F464771

General Info

Members Datasets Scaffolds Average Seq Length
569 325 485 544

Family's Representative Sequence

Representative Sequence 3300049744|Ga0501083_0046568|Ga0501083_0046568_310_2121
Length 584
Sequence MLDIIGSAERPLVPIWIDLNQLFSGIQPSDRNINLPWEASVMHAIQSIIATAPEIFLLLSVAIGTMLGRIKISGFSIGTTACILIASVLVGQLGAFTFPSLLRVVLFSLFVFTIGYRSGPEFFASLSIRTLAQVAVALVLGCTGLAIVLIFAFALRLDPVTASGLAAGALTQSSVILGLSESVLEQQEANIASGYAVTYVLGYILTLLYVPIIAPKLMRVDLKAEAKKLEAELASGNPPKIETLPYRKFQARAYRVSAGAGRTVGNIEDEIGNRTVIERIVRQGSDIEPHPDTVLEVGDDIVIVGRTAAIVAAGPVFGTEIDADDILKAIPGNALEVLVDSRKLHGRSIQQVADRLGNDARGIFLRSLTRMGREVPLSADTRVYVGDVMTLVGSTPNIERAAANVGQIIRSGDRVDIAFLTAGSFKIGNIALTLGGXXXALVAGLVCGWLRSRRPTIGAIPPAAQQTLSDLGIGGFIAAIGLGNGHSAWLAIQSHGLELVGMGIVVTLVPLTVATLFAHHMLRMNPVLICGALAGAMTVDAAVTGACEVAQSQTPVLGVAVPYAVGNVVLTVLGPIIVVSTFVG

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
3 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
4 2511231023 Pseudomonas sp. GM80 Isolate Nodule
5 2511231024 Pseudomonas sp. GM84 Isolate Nodule
6 2511231031 Pseudomonas sp. GM16 Isolate Nodule
7 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
8 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
9 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
10 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
11 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
12 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
13 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
14 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
15 2765235841 Pseudomonas putida AA7 Isolate Unclassified
16 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
17 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
18 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
19 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
20 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
21 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
22 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
23 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
24 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
25 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
26 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
27 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
28 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
29 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
30 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
31 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
32 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
33 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
34 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
35 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
36 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
37 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
38 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
39 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
40 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
41 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
42 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
43 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
44 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
45 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
46 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
47 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
48 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
49 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
50 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
51 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
52 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
53 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
54 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
55 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
56 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
57 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
58 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
59 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
60 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
61 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
