F464827

General Info

Members Datasets Scaffolds Average Seq Length
570 313 1140 116

Family's Representative Sequence

Representative Sequence 3300013308|Ga0157375_11753945|Ga0157375_117539452
Length 136
Sequence MAESKTGTISANAKKRTGSQVSRKRRSAVTKRNARLRKKVQGSAQRPRISVFRSNRGISAQLIDDDAGRTLAAVNWTEAELRGLSRADQPKRVGELIAERAKAAGITEAVFDRGGYQYHGRVRALADGAREGGLAF

Samples

Sample ID Description Type Environment
1 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
47 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
48 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
54 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
65 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
77 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
78 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
79 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
85 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
87 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
88 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
89 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
96 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
97 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
98 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
109 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
159 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
164 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
165 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
166 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
167 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
168 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
171 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
175 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
176 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
184 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
185 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
186 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
193 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
194 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
195 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
196 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
197 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
198 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
199 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
200 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
201 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
202 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
203 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
204 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
205 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
206 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
207 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
208 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
209 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
212 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
213 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
214 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
215 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
216 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
217 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
218 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
219 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
220 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
221 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
222 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
223 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
224 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
225 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
226 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
227 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
232 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
233 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
234 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
235 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
236 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
237 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
238 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
239 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
240 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
241 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
242 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
250 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
257 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
258 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
259 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
260 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
263 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
264 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
265 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
266 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
267 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
268 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
269 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
270 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
271 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
272 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
273 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
274 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
275 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
276 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
277 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
278 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
279 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
280 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
281 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
282 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
283 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
284 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
285 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
