
1138 Ga0500636_0082352
1139 Ga0500645_000062
1140 2643997067

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

23

128

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3rhe-assembly1.cif.gz_A the crystal structure of nad-dependent benzaldehyde dehydrogenase from legionella pneumophila 0.8154 6 110
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7942 2 112
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7903 1 112
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.7842 1 112
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.782 2 112
ID Description Score Start End Superfamily
af_P9WKQ3_98_165_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.9193 63 112 3.30.720.110
3m2oB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8666 63 108 3.30.720.110
3itwB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8501 63 109 3.30.720.110
2kjzB02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8456 63 110 3.30.720.110
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.834 63 112 3.30.720.110
ID Description Score Start End GO Terms
AF-A0A090S908-F1-model_v4 deleted 0.9727 63 112
AF-A0A658G1N3-F1-model_v4 deleted 0.966 65 110
AF-A0A7W1BFX7-F1-model_v4 Glyoxalase/fosfomycin resistance/dioxygenase domain-containing protein 0.9658 63 112
AF-R4YZ40-F1-model_v4 Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily protein 0.9602 63 112 GO:0051213
AF-A0A257JPE9-F1-model_v4 VOC domain-containing protein 0.9581 1 110

Map