62 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
63 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
64 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
65 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
66 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
67 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
68 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
69 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
70 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
71 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
72 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
73 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
74 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
75 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
76 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
77 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
78 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
79 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
80 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
81 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
82 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
85 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
86 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
87 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
88 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
89 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
90 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
91 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
92 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
93 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
94 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
95 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
96 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
97 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
98 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
99 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
100 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
101 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
102 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
103 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
104 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
105 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
106 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
107 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
108 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
109 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
110 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
111 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
112 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
113 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
114 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
115 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
116 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
117 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
118 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
119 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
120 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
123 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
124 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
125 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
126 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
134 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
135 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
136 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
137 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
138 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
141 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
142 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
143 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
146 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
147 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
148 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
149 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
150 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
151 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
154 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
155 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
181 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
182 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
183 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
191 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
197 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
198 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
199 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
200 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
203 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
204 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
205 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
206 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
207 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
208 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
209 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
210 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
211 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
214 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
215 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
216 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
217 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
218 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
219 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
222 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
227 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
228 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
236 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
237 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
238 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
239 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
240 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
247 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
248 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
251 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
252 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
256 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
257 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
258 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
261 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
262 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
263 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
264 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
265 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
268 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
269 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
270 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
274 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
275 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
276 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
277 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
278 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
286 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
290 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
291 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
293 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
294 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
295 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
298 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
299 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
300 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
301 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
302 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
303 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
308 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
309 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
312 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
313 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