286 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
287 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
292 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
297 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
298 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
299 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
300 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
301 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
302 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
303 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
304 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
305 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
306 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
307 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
308 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
309 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
310 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
311 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
312 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
313 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.23
Nodule 0
Rhizoplane 7.72
Rhizosphere 87.37
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157375_11753945 3300013308 Bacteria 736
2 JGI24746J21847_1020519 3300001977 Bacteria 927
3 JGI24749J21850_1019971 3300002076 Bacteria 946
4 JGI24744J21845_10011794 3300002077 Bacteria 1782
5 JGI24751J29686_10014668 3300002459 Bacteria 1616
6 JGI25407J50210_10006859 3300003373 Bacteria 2845
7 Ga0070658_10863268 3300005327 Bacteria 787
8 Ga0070676_10114803 3300005328 Bacteria 1682
9 Ga0070676_10295767 3300005328 Bacteria 1096
10 Ga0070683_100015421 3300005329 Bacteria 6711
11 Ga0070683_101113453 3300005329 Bacteria 758
12 Ga0070670_100002726 3300005331 Bacteria 14597
13 Ga0070670_101858327 3300005331 Bacteria 555
14 Ga0068869_100022221 3300005334 Bacteria 4369
15 Ga0068869_100087628 3300005334 Bacteria 2335
16 Ga0070680_101048092 3300005336 Bacteria 705
17 Ga0070682_100009345 3300005337 Bacteria 5549
18 Ga0068868_100064173 3300005338 Bacteria 2915
19 Ga0068868_100098882 3300005338 Bacteria 2360
20 Ga0068868_100549546 3300005338 Bacteria 1018
21 Ga0070660_100139990 3300005339 Bacteria 1941
22 Ga0070660_100870603 3300005339 Bacteria 759
23 Ga0070689_100364622 3300005340 Bacteria 1214
24 Ga0070689_101784265 3300005340 Bacteria 561
25 Ga0070691_10036588 3300005341 Bacteria 2314
26 Ga0070691_10273636 3300005341 Bacteria 913
27 Ga0070691_10624426 3300005341 Bacteria 639
28 Ga0070687_100073999 3300005343 Bacteria 1838
29 Ga0070692_10227381 3300005345 Bacteria 1106
30 Ga0070668_100184321 3300005347 Bacteria 1707
31 Ga0070668_100801816 3300005347 Bacteria 837
32 Ga0070668_100896025 3300005347 Bacteria 793
33 Ga0070669_100067688 3300005353 Bacteria 2635
34 Ga0070669_100904826 3300005353 Bacteria 754
35 Ga0070675_100009573 3300005354 Bacteria 7541
36 Ga0070675_101975966 3300005354 Bacteria 538
37 Ga0070674_100011725 3300005356 Bacteria 5347
38 Ga0070674_100132980 3300005356 Bacteria 1857
39 Ga0070674_101699937 3300005356 Bacteria 571
40 Ga0070673_100009174 3300005364 Bacteria 6630
41 Ga0070688_100010080 3300005365 Bacteria 5195
42 Ga0070659_100000160 3300005366 Bacteria 51528
43 Ga0070659_100461407 3300005366 Bacteria 1079
44 Ga0070714_100002996 3300005435 Bacteria 12517
45 Ga0070714_100329418 3300005435 Bacteria 1430
46 Ga0070714_100409185 3300005435 Bacteria 1284
47 Ga0070714_102114430 3300005435 Bacteria 548
48 Ga0070714_102265563 3300005435 Bacteria 528
49 Ga0070713_100482794 3300005436 Bacteria 1167
50 Ga0070713_100589040 3300005436 Bacteria 1056
51 Ga0070713_100778506 3300005436 Bacteria 916
52 Ga0070710_10000005 3300005437 Bacteria 238049
53 Ga0070710_10007649 3300005437 Bacteria 5238
54 Ga0070710_11043148 3300005437 Bacteria 598
55 Ga0070701_10746123 3300005438 Bacteria 663
56 Ga0070711_100014201 3300005439 Bacteria 5014
57 Ga0070705_100002004 3300005440 Bacteria 10415
58 Ga0070705_100580974 3300005440 Bacteria 864
59 Ga0070700_100048730 3300005441 Bacteria 2627
60 Ga0070700_100069500 3300005441 Bacteria 2243
61 Ga0070694_100095994 3300005444 Bacteria 2089
62 Ga0070694_101165334 3300005444 Bacteria 645
63 Ga0070678_101427585 3300005456 Bacteria 647
64 Ga0070678_102136341 3300005456 Bacteria 531
65 Ga0070662_100034903 3300005457 Bacteria 3549
66 Ga0070662_100377263 3300005457 Bacteria 1167
67 Ga0070681_10360656 3300005458 Bacteria 1364
68 Ga0068867_100053386 3300005459 Bacteria 2985
69 Ga0068867_100067100 3300005459 Bacteria 2673
70 Ga0068867_100602014 3300005459 Bacteria 959
71 Ga0068867_100707032 3300005459 Bacteria 890
72 Ga0070685_10005868 3300005466 Bacteria 6247
73 Ga0070706_100996339 3300005467 Bacteria 773
74 Ga0070707_101580516 3300005468 Bacteria 623
75 Ga0070698_101585524 3300005471 Bacteria 607
76 Ga0070679_101631323 3300005530 Bacteria 593
77 Ga0070679_101799189 3300005530 Bacteria 561
78 Ga0070684_100022860 3300005535 Bacteria 5220
79 Ga0070684_100684458 3300005535 Bacteria 956
80 Ga0070684_101132636 3300005535 Bacteria 735
81 Ga0070684_101921670 3300005535 Bacteria 558
82 Ga0068853_101482612 3300005539 Bacteria 657
83 Ga0070686_100537385 3300005544 Bacteria 912
84 Ga0070686_101025998 3300005544 Bacteria 678
85 Ga0070695_100054287 3300005545 Bacteria 2578
86 Ga0070696_100080791 3300005546 Bacteria 2302
87 Ga0070693_101101406 3300005547 Bacteria 606
88 Ga0070665_100017318 3300005548 Bacteria 7231
89 Ga0070704_100340969 3300005549 Bacteria 1262
90 Ga0070664_100007134 3300005564 Bacteria 9012
91 Ga0070664_101483215 3300005564 Bacteria 642
92 Ga0068857_100043867 3300005577 Bacteria 3966
93 Ga0068857_100138893 3300005577 Bacteria 2196
94 Ga0068854_100039486 3300005578 Bacteria 3326
95 Ga0068854_100114916 3300005578 Bacteria 2035
96 Ga0068854_101043647 3300005578 Bacteria 726
97 Ga0070702_100014750 3300005615 Bacteria 3972
98 Ga0070702_100199447 3300005615 Bacteria 1323
99 Ga0070702_100242311 3300005615 Bacteria 1217
100 Ga0070702_100824407 3300005615 Bacteria 719
101 Ga0068852_100230093 3300005616 Bacteria 1767
102 Ga0068852_101741547 3300005616 Bacteria 646
103 Ga0068864_100008046 3300005618 Bacteria 8696
104 Ga0068866_10047907 3300005718 Bacteria 2158