314 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
315 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
316 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
317 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
320 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
321 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
322 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
323 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
324 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
325 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.54
Metatranscriptomes 0
Isolates 14.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.91
Nodule 10.19
Rhizoplane 5.98
Rhizosphere 66.78
Stem 0
Stem Tuber 0
Unclassified 9.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10000180 3300003215 Bacteria 62334
2 JGI25153J46596_10000390 3300003215 Bacteria 29780
3 Ga0055531_10006480 3300003794 Bacteria 6640
4 Ga0065165_1003135 3300005262 Bacteria 12211
5 Ga0065714_10064981 3300005288 Bacteria 14438
6 Ga0065714_10066318 3300005288 Bacteria 7119
7 Ga0070658_10075856 3300005327 Bacteria 2758
8 Ga0070658_10136593 3300005327 Bacteria 2046
9 Ga0070680_100003387 3300005336 Bacteria 11894
10 Ga0070682_100036010 3300005337 Bacteria 3024
11 Ga0070660_100111295 3300005339 Bacteria 2179
12 Ga0070668_100004843 3300005347 Bacteria 9969
13 Ga0070668_100009153 3300005347 Bacteria 7349
14 Ga0070671_100010474 3300005355 Bacteria 7439
15 Ga0070703_10001256 3300005406 Bacteria 7715
16 Ga0070709_10000919 3300005434 Bacteria 16307
17 Ga0070713_100043990 3300005436 Unclassified 3654
18 Ga0070701_10001252 3300005438 Bacteria 9316
19 Ga0070711_100006855 3300005439 Bacteria 6898
20 Ga0070705_100005364 3300005440 Bacteria 6243
21 Ga0070700_100006452 3300005441 Bacteria 6277
22 Ga0070694_100002725 3300005444 Bacteria 10482
23 Ga0070663_100013717 3300005455 Bacteria 5178
24 Ga0070663_100016602 3300005455 Bacteria 4787
25 Ga0070663_100027863 3300005455 Bacteria 3841
26 Ga0070681_10008340 3300005458 Bacteria 10150
27 Ga0070699_100015055 3300005518 Bacteria 6647
28 Ga0070679_100119871 3300005530 Bacteria 2616
29 Ga0068853_100214508 3300005539 Bacteria 1755
30 Ga0070695_100002263 3300005545 Bacteria 11028
31 Ga0070696_100003676 3300005546 Bacteria 10227
32 Ga0070693_100017581 3300005547 Bacteria 3720
33 Ga0070665_100091722 3300005548 Bacteria 3043
34 Ga0070704_100006686 3300005549 Bacteria 6817
35 Ga0070664_100043358 3300005564 Bacteria 3796
36 Ga0068857_100013610 3300005577 Bacteria 7087
37 Ga0068857_100020216 3300005577 Bacteria 5854
38 Ga0068856_100034730 3300005614 Bacteria 4940
39 Ga0068856_100054526 3300005614 Bacteria 3943
40 Ga0070702_100005120 3300005615 Bacteria 6068
41 Ga0068852_100030149 3300005616 Bacteria 4462
42 Ga0068859_100025533 3300005617 Bacteria 5926
43 Ga0068863_100110397 3300005841 Bacteria 2619
44 Ga0068858_100033437 3300005842 Bacteria 4772
45 Ga0068860_100006519 3300005843 Bacteria 11717
46 Ga0068862_100014046 3300005844 Bacteria 6643
47 Ga0081540_1004378 3300005983 Bacteria 10795
48 Ga0075365_10005441 3300006038 Bacteria 6866
49 Ga0075365_10037446 3300006038 Bacteria 3149
50 Ga0075365_10057389 3300006038 Bacteria 2590
51 Ga0075368_10003552 3300006042 Bacteria 5223
52 Ga0075363_100002557 3300006048 Bacteria 7474
53 Ga0075363_100015191 3300006048 Bacteria 3779
54 Ga0075364_10001453 3300006051 Bacteria 12859
55 Ga0075364_10006874 3300006051 Bacteria 6715
56 Ga0075364_10025038 3300006051 Bacteria 3795
57 Ga0070716_100049336 3300006173 Unclassified 2384
58 Ga0070712_100002255 3300006175 Bacteria 11853
59 Ga0075362_10022461 3300006177 Bacteria 2659
60 Ga0075367_10002881 3300006178 Bacteria 8005
61 Ga0075367_10010612 3300006178 Bacteria 4845
62 Ga0075370_10008191 3300006353 Bacteria 5364
63 Ga0075370_10031471 3300006353 Bacteria 2962
64 Ga0075428_100008624 3300006844 Bacteria 11310
65 Ga0075428_100040822 3300006844 Bacteria 5103
66 Ga0075430_100075448 3300006846 Unclassified 2827
67 Ga0075431_100058689 3300006847 Bacteria 3971
68 Ga0075434_100154594 3300006871 Unclassified 2314
69 Ga0075429_100023272 3300006880 Bacteria 5373
70 Ga0068865_100034009 3300006881 Bacteria 3417
71 Ga0097620_100025533 3300006931 Bacteria 5926