105 Ga0068866_10287249 3300005718 Bacteria 1022
106 Ga0068861_100186193 3300005719 Bacteria 1731
107 Ga0068861_100459478 3300005719 Bacteria 1143
108 Ga0068861_100626571 3300005719 Bacteria 990
109 Ga0068861_100969212 3300005719 Bacteria 810
110 Ga0068870_10129624 3300005840 Bacteria 1463
111 Ga0068870_10238347 3300005840 Bacteria 1122
112 Ga0068870_10428906 3300005840 Bacteria 867
113 Ga0068858_100170708 3300005842 Bacteria 2051
114 Ga0068862_100841269 3300005844 Bacteria 899
115 Ga0081455_10003653 3300005937 Bacteria 17623
116 Ga0081455_10013376 3300005937 Bacteria 8115
117 Ga0081538_10000515 3300005981 Bacteria 43219
118 Ga0081538_10056377 3300005981 Bacteria 2302
119 Ga0070717_10000069 3300006028 Bacteria 86039
120 Ga0070717_10100849 3300006028 Bacteria 2451
121 Ga0075364_10047686 3300006051 Bacteria 2791
122 Ga0075432_10329247 3300006058 Bacteria 642
123 Ga0070716_101514345 3300006173 Bacteria 549
124 Ga0070712_100015813 3300006175 Bacteria 4865
125 Ga0070712_100088319 3300006175 Bacteria 2265
126 Ga0075362_10066382 3300006177 Bacteria 1639
127 Ga0097621_100654086 3300006237 Bacteria 964
128 Ga0068871_100363172 3300006358 Bacteria 1283
129 Ga0068871_100593202 3300006358 Bacteria 1007
130 Ga0075428_100352959 3300006844 Bacteria 1578
131 Ga0075428_102623806 3300006844 Bacteria 514
132 Ga0075430_100198298 3300006846 Bacteria 1667
133 Ga0075430_100236322 3300006846 Bacteria 1515
134 Ga0075431_101145775 3300006847 Bacteria 741
135 Ga0075434_101291648 3300006871 Bacteria 741
136 Ga0075434_102618401 3300006871 Bacteria 505
137 Ga0075429_100008266 3300006880 Bacteria 9046
138 Ga0068865_100137372 3300006881 Bacteria 1839
139 Ga0068865_100763183 3300006881 Bacteria 831
140 Ga0075436_101344919 3300006914 Bacteria 541
141 Ga0075435_100175112 3300007076 Bacteria 1811
142 Ga0105240_11158518 3300009093 Bacteria 820
143 Ga0111539_10133035 3300009094 Bacteria 2912
144 Ga0111539_10335023 3300009094 Bacteria 1761
145 Ga0111539_10836155 3300009094 Bacteria 1071
146 Ga0111539_10923558 3300009094 Bacteria 1015
147 Ga0105245_10050741 3300009098 Bacteria 3719
148 Ga0105245_10082662 3300009098 Bacteria 2938
149 Ga0105245_10459882 3300009098 Bacteria 1283
150 Ga0105247_10472280 3300009101 Bacteria 908
151 Ga0114129_10038141 3300009147 Bacteria 6780
152 Ga0114129_10220001 3300009147 Bacteria 2562
153 Ga0114129_10648062 3300009147 Bacteria 1363
154 Ga0114129_11201232 3300009147 Bacteria 944
155 Ga0114129_11759058 3300009147 Bacteria 755
156 Ga0114129_13183831 3300009147 Bacteria 534
157 Ga0105243_10051478 3300009148 Bacteria 3257
158 Ga0105243_10067410 3300009148 Bacteria 2881
159 Ga0105243_10759227 3300009148 Bacteria 952
160 Ga0105243_11743172 3300009148 Bacteria 653
161 Ga0105241_10985003 3300009174 Bacteria 788
162 Ga0105242_10017261 3300009176 Bacteria 5621
163 Ga0105242_10393313 3300009176 Bacteria 1292
164 Ga0105242_10576737 3300009176 Bacteria 1083
165 Ga0105242_12678678 3300009176 Bacteria 548
166 Ga0105248_10266891 3300009177 Bacteria 1927
167 Ga0105248_11224307 3300009177 Bacteria 849
168 Ga0105248_11725174 3300009177 Bacteria 710
169 Ga0105249_10072395 3300009553 Bacteria 3186
170 Ga0105249_10075615 3300009553 Bacteria 3119
171 Ga0105249_10361188 3300009553 Bacteria 1474
172 Ga0105249_10486554 3300009553 Bacteria 1277
173 Ga0105249_11085828 3300009553 Bacteria 870
174 Ga0105239_10057026 3300010375 Bacteria 4285
175 Ga0105239_10199321 3300010375 Bacteria 2242
176 Ga0105246_10009458 3300011119 Bacteria 6005
177 Ga0105246_10260717 3300011119 Bacteria 1381
178 Ga0105246_12417382 3300011119 Bacteria 516
179 Ga0157338_1004210 3300012515 Bacteria 1233
180 Ga0157371_10487880 3300013102 Bacteria 909
181 Ga0157371_10989391 3300013102 Bacteria 641
182 Ga0157374_10575437 3300013296 Bacteria 1135
183 Ga0157374_11580747 3300013296 Bacteria 680
184 Ga0157378_10494011 3300013297 Bacteria 1221
185 Ga0157378_11453832 3300013297 Bacteria 729
186 Ga0163162_10621136 3300013306 Bacteria 1206
187 Ga0163162_12005368 3300013306 Bacteria 663
188 Ga0157372_13127044 3300013307 Bacteria 528
189 Ga0157375_10047233 3300013308 Bacteria 4203
190 Ga0163163_10520703 3300014325 Bacteria 1251
191 Ga0157380_10094813 3300014326 Bacteria 2471
192 Ga0157380_12591782 3300014326 Bacteria 573
193 Ga0157377_10332897 3300014745 Bacteria 1013
194 Ga0157377_10650538 3300014745 Bacteria 759
195 Ga0157377_11114490 3300014745 Bacteria 605
196 Ga0157377_11211779 3300014745 Bacteria 585
197 Ga0157377_11542863 3300014745 Bacteria 530
198 Ga0157379_10009655 3300014968 Bacteria 8398
199 Ga0157379_10113501 3300014968 Bacteria 2435
200 Ga0157379_11154902 3300014968 Bacteria 743
201 Ga0157376_10054472 3300014969 Bacteria 3334
202 Ga0157376_11493147 3300014969 Bacteria 709
203 Ga0157376_11494629 3300014969 Bacteria 708
204 Ga0163161_10391273 3300017792 Bacteria 1113
205 Ga0163161_11724928 3300017792 Bacteria 555
206 Ga0206354_10224139 3300020081 Bacteria 1550
207 Ga0213874_10000186 3300021377 Bacteria 11171
208 Ga0213874_10023284 3300021377 Bacteria 1726
209 Ga0213876_10034180 3300021384 Bacteria 2681
210 Ga0213876_10309657 3300021384 Bacteria 839
211 Ga0213875_10048851 3300021388 Bacteria 1984
212 Ga0213875_10307411 3300021388 Bacteria 751
213 Ga0207682_10180353 3300025893 Bacteria 964
214 Ga0207692_10000003 3300025898 Bacteria 431531
215 Ga0207692_10009886 3300025898 Bacteria 3998
216 Ga0207642_10033564 3300025899 Bacteria 2173
217 Ga0207688_10000094 3300025901 Bacteria 34655
218 Ga0207688_10097866 3300025901 Bacteria 1691
219 Ga0207688_10098479 3300025901 Bacteria 1686
220 Ga0207685_10214139 3300025905 Bacteria 912
221 Ga0207645_10718522 3300025907 Bacteria 679
222 Ga0207645_10844336 3300025907 Bacteria 622
223 Ga0207643_10012632 3300025908 Bacteria 4561
224 Ga0207643_10239427 3300025908 Bacteria 1115
225 Ga0207643_10310002 3300025908 Bacteria 984
226 Ga0207705_11472263 3300025909 Bacteria 516
227 Ga0207684_10792134 3300025910 Bacteria 802
228 Ga0207695_10456429 3300025913 Bacteria 1161
229 Ga0207693_10000138 3300025915 Bacteria 66126
230 Ga0207693_10042138 3300025915 Bacteria 3594
231 Ga0207693_10108337 3300025915 Bacteria 2179
232 Ga0207663_10149835 3300025916 Bacteria 1635
233 Ga0207663_10458744 3300025916 Bacteria 984