72 Ga0079104_1000245 3300006946 Bacteria 72407
73 Ga0075435_100071358 3300007076 Unclassified 2836
74 Ga0099795_10001105 3300007788 Bacteria 5604
75 Ga0105244_10000071 3300009036 Bacteria 117110
76 Ga0105244_10001439 3300009036 Bacteria 19267
77 Ga0105244_10022157 3300009036 Bacteria 3499
78 Ga0111539_10005573 3300009094 Bacteria 16276
79 Ga0111539_10019435 3300009094 Bacteria 8386
80 Ga0105245_10153273 3300009098 Bacteria 2181
81 Ga0105247_10003693 3300009101 Bacteria 9932
82 Ga0105247_10006321 3300009101 Bacteria 7338
83 Ga0105247_10072787 3300009101 Bacteria 2152
84 Ga0114129_10029146 3300009147 Bacteria 7819
85 Ga0105241_10024641 3300009174 Bacteria 4468
86 Ga0105241_10026293 3300009174 Bacteria 4329
87 Ga0105237_10005770 3300009545 Bacteria 13905
88 Ga0105238_10047100 3300009551 Bacteria 4348
89 Ga0105249_10022566 3300009553 Bacteria 5639
90 Ga0105239_10012754 3300010375 Bacteria 9350
91 Ga0105239_10051798 3300010375 Bacteria 4499
92 Ga0105239_10103975 3300010375 Bacteria 3144
93 Ga0105246_10047117 3300011119 Bacteria 2943
94 Ga0157370_10048292 3300013104 Bacteria 4077
95 Ga0157369_10002741 3300013105 Bacteria 21039
96 Ga0163162_10000085 3300013306 Bacteria 86018
97 Ga0163162_10008002 3300013306 Bacteria 10311
98 Ga0157375_10039541 3300013308 Bacteria 4541
99 Ga0157379_10152227 3300014968 Bacteria 2086
100 Ga0157376_10098304 3300014969 Bacteria 2551
101 Ga0163161_10000111 3300017792 Bacteria 77470
102 Ga0209233_1000599 3300025261 Bacteria 18677
103 Ga0209758_1000024 3300025297 Bacteria 591966
104 Ga0209758_1000131 3300025297 Bacteria 184259
105 Ga0209256_1001434 3300025299 Bacteria 24692
106 Ga0209257_1001033 3300025304 Bacteria 37252
107 Ga0207655_1000027 3300025728 Bacteria 444552
108 Ga0207655_1001713 3300025728 Bacteria 19276
109 Ga0207655_1011942 3300025728 Bacteria 5121
110 Ga0207653_10000657 3300025885 Bacteria 11891
111 Ga0207647_10000715 3300025904 Bacteria 26025
112 Ga0207647_10056308 3300025904 Bacteria 2412
113 Ga0207699_10007534 3300025906 Bacteria 5326
114 Ga0207705_10071243 3300025909 Bacteria 2519
115 Ga0207707_10052256 3300025912 Unclassified 3559
116 Ga0207693_10011815 3300025915 Bacteria 7056
117 Ga0207660_10046818 3300025917 Unclassified 3054
118 Ga0207657_10071251 3300025919 Bacteria 2943
119 Ga0207694_10047826 3300025924 Bacteria 3308
120 Ga0207687_10079351 3300025927 Bacteria 2366
121 Ga0207679_10086794 3300025945 Bacteria 2408
122 Ga0207712_10012146 3300025961 Bacteria 5503
123 Ga0207668_10020660 3300025972 Bacteria 4189
124 Ga0207668_10027117 3300025972 Bacteria 3729
125 Ga0207703_10024189 3300026035 Bacteria 4778
126 Ga0207703_10085343 3300026035 Bacteria 2642
127 Ga0207678_10004072 3300026067 Bacteria 13151
128 Ga0207678_10005395 3300026067 Bacteria 11455
129 Ga0207678_10028066 3300026067 Bacteria 4915
130 Ga0207708_10003023 3300026075 Bacteria 12400
131 Ga0207702_10043992 3300026078 Bacteria 3752
132 Ga0207674_10002183 3300026116 Bacteria 24754
133 Ga0207698_10008980 3300026142 Bacteria 6344
134 Ga0209281_1000046 3300027111 Bacteria 327042
135 Ga0268266_10027424 3300028379 Bacteria 4843
136 Ga0268265_10000961 3300028380 Bacteria 26484
137 Ga0268264_10012167 3300028381 Bacteria 7084
138 Ga0307511_10034544 3300030521 Bacteria 4434
139 Ga0307509_10003603 3300031507 Bacteria 23280
140 Ga0373931_0001957 3300035691 Bacteria 9045
141 Ga0373931_0074190 3300035691 Unclassified 1863
142 Ga0373935_0015603 3300035692 Bacteria 4594
143 Ga0373927_0011770 3300035695 Bacteria 5825
144 Ga0373927_0020298 3300035695 Bacteria 4357
145 Ga0373937_0006557 3300036401 Bacteria 10054
146 Ga0373937_0083190 3300036401 Bacteria 2961
147 Ga0395899_0034737 3300037312 Bacteria 3787
148 Ga0395900_0000962 3300037418 Bacteria 37526
149 Ga0395900_0093154 3300037418 Bacteria 3095
150 Ga0395898_0010314 3300037466 Bacteria 9775
151 Ga0395905_0000838 3300037471 Bacteria 40172
152 Ga0395901_0029678 3300038443 Bacteria 5631
153 Ga0395901_0074337 3300038443 Bacteria 3545
154 Ga0395901_0081053 3300038443 Bacteria 3390
155 Ga0450911_000652 3300042115 Bacteria 10410
156 Ga0466972_0001886 3300044658 Bacteria 10291
157 Ga0466966_0001768 3300044684 Bacteria 14017
158 Ga0466961_0000009 3300044693 Bacteria 139001
159 Ga0466959_0003178 3300045049 Bacteria 10664
160 Ga0495617_000265 3300046452 Bacteria 30319
161 Ga0495617_000490 3300046452 Bacteria 20939
162 Ga0495617_001069 3300046452 Bacteria 12466
163 Ga0495617_001700 3300046452 Bacteria 9450
164 Ga0495617_006363 3300046452 Bacteria 4145
165 Ga0495617_013898 3300046452 Bacteria 2738
166 Ga0495617_014837 3300046452 Bacteria 2646
167 Ga0495627_001943 3300046453 Bacteria 10755
168 Ga0495590_0000062 3300046457 Bacteria 82552
169 Ga0495590_0001063 3300046457 Bacteria 12095
170 Ga0495591_000086 3300046458 Bacteria 104667
171 Ga0495591_000181 3300046458 Bacteria 65312
172 Ga0495591_000305 3300046458 Bacteria 44968
173 Ga0495591_005476 3300046458 Bacteria 5868
174 Ga0495591_024490 3300046458 Bacteria 1912
175 Ga0495638_0000450 3300046460 Bacteria 49303
176 Ga0495638_0002048 3300046460 Bacteria 17132
177 Ga0495638_0002236 3300046460 Bacteria 16077
178 Ga0495638_0003298 3300046460 Bacteria 12730
179 Ga0495638_0004555 3300046460 Bacteria 10497
180 Ga0495638_0013370 3300046460 Bacteria 5590
181 Ga0495638_0073321 3300046460 Bacteria 2089
182 Ga0495651_0011984 3300046462 Bacteria 6673
183 Ga0495650_0000073 3300046471 Bacteria 253286
184 Ga0495650_0000690 3300046471 Bacteria 43630
185 Ga0495650_0004735 3300046471 Bacteria 9154
186 Ga0495650_0006563 3300046471 Bacteria 7232
187 Ga0495650_0007766 3300046471 Bacteria 6382
188 Ga0495605_0004653 3300046474 Bacteria 8025
189 Ga0495584_0000389 3300046491 Bacteria 30210
190 Ga0495584_0002599 3300046491 Bacteria 10170
191 Ga0495584_0005436 3300046491 Bacteria 6750
192 Ga0495584_0006036 3300046491 Bacteria 6380
193 Ga0495585_0000054 3300046492 Bacteria 114916
194 Ga0495585_0000208 3300046492 Bacteria 61272
195 Ga0495585_0000331 3300046492 Bacteria 46253
196 Ga0495585_0000417 3300046492 Bacteria 41075
197 Ga0495585_0000869 3300046492 Bacteria 25792
198 Ga0495585_0006797 3300046492 Bacteria 7059
199 Ga0495585_0007893 3300046492 Bacteria 6472
200 Ga0495596_0000027 3300046500 Bacteria 104155
201 Ga0495596_0000681 3300046500 Bacteria 21128
202 Ga0495596_0034531 3300046500 Bacteria 2007
203 Ga0495607_0004183 3300046501 Bacteria 10722
204 Ga0495607_0004824 3300046501 Bacteria 9836
205 Ga0495607_0006140 3300046501 Bacteria 8500
206 Ga0495607_0006522 3300046501 Bacteria 8202
207 Ga0495607_0007614 3300046501 Bacteria 7462
208 Ga0495607_0014282 3300046501 Bacteria 5176
209 Ga0495583_0000380 3300046506 Bacteria 68842
210 Ga0495583_0001221 3300046506 Bacteria 27359
211 Ga0495583_0009449 3300046506 Bacteria 5823
212 Ga0495583_0069839 3300046506 Bacteria 1546
213 Ga0495606_0000047 3300046507 Bacteria 207892
214 Ga0495606_0000177 3300046507 Bacteria 112843
215 Ga0495606_0002916 3300046507 Bacteria 18883
216 Ga0495606_0003003 3300046507 Bacteria 18515
217 Ga0495606_0004489 3300046507 Bacteria 13910
218 Ga0495606_0005687 3300046507 Bacteria 11804
219 Ga0495606_0008334 3300046507 Bacteria 9031
220 Ga0495606_0020924 3300046507 Bacteria 4805
221 Ga0495606_0022098 3300046507 Bacteria 4646
222 Ga0495606_0050889 3300046507 Bacteria 2706
223 Ga0495610_0000192 3300046512 Bacteria 68118
224 Ga0495610_0003732 3300046512 Bacteria 11653
225 Ga0495610_0005268 3300046512 Bacteria 9252
226 Ga0495610_0005610 3300046512 Bacteria 8857
227 Ga0495610_0011264 3300046512 Bacteria 5480
228 Ga0495610_0012486 3300046512 Bacteria 5109
229 Ga0495610_0023636 3300046512 Bacteria 3334
230 Ga0495610_0034824 3300046512 Bacteria 2590
231 Ga0495616_0000622 3300046513 Bacteria 26614
232 Ga0495616_0000769 3300046513 Bacteria 23452
233 Ga0495616_0025847 3300046513 Bacteria 3131
234 Ga0495620_0023598 3300046515 Bacteria 2938
235 Ga0495631_0001246 3300046518 Bacteria 15721
236 Ga0495632_0000021 3300046519 Bacteria 187363
237 Ga0495632_0000346 3300046519 Bacteria 44143
238 Ga0495632_0004717 3300046519 Bacteria 9200
239 Ga0495632_0005072 3300046519 Bacteria 8808
240 Ga0495632_0026747 3300046519 Bacteria 3032
241 Ga0495632_0036312 3300046519 Bacteria 2507
242 Ga0495632_0055744 3300046519 Bacteria 1934
243 Ga0495637_0000016 3300046520 Bacteria 226914
244 Ga0495637_0000060 3300046520 Bacteria 96132
245 Ga0495637_0000209 3300046520 Bacteria 45853
246 Ga0495637_0000256 3300046520 Bacteria 41886