234 Ga0207660_10832747 3300025917 Bacteria 753
235 Ga0207662_10016896 3300025918 Bacteria 4122
236 Ga0207662_10247024 3300025918 Bacteria 1170
237 Ga0207649_11549115 3300025920 Bacteria 525
238 Ga0207652_10421098 3300025921 Bacteria 1204
239 Ga0207652_11367900 3300025921 Bacteria 611
240 Ga0207652_11448333 3300025921 Bacteria 590
241 Ga0207681_10050270 3300025923 Bacteria 2820
242 Ga0207681_10375960 3300025923 Bacteria 1143
243 Ga0207650_10103407 3300025925 Bacteria 2196
244 Ga0207659_10046963 3300025926 Bacteria 3052
245 Ga0207687_10003382 3300025927 Bacteria 10770
246 Ga0207687_10182129 3300025927 Bacteria 1628
247 Ga0207687_10459762 3300025927 Bacteria 1057
248 Ga0207700_10326256 3300025928 Bacteria 1331
249 Ga0207700_10485250 3300025928 Bacteria 1092
250 Ga0207700_10560019 3300025928 Bacteria 1015
251 Ga0207700_11309310 3300025928 Bacteria 645
252 Ga0207664_10002353 3300025929 Bacteria 12503
253 Ga0207664_10176362 3300025929 Bacteria 1833
254 Ga0207664_10185128 3300025929 Bacteria 1790
255 Ga0207664_11129668 3300025929 Bacteria 700
256 Ga0207664_11258767 3300025929 Bacteria 659
257 Ga0207690_10000165 3300025932 Bacteria 51537
258 Ga0207690_10904556 3300025932 Bacteria 732
259 Ga0207706_10056627 3300025933 Bacteria 3456
260 Ga0207706_10092608 3300025933 Bacteria 2658
261 Ga0207706_10118371 3300025933 Bacteria 2329
262 Ga0207686_10687831 3300025934 Bacteria 812
263 Ga0207686_11658318 3300025934 Bacteria 528
264 Ga0207709_10052519 3300025935 Bacteria 2504
265 Ga0207709_10096468 3300025935 Bacteria 1945
266 Ga0207709_10305629 3300025935 Bacteria 1185
267 Ga0207709_10976309 3300025935 Bacteria 691
268 Ga0207670_10006161 3300025936 Bacteria 6635
269 Ga0207670_10524788 3300025936 Bacteria 964
270 Ga0207704_10144064 3300025938 Bacteria 1671
271 Ga0207704_10335079 3300025938 Bacteria 1172
272 Ga0207704_11706639 3300025938 Bacteria 541
273 Ga0207665_10052912 3300025939 Bacteria 2736
274 Ga0207665_10383851 3300025939 Bacteria 1067
275 Ga0207691_10016214 3300025940 Bacteria 7074
276 Ga0207711_10254679 3300025941 Bacteria 1613
277 Ga0207711_11619358 3300025941 Bacteria 591
278 Ga0207689_10032263 3300025942 Bacteria 4358
279 Ga0207689_10203146 3300025942 Bacteria 1636
280 Ga0207689_10376241 3300025942 Bacteria 1182
281 Ga0207661_10196500 3300025944 Bacteria 1771
282 Ga0207661_10309724 3300025944 Bacteria 1417
283 Ga0207661_10588464 3300025944 Bacteria 1021
284 Ga0207679_10092595 3300025945 Bacteria 2342
285 Ga0207679_10245602 3300025945 Bacteria 1519
286 Ga0207651_10079625 3300025960 Bacteria 2354
287 Ga0207712_10040801 3300025961 Bacteria 3188
288 Ga0207712_10051123 3300025961 Bacteria 2889
289 Ga0207712_10481586 3300025961 Bacteria 1058
290 Ga0207712_10815134 3300025961 Bacteria 821
291 Ga0207712_11119020 3300025961 Bacteria 701
292 Ga0207668_10210237 3300025972 Bacteria 1556
293 Ga0207668_10248571 3300025972 Bacteria 1443
294 Ga0207640_10058621 3300025981 Bacteria 2537
295 Ga0207640_10191544 3300025981 Bacteria 1542
296 Ga0207658_11193256 3300025986 Bacteria 696
297 Ga0207677_10067197 3300026023 Bacteria 2510
298 Ga0207677_10071504 3300026023 Bacteria 2449
299 Ga0207677_10621070 3300026023 Bacteria 950
300 Ga0207677_11395188 3300026023 Bacteria 645
301 Ga0207703_11104691 3300026035 Bacteria 762
302 Ga0207703_11153187 3300026035 Bacteria 745
303 Ga0207639_11046646 3300026041 Bacteria 765
304 Ga0207678_10671473 3300026067 Bacteria 911
305 Ga0207708_10093297 3300026075 Bacteria 2323
306 Ga0207708_10106624 3300026075 Bacteria 2173
307 Ga0207702_11560957 3300026078 Bacteria 653
308 Ga0207648_10042703 3300026089 Bacteria 3980
309 Ga0207648_10073575 3300026089 Bacteria 2978
310 Ga0207648_10141115 3300026089 Bacteria 2123
311 Ga0207648_11560840 3300026089 Bacteria 620
312 Ga0207648_11607019 3300026089 Bacteria 611
313 Ga0207676_10321175 3300026095 Bacteria 1421
314 Ga0207674_10053221 3300026116 Bacteria 4126
315 Ga0207674_10153021 3300026116 Bacteria 2263
316 Ga0207675_100041253 3300026118 Bacteria 4310
317 Ga0207675_100394971 3300026118 Bacteria 1362
318 Ga0207675_100919960 3300026118 Bacteria 891
319 Ga0207675_101076870 3300026118 Bacteria 823
320 Ga0207675_101934741 3300026118 Bacteria 608
321 Ga0209998_10059558 3300027717 Bacteria 897
322 Ga0207428_10012556 3300027907 Bacteria 7436
323 Ga0207428_10191865 3300027907 Bacteria 1540
324 Ga0207428_10233129 3300027907 Bacteria 1377
325 Ga0268266_10043001 3300028379 Bacteria 3860
326 Ga0268266_10740309 3300028379 Bacteria 948
327 Ga0268265_10063794 3300028380 Bacteria 2836
328 Ga0268264_12567273 3300028381 Bacteria 514
329 Ga0265337_1094345 3300028556 Bacteria 815
330 Ga0265326_10000082 3300028558 Bacteria 51208
331 Ga0265319_1000357 3300028563 Bacteria 33082
332 Ga0265334_10000050 3300028573 Bacteria 88877
333 Ga0265318_10004027 3300028577 Bacteria 7219
334 Ga0265318_10069688 3300028577 Bacteria 1304
335 Ga0265336_10014127 3300028666 Bacteria 2649
336 Ga0265338_10021918 3300028800 Bacteria 6638
337 Ga0265338_10139793 3300028800 Bacteria 1898
338 Ga0265324_10007767 3300029957 Bacteria 4315
339 Ga0265320_10049794 3300031240 Bacteria 2039
340 Ga0265320_10056757 3300031240 Bacteria 1880
341 Ga0265320_10178127 3300031240 Bacteria 953
342 Ga0265327_10034948 3300031251 Bacteria 2784
343 Ga0265316_10181624 3300031344 Bacteria 1566
344 Ga0307408_101436593 3300031548 Bacteria 650
345 Ga0265313_10033426 3300031595 Bacteria 2614
346 Ga0265314_10543833 3300031711 Bacteria 605
347 Ga0307413_11112707 3300031824 Bacteria 683
348 Ga0307406_10317911 3300031901 Bacteria 1203
349 Ga0307409_100631742 3300031995 Bacteria 1062
350 Ga0307409_102800034 3300031995 Bacteria 515
351 Ga0307415_100459697 3300032126 Bacteria 1103
352 Ga0373959_0038767 3300034820 Bacteria 992
353 Ga0373940_0089616 3300035088 Bacteria 920
354 Ga0373945_0423872 3300035116 Bacteria 586
355 Ga0373953_0073307 3300035117 Bacteria 1415
356 Ga0373954_0094219 3300035118 Bacteria 1441
357 Ga0373956_0048203 3300035119 Bacteria 1908
358 Ga0373957_0030296 3300035120 Bacteria 1982
359 Ga0373960_0350322 3300035121 Bacteria 560
360 Ga0373955_0694214 3300035172 Bacteria 625
361 Ga0373961_0065656 3300035241 Bacteria 1112
362 Ga0373961_0428870 3300035241 Bacteria 512
363 Ga0373924_0429021 3300035410 Bacteria 592
364 Ga0373931_1163746 3300035691 Bacteria 527
365 Ga0373937_0015319 3300036401 Bacteria 6780
366 Ga0373925_0631221 3300037068 Bacteria 883
367 Ga0395899_0000868 3300037312 Bacteria 28808
368 Ga0395899_0153589 3300037312 Bacteria 1630
369 Ga0395900_0019629 3300037418 Bacteria 6891
370 Ga0395898_0019061 3300037466 Bacteria 6984
371 Ga0395898_0168561 3300037466 Bacteria 2093
372 Ga0395898_0216390 3300037466 Bacteria 1827
373 Ga0395898_1089549 3300037466 Bacteria 732
374 Ga0395905_0134724 3300037471 Bacteria 2323
375 Ga0395905_1043798 3300037471 Bacteria 720
376 Ga0436364_0229258 3300037853 Bacteria 1025
377 Ga0436364_0283540 3300037853 Bacteria 1007
378 Ga0436364_0908299 3300037853 Bacteria 1583
379 Ga0395901_0115415 3300038443 Bacteria 2820
380 Ga0395901_0313426 3300038443 Bacteria 1624
381 Ga0395901_0418740 3300038443 Bacteria 1374
382 Ga0436365_0490069 3300039437 Bacteria 5129
383 Ga0436365_0853085 3300039437 Bacteria 949
384 Ga0436363_0136874 3300039450 Bacteria 50367
385 Ga0436363_0869812 3300039450 Bacteria 2166
386 Ga0436362_0121036 3300039453 Bacteria 947
387 Ga0451847_0494066 3300041503 Bacteria 640
388 Ga0451849_0458310 3300041505 Bacteria 944
389 Ga0451853_3474825 3300041512 Bacteria 550
390 Ga0439450_068169 3300042008 Bacteria 870
391 Ga0439454_040445 3300042011 Bacteria 761
392 Ga0450888_038061 3300042126 Bacteria 662
393 Ga0439459_0071883 3300042438 Bacteria 802
394 Ga0466969_0029450 3300044656 Bacteria 2803
395 Ga0466972_0431269 3300044658 Bacteria 619
396 Ga0466966_0127502 3300044684 Bacteria 1560
397 Ga0466966_0224699 3300044684 Bacteria 1133
398 Ga0466966_0263399 3300044684 Bacteria 1038
399 Ga0466966_0449292 3300044684 Bacteria 775
400 Ga0466961_0189708 3300044693 Bacteria 1274
401 Ga0466961_0380237 3300044693 Bacteria 858
402 Ga0466971_0635560 3300044719 Bacteria 534
403 Ga0466970_0542044 3300044765 Bacteria 672
404 Ga0466957_0261777 3300044842 Bacteria 1153
405 Ga0466957_0310283 3300044842 Bacteria 1062
406 Ga0466957_1248420 3300044842 Bacteria 538
407 Ga0466960_0519257 3300044901 Bacteria 700
408 Ga0466959_0098670 3300045049 Bacteria 2092
409 Ga0466959_0155154 3300045049 Bacteria 1612
410 Ga0466959_0169675 3300045049 Bacteria 1531
411 Ga0466959_0351053 3300045049 Bacteria 1006
412 Ga0466959_0485780 3300045049 Bacteria 835
413 Ga0466958_0048369 3300045836 Bacteria 2570
414 Ga0466958_0155336 3300045836 Bacteria 1444
415 Ga0466958_0479099 3300045836 Bacteria 807
416 Ga0466967_0097876 3300045976 Bacteria 2678
417 Ga0466967_1139758 3300045976 Bacteria 777
418 Ga0495592_0164426 3300046454 Bacteria 1524
419 Ga0495603_0121963 3300046455 Bacteria 1519
420 Ga0495603_0406411 3300046455 Bacteria 780
421 Ga0495629_0182808 3300046459 Bacteria 1453
422 Ga0495641_0046874 3300046461 Bacteria 1986
423 Ga0495651_0026496 3300046462 Bacteria 4515
424 Ga0495653_0283040 3300046463 Bacteria 1087
425 Ga0495582_0144690 3300046473 Bacteria 1348
426 Ga0495582_0188031 3300046473 Bacteria 1178
427 Ga0495582_0303737 3300046473 Bacteria 917
428 Ga0495639_0098236 3300046475 Bacteria 1380
429 Ga0495584_0056800 3300046491 Bacteria 1970
430 Ga0495584_0330841 3300046491 Bacteria 774
431 Ga0495585_0374840 3300046492 Bacteria 688
432 Ga0495594_0205946 3300046499 Bacteria 1121
433 Ga0495594_0451038 3300046499 Bacteria 731
434 Ga0495607_0131617 3300046501 Bacteria 1301
435 Ga0495608_0002787 3300046511 Bacteria 12547
436 Ga0495618_0101858 3300046514 Bacteria 1838
437 Ga0495618_0505425 3300046514 Bacteria 728
438 Ga0495628_0126922 3300046516 Bacteria 1954
439 Ga0495628_0451435 3300046516 Bacteria 934
440 Ga0495630_0199389 3300046517 Bacteria 1527
441 Ga0495666_0314670 3300046526 Bacteria 707
442 Ga0495642_0436080 3300046528 Bacteria 579
443 Ga0495652_0074700 3300046529 Bacteria 2818
444 Ga0495652_0900558 3300046529 Bacteria 583
445 Ga0495587_0377881 3300046536 Bacteria 788
446 Ga0495645_0770570 3300046543 Bacteria 579
447 Ga0495633_0238937 3300046558 Bacteria 830
448 Ga0495667_0003950 3300046559 Bacteria 9947
449 Ga0495667_0359015 3300046559 Bacteria 920
450 Ga0495656_0058346 3300046615 Bacteria 1675
451 Ga0495656_0092737 3300046615 Bacteria 1384
452 Ga0495634_0362393 3300046642 Bacteria 866
453 Ga0495635_0043525 3300046663 Bacteria 3098
454 Ga0495635_0058145 3300046663 Bacteria 2660
455 Ga0495588_0182500 3300046674 Bacteria 1109
456 Ga0495588_0438170 3300046674 Bacteria 686
457 Ga0495588_0515076 3300046674 Bacteria 627
458 Ga0495657_0272145 3300046675 Bacteria 1015
459 Ga0495623_0296325 3300046679 Bacteria 895
460 Ga0495646_0022118 3300046680 Bacteria 4013
461 Ga0495646_0160851 3300046680 Bacteria 1243
462 Ga0495647_0124494 3300046681 Bacteria 1087
463 Ga0495658_0204098 3300046683 Bacteria 1233
464 Ga0495658_0538091 3300046683 Bacteria 748
465 Ga0495669_0208326 3300046684 Bacteria 936
466 Ga0495613_0171016 3300046689 Bacteria 1542
467 Ga0495613_0582213 3300046689 Bacteria 746
468 Ga0495600_0088557 3300046809 Bacteria 2019
469 Ga0495581_0266205 3300047315 Bacteria 1002
470 Ga0495604_0225077 3300047317 Bacteria 1289
471 Ga0495604_0790651 3300047317 Bacteria 598
472 Ga0495674_0097637 3300047319 Bacteria 2502
473 Ga0495674_0100939 3300047319 Bacteria 2455
474 Ga0495676_0479019 3300047321 Bacteria 819
475 Ga0495680_0077762 3300047322 Bacteria 2512
476 Ga0495677_0385902 3300047445 Bacteria 554
477 Ga0495684_0312873 3300047471 Bacteria 1125
478 Ga0495593_0038932 3300047673 Bacteria 2566
479 Ga0495602_0043203 3300048088 Bacteria 4100
480 Ga0495615_0276355 3300048090 Bacteria 538
481 Ga0496100_0001383 3300048903 Bacteria 11886
482 Ga0496100_0608958 3300048903 Bacteria 849
483 Ga0496100_1360810 3300048903 Bacteria 560
484 Ga0496101_0001892 3300048904 Bacteria 12640
485 Ga0496101_0477083 3300048904 Bacteria 985
486 Ga0496102_0153608 3300048905 Bacteria 2164
487 Ga0496102_0475026 3300048905 Bacteria 1171
488 Ga0496102_0930532 3300048905 Bacteria 791
489 Ga0496102_0971352 3300048905 Bacteria 770
490 Ga0496102_1111207 3300048905 Bacteria 710
491 Ga0496103_0365360 3300048906 Bacteria 928
492 Ga0496103_0475584 3300048906 Bacteria 800
493 Ga0496103_1030630 3300048906 Bacteria 511
494 Ga0496104_0034704 3300048907 Bacteria 4705
495 Ga0496104_0176856 3300048907 Bacteria 2044
496 Ga0496104_1078229 3300048907 Bacteria 707