247 Ga0495637_0004354 3300046520 Bacteria 7348
248 Ga0495637_0005062 3300046520 Bacteria 6770
249 Ga0495637_0029634 3300046520 Bacteria 2434
250 Ga0495643_0000536 3300046522 Bacteria 47220
251 Ga0495643_0001236 3300046522 Bacteria 24581
252 Ga0495643_0001277 3300046522 Bacteria 24144
253 Ga0495643_0003302 3300046522 Bacteria 11915
254 Ga0495643_0006140 3300046522 Bacteria 7981
255 Ga0495643_0007555 3300046522 Bacteria 6994
256 Ga0495643_0012340 3300046522 Bacteria 5159
257 Ga0495644_0019207 3300046523 Bacteria 2609
258 Ga0495648_0000062 3300046524 Bacteria 150125
259 Ga0495648_0000156 3300046524 Bacteria 81149
260 Ga0495648_0000185 3300046524 Bacteria 71360
261 Ga0495648_0000280 3300046524 Bacteria 57789
262 Ga0495648_0000336 3300046524 Bacteria 51889
263 Ga0495648_0000405 3300046524 Bacteria 47490
264 Ga0495648_0001275 3300046524 Bacteria 25135
265 Ga0495648_0014973 3300046524 Bacteria 5649
266 Ga0495648_0015336 3300046524 Bacteria 5568
267 Ga0495648_0053752 3300046524 Bacteria 2437
268 Ga0495642_0000006 3300046528 Bacteria 172412
269 Ga0495652_0042818 3300046529 Bacteria 3903
270 Ga0495654_0001179 3300046530 Bacteria 18608
271 Ga0495654_0001819 3300046530 Bacteria 14189
272 Ga0495654_0003563 3300046530 Bacteria 9489
273 Ga0495654_0004422 3300046530 Bacteria 8343
274 Ga0495654_0007747 3300046530 Bacteria 5978
275 Ga0495654_0032282 3300046530 Bacteria 2654
276 Ga0495654_0059139 3300046530 Bacteria 1846
277 Ga0495640_0022430 3300046533 Bacteria 4614
278 Ga0495609_0003185 3300046538 Bacteria 9538
279 Ga0495609_0025231 3300046538 Bacteria 2726
280 Ga0495597_0003852 3300046542 Bacteria 8508
281 Ga0495597_0003905 3300046542 Bacteria 8420
282 Ga0495597_0004087 3300046542 Bacteria 8138
283 Ga0495597_0004751 3300046542 Bacteria 7353
284 Ga0495645_0090401 3300046543 Bacteria 2188
285 Ga0495622_0008117 3300046557 Bacteria 4865
286 Ga0495622_0009036 3300046557 Bacteria 4615
287 Ga0495622_0026546 3300046557 Bacteria 2704
288 Ga0495633_0000610 3300046558 Bacteria 34156
289 Ga0495633_0012353 3300046558 Bacteria 4547
290 Ga0495668_0000281 3300046616 Bacteria 70290
291 Ga0495668_0000365 3300046616 Bacteria 59626
292 Ga0495668_0019585 3300046616 Bacteria 3898
293 Ga0495611_0000012 3300046648 Bacteria 131579
294 Ga0495611_0001133 3300046648 Bacteria 13969
295 Ga0495611_0006395 3300046648 Bacteria 5020
296 Ga0495625_0000886 3300046660 Bacteria 40497
297 Ga0495625_0000921 3300046660 Bacteria 39545
298 Ga0495625_0003916 3300046660 Bacteria 14337
299 Ga0495625_0066204 3300046660 Bacteria 2545
300 Ga0495625_0083684 3300046660 Bacteria 2217
301 Ga0495635_0004801 3300046663 Bacteria 9397
302 Ga0495635_0105026 3300046663 Bacteria 1930
303 Ga0495661_0000001 3300046665 Bacteria 898372
304 Ga0495661_0000425 3300046665 Bacteria 44532
305 Ga0495588_0021294 3300046674 Bacteria 3194
306 Ga0495588_0025959 3300046674 Bacteria 2923
307 Ga0495669_0027259 3300046684 Bacteria 2499
308 Ga0495613_0037296 3300046689 Bacteria 3604
309 Ga0495624_0072305 3300046690 Bacteria 2145
310 Ga0495670_0000035 3300046691 Bacteria 79166
311 Ga0495670_0004943 3300046691 Bacteria 6548
312 Ga0495670_0027309 3300046691 Bacteria 2827
313 Ga0495671_0000588 3300046692 Bacteria 26872
314 Ga0495671_0002165 3300046692 Bacteria 12516
315 Ga0495671_0011481 3300046692 Bacteria 4869
316 Ga0495671_0012413 3300046692 Bacteria 4654
317 Ga0495671_0035854 3300046692 Bacteria 2516
318 Ga0495649_0000128 3300046694 Bacteria 66267
319 Ga0495649_0000267 3300046694 Bacteria 46493
320 Ga0495649_0000306 3300046694 Bacteria 43053
321 Ga0495649_0000502 3300046694 Bacteria 33450
322 Ga0495649_0000632 3300046694 Bacteria 28702
323 Ga0495649_0001060 3300046694 Bacteria 21502
324 Ga0495649_0003916 3300046694 Bacteria 9844
325 Ga0495649_0016077 3300046694 Bacteria 4247
326 Ga0495649_0042050 3300046694 Bacteria 2497
327 Ga0495649_0043049 3300046694 Bacteria 2465
328 Ga0495649_0099475 3300046694 Bacteria 1546
329 Ga0495589_0000499 3300046794 Bacteria 27768
330 Ga0495589_0000565 3300046794 Bacteria 25553
331 Ga0495589_0000567 3300046794 Bacteria 25481
332 Ga0495589_0003971 3300046794 Bacteria 7937
333 Ga0495589_0006474 3300046794 Bacteria 6175
334 Ga0495660_0000210 3300046810 Bacteria 59589