497 Ga0496104_1291599 3300048907 Bacteria 633
498 Ga0496105_0051150 3300048908 Bacteria 3414
499 Ga0496105_1159570 3300048908 Bacteria 571
500 Ga0496106_0143480 3300048909 Bacteria 1879
501 Ga0496107_0291443 3300048910 Bacteria 1215
502 Ga0496108_0211148 3300048911 Bacteria 1685
503 Ga0496108_0452015 3300048911 Bacteria 1122
504 Ga0496108_0877093 3300048911 Bacteria 771
505 Ga0496109_0313261 3300048912 Bacteria 1480
506 Ga0496109_0442333 3300048912 Bacteria 1228
507 Ga0496109_0589098 3300048912 Bacteria 1048
508 Ga0496109_1267166 3300048912 Bacteria 673
509 Ga0496109_1489584 3300048912 Bacteria 612
510 Ga0496110_0060868 3300048913 Bacteria 3331
511 Ga0496110_0120686 3300048913 Bacteria 2361
512 Ga0496110_0328524 3300048913 Bacteria 1393
513 Ga0496110_0449628 3300048913 Bacteria 1174
514 Ga0496111_0211307 3300048914 Bacteria 1441
515 Ga0496111_0251150 3300048914 Bacteria 1313
516 Ga0496111_0325902 3300048914 Bacteria 1137
517 Ga0496112_0015765 3300048915 Bacteria 7060
518 Ga0496112_0774530 3300048915 Bacteria 885
519 Ga0496113_0040129 3300048916 Bacteria 3448
520 Ga0496113_0049112 3300048916 Bacteria 3141
521 Ga0496114_0006753 3300048917 Bacteria 9038
522 Ga0496114_0526973 3300048917 Bacteria 1044
523 Ga0496115_0361798 3300048918 Bacteria 1182
524 Ga0496115_0392744 3300048918 Bacteria 1126
525 Ga0496119_0129439 3300048922 Bacteria 1377
526 Ga0496120_0223969 3300048923 Bacteria 897
527 Ga0496121_0010570 3300048924 Bacteria 10377
528 Ga0496124_0042682 3300048927 Bacteria 3903
529 Ga0496124_0431984 3300048927 Bacteria 904
530 Ga0501036_1316469 3300049572 Bacteria 587
531 Ga0501042_0210161 3300049578 Bacteria 1404
532 Ga0501067_0012891 3300049583 Bacteria 4629
533 Ga0501069_0662672 3300049585 Bacteria 628
534 Ga0501071_1097563 3300049587 Bacteria 615
535 Ga0501072_1213354 3300049588 Bacteria 586
536 Ga0501074_0354459 3300049590 Bacteria 1041
537 Ga0501075_0211108 3300049591 Bacteria 1481
538 Ga0501045_0398140 3300049824 Bacteria 1025
539 Ga0501045_0608731 3300049824 Bacteria 809
540 nmdc:mga03683_528819_c1 3300050489 Bacteria 573
541 nmdc:mga00v17_309454_c1 3300050491 Bacteria 1026
542 nmdc:mga00v17_87716_c1 3300050491 Bacteria 1950
543 nmdc:mga0k408_417895_c1 3300050493 Bacteria 797
544 nmdc:mga05p37_1390599_c1 3300050507 Bacteria 708
545 nmdc:mga05p37_2010672_c1 3300050507 Bacteria 546
546 nmdc:mga05p37_555413_c1 3300050507 Bacteria 1306
547 nmdc:mga05p37_759979_c1 3300050507 Bacteria 1067
548 nmdc:mga05p37_850721_c1 3300050507 Bacteria 991
549 nmdc:mga09592_13588_c1 3300050508 Bacteria 6651
550 nmdc:mga0qj67_234556_c1 3300050509 Bacteria 1489
551 nmdc:mga0qj67_967122_c1 3300050509 Bacteria 669
552 nmdc:mga06r32_257777_c1 3300050510 Bacteria 1732
553 nmdc:mga08y16_100164_c1 3300050511 Bacteria 3017
554 nmdc:mga08y16_114914_c1 3300050511 Bacteria 2802
555 nmdc:mga08y16_1197606_c1 3300050511 Bacteria 730
556 nmdc:mga08y16_131091_c1 3300050511 Bacteria 2607
557 nmdc:mga08y16_631915_c1 3300050511 Bacteria 1077
558 nmdc:mga0n895_1366089_c1 3300050512 Bacteria 678
559 nmdc:mga0rr50_605611_c1 3300050513 Bacteria 934
560 nmdc:mga08x19_1189282_c1 3300050514 Bacteria 541
561 nmdc:mga0a205_764216_c1 3300050515 Bacteria 815
562 Ga0495612_0219258 3300053078 Bacteria 842
563 Ga0495612_0295624 3300053078 Bacteria 726
564 Ga0495655_0178405 3300053083 Bacteria 684
565 Ga0495655_0298623 3300053083 Bacteria 553
566 Ga0495619_0802809 3300053085 Bacteria 636
567 Ga0500614_101679 3300053123 Bacteria 829
568 Ga0501084_1145723 3300054114 Bacteria 653
569 Ga0501084_1684047 3300054114 Bacteria 530
570 Ga0501082_1169377 3300060353 Bacteria 672
571 Ga0157375_11753945
572 JGI24746J21847_1020519
573 JGI24749J21850_1019971
574 JGI24744J21845_10011794
575 JGI24751J29686_10014668
576 JGI25407J50210_10006859
577 Ga0070658_10863268
578 Ga0070676_10114803
579 Ga0070676_10295767
580 Ga0070683_100015421
581 Ga0070683_101113453
582 Ga0070670_100002726
583 Ga0070670_101858327
584 Ga0068869_100022221
585 Ga0068869_100087628
586 Ga0070680_101048092
587 Ga0070682_100009345
588 Ga0068868_100064173
589 Ga0068868_100098882
590 Ga0068868_100549546
591 Ga0070660_100139990
592 Ga0070660_100870603
593 Ga0070689_100364622
594 Ga0070689_101784265
595 Ga0070691_10036588
596 Ga0070691_10273636
597 Ga0070691_10624426
598 Ga0070687_100073999
599 Ga0070692_10227381
600 Ga0070668_100184321
601 Ga0070668_100801816
602 Ga0070668_100896025
603 Ga0070669_100067688
604 Ga0070669_100904826
605 Ga0070675_100009573
606 Ga0070675_101975966
607 Ga0070674_100011725
608 Ga0070674_100132980
609 Ga0070674_101699937
610 Ga0070673_100009174
611 Ga0070688_100010080
612 Ga0070659_100000160
613 Ga0070659_100461407
614 Ga0070714_100002996
615 Ga0070714_100329418
616 Ga0070714_100409185
617 Ga0070714_102114430
618 Ga0070714_102265563
619 Ga0070713_100482794
620 Ga0070713_100589040
621 Ga0070713_100778506
622 Ga0070710_10000005
623 Ga0070710_10007649
624 Ga0070710_11043148
625 Ga0070701_10746123
626 Ga0070711_100014201
627 Ga0070705_100002004
628 Ga0070705_100580974
629 Ga0070700_100048730
630 Ga0070700_100069500
631 Ga0070694_100095994
632 Ga0070694_101165334
633 Ga0070678_101427585
634 Ga0070678_102136341
635 Ga0070662_100034903
636 Ga0070662_100377263
637 Ga0070681_10360656
638 Ga0068867_100053386
639 Ga0068867_100067100
640 Ga0068867_100602014
641 Ga0068867_100707032
642 Ga0070685_10005868
643 Ga0070706_100996339
644 Ga0070707_101580516
645 Ga0070698_101585524
646 Ga0070679_101631323
647 Ga0070679_101799189
648 Ga0070684_100022860
649 Ga0070684_100684458
650 Ga0070684_101132636
651 Ga0070684_101921670
652 Ga0068853_101482612
653 Ga0070686_100537385
654 Ga0070686_101025998
655 Ga0070695_100054287
656 Ga0070696_100080791
657 Ga0070693_101101406
658 Ga0070665_100017318
659 Ga0070704_100340969
660 Ga0070664_100007134
661 Ga0070664_101483215
662 Ga0068857_100043867
663 Ga0068857_100138893
664 Ga0068854_100039486
665 Ga0068854_100114916
666 Ga0068854_101043647
667 Ga0070702_100014750
668 Ga0070702_100199447
669 Ga0070702_100242311
670 Ga0070702_100824407
671 Ga0068852_100230093
672 Ga0068852_101741547
673 Ga0068864_100008046
674 Ga0068866_10047907
675 Ga0068866_10287249
676 Ga0068861_100186193
677 Ga0068861_100459478
678 Ga0068861_100626571
679 Ga0068861_100969212
680 Ga0068870_10129624
681 Ga0068870_10238347
682 Ga0068870_10428906
683 Ga0068858_100170708
684 Ga0068862_100841269
685 Ga0081455_10003653
686 Ga0081455_10013376
687 Ga0081538_10000515
688 Ga0081538_10056377
689 Ga0070717_10000069
690 Ga0070717_10100849
691 Ga0075364_10047686
692 Ga0075432_10329247
693 Ga0070716_101514345
694 Ga0070712_100015813
695 Ga0070712_100088319
696 Ga0075362_10066382
697 Ga0097621_100654086
698 Ga0068871_100363172
699 Ga0068871_100593202
700 Ga0075428_100352959
701 Ga0075428_102623806
702 Ga0075430_100198298
703 Ga0075430_100236322
704 Ga0075431_101145775
705 Ga0075434_101291648
706 Ga0075434_102618401
707 Ga0075429_100008266
708 Ga0068865_100137372
709 Ga0068865_100763183
710 Ga0075436_101344919
711 Ga0075435_100175112
712 Ga0105240_11158518
713 Ga0111539_10133035
714 Ga0111539_10335023
715 Ga0111539_10836155
716 Ga0111539_10923558
717 Ga0105245_10050741
718 Ga0105245_10082662
719 Ga0105245_10459882
720 Ga0105247_10472280
721 Ga0114129_10038141
722 Ga0114129_10220001
723 Ga0114129_10648062
724 Ga0114129_11201232
725 Ga0114129_11759058
726 Ga0114129_13183831
727 Ga0105243_10051478
728 Ga0105243_10067410
729 Ga0105243_10759227
730 Ga0105243_11743172
731 Ga0105241_10985003
732 Ga0105242_10017261
733 Ga0105242_10393313
734 Ga0105242_10576737
735 Ga0105242_12678678
736 Ga0105248_10266891
737 Ga0105248_11224307
738 Ga0105248_11725174
739 Ga0105249_10072395
740 Ga0105249_10075615
741 Ga0105249_10361188
742 Ga0105249_10486554
743 Ga0105249_11085828
744 Ga0105239_10057026
745 Ga0105239_10199321
746 Ga0105246_10009458
747 Ga0105246_10260717
748 Ga0105246_12417382
749 Ga0157338_1004210
750 Ga0157371_10487880
751 Ga0157371_10989391
752 Ga0157374_10575437
753 Ga0157374_11580747
754 Ga0157378_10494011
755 Ga0157378_11453832
756 Ga0163162_10621136
757 Ga0163162_12005368
758 Ga0157372_13127044
759 Ga0157375_10047233
760 Ga0163163_10520703
761 Ga0157380_10094813
762 Ga0157380_12591782
763 Ga0157377_10332897
764 Ga0157377_10650538
765 Ga0157377_11114490
766 Ga0157377_11211779
767 Ga0157377_11542863
768 Ga0157379_10009655
769 Ga0157379_10113501
770 Ga0157379_11154902
771 Ga0157376_10054472
772 Ga0157376_11493147
773 Ga0157376_11494629
774 Ga0163161_10391273
775 Ga0163161_11724928
776 Ga0206354_10224139
777 Ga0213874_10000186
778 Ga0213874_10023284
779 Ga0213876_10034180
780 Ga0213876_10309657
781 Ga0213875_10048851
782 Ga0213875_10307411
783 Ga0207682_10180353
784 Ga0207692_10000003
785 Ga0207692_10009886
786 Ga0207642_10033564
787 Ga0207688_10000094
788 Ga0207688_10097866
789 Ga0207688_10098479
790 Ga0207685_10214139
791 Ga0207645_10718522
792 Ga0207645_10844336
793 Ga0207643_10012632
794 Ga0207643_10239427
795 Ga0207643_10310002
796 Ga0207705_11472263
797 Ga0207684_10792134
798 Ga0207695_10456429
799 Ga0207693_10000138
800 Ga0207693_10042138
801 Ga0207693_10108337
802 Ga0207663_10149835
803 Ga0207663_10458744
804 Ga0207660_10832747
805 Ga0207662_10016896
806 Ga0207662_10247024
807 Ga0207649_11549115
808 Ga0207652_10421098
809 Ga0207652_11367900
810 Ga0207652_11448333
811 Ga0207681_10050270
812 Ga0207681_10375960
813 Ga0207650_10103407
814 Ga0207659_10046963
815 Ga0207687_10003382
816 Ga0207687_10182129
817 Ga0207687_10459762
818 Ga0207700_10326256
819 Ga0207700_10485250
820 Ga0207700_10560019
821 Ga0207700_11309310
822 Ga0207664_10002353
823 Ga0207664_10176362
824 Ga0207664_10185128
825 Ga0207664_11129668
826 Ga0207664_11258767
827 Ga0207690_10000165
828 Ga0207690_10904556
829 Ga0207706_10056627
830 Ga0207706_10092608
831 Ga0207706_10118371
832 Ga0207686_10687831
833 Ga0207686_11658318
834 Ga0207709_10052519
835 Ga0207709_10096468
836 Ga0207709_10305629
837 Ga0207709_10976309
838 Ga0207670_10006161
839 Ga0207670_10524788
840 Ga0207704_10144064
841 Ga0207704_10335079
842 Ga0207704_11706639
843 Ga0207665_10052912
844 Ga0207665_10383851
845 Ga0207691_10016214
846 Ga0207711_10254679
847 Ga0207711_11619358
848 Ga0207689_10032263
849 Ga0207689_10203146
850 Ga0207689_10376241
851 Ga0207661_10196500
852 Ga0207661_10309724
853 Ga0207661_10588464
854 Ga0207679_10092595
855 Ga0207679_10245602
856 Ga0207651_10079625
857 Ga0207712_10040801
858 Ga0207712_10051123
859 Ga0207712_10481586
860 Ga0207712_10815134
861 Ga0207712_11119020
862 Ga0207668_10210237
863 Ga0207668_10248571
864 Ga0207640_10058621
865 Ga0207640_10191544
866 Ga0207658_11193256
867 Ga0207677_10067197
868 Ga0207677_10071504
869 Ga0207677_10621070
870 Ga0207677_11395188
871 Ga0207703_11104691
872 Ga0207703_11153187
873 Ga0207639_11046646
874 Ga0207678_10671473
875 Ga0207708_10093297
876 Ga0207708_10106624
877 Ga0207702_11560957
878 Ga0207648_10042703
879 Ga0207648_10073575
880 Ga0207648_10141115
881 Ga0207648_11560840
882 Ga0207648_11607019
883 Ga0207676_10321175
884 Ga0207674_10053221
885 Ga0207674_10153021
886 Ga0207675_100041253
887 Ga0207675_100394971
888 Ga0207675_100919960
889 Ga0207675_101076870
890 Ga0207675_101934741
891 Ga0209998_10059558
892 Ga0207428_10012556
893 Ga0207428_10191865
894 Ga0207428_10233129
895 Ga0268266_10043001
896 Ga0268266_10740309
897 Ga0268265_10063794
898 Ga0268264_12567273
899 Ga0265337_1094345
900 Ga0265326_10000082
901 Ga0265319_1000357
902 Ga0265334_10000050
903 Ga0265318_10004027
904 Ga0265318_10069688
905 Ga0265336_10014127
906 Ga0265338_10021918
907 Ga0265338_10139793
908 Ga0265324_10007767
909 Ga0265320_10049794
910 Ga0265320_10056757
911 Ga0265320_10178127
912 Ga0265327_10034948
913 Ga0265316_10181624
914 Ga0307408_101436593
915 Ga0265313_10033426
916 Ga0265314_10543833
917 Ga0307413_11112707
918 Ga0307406_10317911
919 Ga0307409_100631742
920 Ga0307409_102800034
921 Ga0307415_100459697
922 Ga0373959_0038767
923 Ga0373940_0089616
924 Ga0373945_0423872
925 Ga0373953_0073307
926 Ga0373954_0094219
927 Ga0373956_0048203
928 Ga0373957_0030296
929 Ga0373960_0350322
930 Ga0373955_0694214
931 Ga0373961_0065656
932 Ga0373961_0428870
933 Ga0373924_0429021
934 Ga0373931_1163746
935 Ga0373937_0015319
936 Ga0373925_0631221
937 Ga0395899_0000868
938 Ga0395899_0153589
939 Ga0395900_0019629
940 Ga0395898_0019061
941 Ga0395898_0168561
942 Ga0395898_0216390
943 Ga0395898_1089549
944 Ga0395905_0134724
945 Ga0395905_1043798
946 Ga0436364_0229258
947 Ga0436364_0283540
948 Ga0436364_0908299
949 Ga0395901_0115415
950 Ga0395901_0313426
951 Ga0395901_0418740
952 Ga0436365_0490069
953 Ga0436365_0853085
954 Ga0436363_0136874
955 Ga0436363_0869812
956 Ga0436362_0121036
957 Ga0451847_0494066
958 Ga0451849_0458310
959 Ga0451853_3474825
960 Ga0439450_068169
961 Ga0439454_040445
962 Ga0450888_038061
963 Ga0439459_0071883
964 Ga0466969_0029450
965 Ga0466972_0431269
966 Ga0466966_0127502
967 Ga0466966_0224699
968 Ga0466966_0263399
969 Ga0466966_0449292
970 Ga0466961_0189708
971 Ga0466961_0380237
972 Ga0466971_0635560
973 Ga0466970_0542044
974 Ga0466957_0261777
975 Ga0466957_0310283
976 Ga0466957_1248420
977 Ga0466960_0519257
978 Ga0466959_0098670
979 Ga0466959_0155154
980 Ga0466959_0169675
981 Ga0466959_0351053
982 Ga0466959_0485780
983 Ga0466958_0048369
984 Ga0466958_0155336
985 Ga0466958_0479099
986 Ga0466967_0097876
987 Ga0466967_1139758
988 Ga0495592_0164426
989 Ga0495603_0121963
990 Ga0495603_0406411
991 Ga0495629_0182808
992 Ga0495641_0046874
993 Ga0495651_0026496
994 Ga0495653_0283040
995 Ga0495582_0144690
996 Ga0495582_0188031
997 Ga0495582_0303737
998 Ga0495639_0098236
999 Ga0495584_0056800
1000 Ga0495584_0330841
1001 Ga0495585_0374840
1002 Ga0495594_0205946
1003 Ga0495594_0451038
1004 Ga0495607_0131617
1005 Ga0495608_0002787
1006 Ga0495618_0101858
1007 Ga0495618_0505425
1008 Ga0495628_0126922
1009 Ga0495628_0451435
1010 Ga0495630_0199389
1011 Ga0495666_0314670
1012 Ga0495642_0436080
1013 Ga0495652_0074700
1014 Ga0495652_0900558
1015 Ga0495587_0377881
1016 Ga0495645_0770570
1017 Ga0495633_0238937
1018 Ga0495667_0003950
1019 Ga0495667_0359015
1020 Ga0495656_0058346
1021 Ga0495656_0092737
1022 Ga0495634_0362393
1023 Ga0495635_0043525
1024 Ga0495635_0058145
1025 Ga0495588_0182500
1026 Ga0495588_0438170
1027 Ga0495588_0515076
1028 Ga0495657_0272145
1029 Ga0495623_0296325
1030 Ga0495646_0022118
1031 Ga0495646_0160851
1032 Ga0495647_0124494
1033 Ga0495658_0204098
1034 Ga0495658_0538091
1035 Ga0495669_0208326
1036 Ga0495613_0171016
1037 Ga0495613_0582213
1038 Ga0495600_0088557
1039 Ga0495581_0266205
1040 Ga0495604_0225077
1041 Ga0495604_0790651
1042 Ga0495674_0097637
1043 Ga0495674_0100939
1044 Ga0495676_0479019
1045 Ga0495680_0077762
1046 Ga0495677_0385902
1047 Ga0495684_0312873
1048 Ga0495593_0038932
1049 Ga0495602_0043203
1050 Ga0495615_0276355
1051 Ga0496100_0001383
1052 Ga0496100_0608958
1053 Ga0496100_1360810
1054 Ga0496101_0001892
1055 Ga0496101_0477083
1056 Ga0496102_0153608
1057 Ga0496102_0475026
1058 Ga0496102_0930532
1059 Ga0496102_0971352
1060 Ga0496102_1111207
1061 Ga0496103_0365360
1062 Ga0496103_0475584
1063 Ga0496103_1030630
1064 Ga0496104_0034704
1065 Ga0496104_0176856
1066 Ga0496104_1078229
1067 Ga0496104_1291599
1068 Ga0496105_0051150
1069 Ga0496105_1159570
1070 Ga0496106_0143480
1071 Ga0496107_0291443
1072 Ga0496108_0211148
1073 Ga0496108_0452015
1074 Ga0496108_0877093
1075 Ga0496109_0313261
1076 Ga0496109_0442333
1077 Ga0496109_0589098
1078 Ga0496109_1267166
1079 Ga0496109_1489584
1080 Ga0496110_0060868
1081 Ga0496110_0120686
1082 Ga0496110_0328524
1083 Ga0496110_0449628
1084 Ga0496111_0211307
1085 Ga0496111_0251150
1086 Ga0496111_0325902
1087 Ga0496112_0015765
1088 Ga0496112_0774530
1089 Ga0496113_0040129
1090 Ga0496113_0049112
1091 Ga0496114_0006753
1092 Ga0496114_0526973
1093 Ga0496115_0361798
1094 Ga0496115_0392744
1095 Ga0496119_0129439
1096 Ga0496120_0223969
1097 Ga0496121_0010570
1098 Ga0496124_0042682
1099 Ga0496124_0431984
1100 Ga0501036_1316469
1101 Ga0501042_0210161
1102 Ga0501067_0012891
1103 Ga0501069_0662672
1104 Ga0501071_1097563
1105 Ga0501072_1213354
1106 Ga0501074_0354459
1107 Ga0501075_0211108
1108 Ga0501045_0398140
1109 Ga0501045_0608731
1110 nmdc:mga03683_528819_c1
1111 nmdc:mga00v17_309454_c1
1112 nmdc:mga00v17_87716_c1
1113 nmdc:mga0k408_417895_c1
1114 nmdc:mga05p37_1390599_c1
1115 nmdc:mga05p37_2010672_c1
1116 nmdc:mga05p37_555413_c1
1117 nmdc:mga05p37_759979_c1
1118 nmdc:mga05p37_850721_c1
1119 nmdc:mga09592_13588_c1
1120 nmdc:mga0qj67_234556_c1
1121 nmdc:mga0qj67_967122_c1
1122 nmdc:mga06r32_257777_c1
1123 nmdc:mga08y16_100164_c1
1124 nmdc:mga08y16_114914_c1
1125 nmdc:mga08y16_1197606_c1
1126 nmdc:mga08y16_131091_c1
1127 nmdc:mga08y16_631915_c1
1128 nmdc:mga0n895_1366089_c1
1129 nmdc:mga0rr50_605611_c1
1130 nmdc:mga08x19_1189282_c1
1131 nmdc:mga0a205_764216_c1
1132 Ga0495612_0219258
1133 Ga0495612_0295624
1134 Ga0495655_0178405
1135 Ga0495655_0298623
1136 Ga0495619_0802809
1137 Ga0500614_101679
1138 Ga0501084_1145723
1139 Ga0501084_1684047
1140 Ga0501082_1169377

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00861

Ribosomal_L18p

Ribosomal L18 of archaea, bacteria, mitoch. and chloroplast

23

136

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.8948 27 116
6ddg-assembly1.cif.gz_a structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.8878 6 116
1ily-assembly1.cif.gz_A solution structure of ribosomal protein l18 of thermus thermophilus 0.8858 27 116
5xym-assembly1.cif.gz_O large subunit of mycobacterium smegmatis 0.8808 6 116
6ddg-assembly1.cif.gz_a structure of the 50s ribosomal subunit from methicillin resistant staphylococcus aureus in complex with the oxazolidinone antibiotic lzd-6 0.8794 6 116
ID Description Score Start End Superfamily
6ddga01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9674 27 116 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9643 20 116 3.30.420.100
5zetP01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.962 20 116 3.30.420.100
5xymO01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9538 20 116 3.30.420.100
4dhcS01 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5; 0.9372 27 116 3.30.420.100
ID Description Score Start End GO Terms
AF-A0A2H0BXB0-F1-model_v4 Large ribosomal subunit protein uL18 0.9825 20 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A840DMP2-F1-model_v4 deleted 0.9765 21 116
AF-A0A1V5NBZ7-F1-model_v4 50S ribosomal protein L18 0.9734 21 116 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:0008097
GO:1990904
AF-A0A554JK54-F1-model_v4 Large ribosomal subunit protein uL18 0.9723 18 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A0H4T7T0-F1-model_v4 Large ribosomal subunit protein uL18 0.972 20 116 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Map