335 Ga0495660_0041460 3300046810 Bacteria 2548
336 Ga0495660_0042754 3300046810 Bacteria 2502
337 Ga0495660_0046217 3300046810 Bacteria 2387
338 Ga0495581_0034206 3300047315 Bacteria 2940
339 Ga0495604_0006641 3300047317 Bacteria 9168
340 Ga0495672_0000158 3300047320 Bacteria 98531
341 Ga0495672_0001010 3300047320 Bacteria 29011
342 Ga0495672_0021209 3300047320 Bacteria 4240
343 Ga0495672_0053849 3300047320 Bacteria 2355
344 Ga0495676_0000001 3300047321 Bacteria 624167
345 Ga0495683_0000111 3300047323 Bacteria 83676
346 Ga0495683_0000750 3300047323 Bacteria 23405
347 Ga0495683_0002716 3300047323 Bacteria 10551
348 Ga0495683_0003120 3300047323 Bacteria 9709
349 Ga0495687_009092 3300047443 Bacteria 5596
350 Ga0495679_000166 3300047446 Bacteria 59656
351 Ga0495679_000199 3300047446 Bacteria 53054
352 Ga0495673_0000354 3300047469 Bacteria 57082
353 Ga0495673_0000399 3300047469 Bacteria 50806
354 Ga0495673_0001866 3300047469 Bacteria 15806
355 Ga0495673_0001998 3300047469 Bacteria 15009
356 Ga0495673_0005174 3300047469 Bacteria 7942
357 Ga0495673_0016622 3300047469 Bacteria 3757
358 Ga0495673_0022056 3300047469 Bacteria 3128
359 Ga0495673_0023286 3300047469 Bacteria 3016
360 Ga0495673_0029878 3300047469 Bacteria 2567
361 Ga0495673_0039248 3300047469 Bacteria 2149
362 Ga0495681_0000069 3300047470 Bacteria 96229
363 Ga0495681_0004059 3300047470 Bacteria 10068
364 Ga0495681_0004842 3300047470 Bacteria 9107
365 Ga0495681_0004995 3300047470 Bacteria 8946
366 Ga0495681_0013330 3300047470 Bacteria 4776
367 Ga0495686_0000291 3300047472 Bacteria 88142
368 Ga0495686_0001687 3300047472 Bacteria 22942
369 Ga0495686_0003224 3300047472 Bacteria 14342
370 Ga0495686_0057076 3300047472 Bacteria 2437
371 Ga0495626_0000008 3300048091 Bacteria 271853
372 Ga0495626_0000077 3300048091 Bacteria 130910
373 Ga0495626_0000778 3300048091 Bacteria 29052
374 Ga0495626_0001286 3300048091 Bacteria 20488
375 Ga0495626_0002093 3300048091 Bacteria 14508
376 Ga0495626_0013065 3300048091 Bacteria 4328
377 Ga0496100_0024732 3300048903 Bacteria 3666
378 Ga0496100_0100165 3300048903 Bacteria 1995
379 Ga0496101_0033536 3300048904 Bacteria 3622
380 Ga0496101_0037700 3300048904 Bacteria 3431
381 Ga0496102_0002826 3300048905 Bacteria 14779
382 Ga0496102_0016670 3300048905 Bacteria 6426
383 Ga0496103_0001986 3300048906 Bacteria 13210
384 Ga0496103_0030213 3300048906 Bacteria 3296
385 Ga0496103_0060577 3300048906 Bacteria 2353
386 Ga0496104_0007828 3300048907 Bacteria 9470
387 Ga0496104_0016750 3300048907 Bacteria 6663
388 Ga0496104_0056659 3300048907 Bacteria 3707
389 Ga0496104_0074813 3300048907 Bacteria 3224
390 Ga0496105_0002112 3300048908 Bacteria 14386
391 Ga0496105_0015397 3300048908 Bacteria 6095
392 Ga0496105_0134015 3300048908 Bacteria 2041
393 Ga0496105_0149456 3300048908 Bacteria 1920
394 Ga0496106_0001640 3300048909 Bacteria 16794
395 Ga0496106_0014282 3300048909 Bacteria 5867
396 Ga0496106_0027733 3300048909 Bacteria 4219
397 Ga0496107_0001499 3300048910 Bacteria 14486
398 Ga0496107_0028479 3300048910 Bacteria 3970
399 Ga0496109_0036892 3300048912 Bacteria 4414
400 Ga0496110_0001928 3300048913 Bacteria 15359
401 Ga0496110_0019731 3300048913 Bacteria 5679
402 Ga0496110_0069850 3300048913 Bacteria 3111
403 Ga0496111_0025069 3300048914 Bacteria 4206
404 Ga0496112_0049898 3300048915 Bacteria 4102
405 Ga0496112_0130287 3300048915 Bacteria 2486
406 Ga0496113_0002795 3300048916 Bacteria 10268
407 Ga0496114_0000674 3300048917 Bacteria 25314
408 Ga0496114_0001850 3300048917 Bacteria 16029
409 Ga0496114_0084134 3300048917 Bacteria 2693
410 Ga0496114_0098638 3300048917 Bacteria 2491
411 Ga0496117_0000842 3300048920 Bacteria 47420
412 Ga0496117_0002612 3300048920 Bacteria 22385
413 Ga0496117_0020165 3300048920 Bacteria 5446
414 Ga0496117_0065926 3300048920 Bacteria 2459
415 Ga0496118_0000883 3300048921 Bacteria 47300
416 Ga0496118_0002927 3300048921 Bacteria 22167
417 Ga0496118_0007918 3300048921 Bacteria 11122
418 Ga0496118_0044075 3300048921 Bacteria 3497
419 Ga0496119_0009366 3300048922 Bacteria 8420
420 Ga0496119_0037223 3300048922 Bacteria 3164
421 Ga0496120_0008150 3300048923 Bacteria 7684
422 Ga0496121_0000218 3300048924 Bacteria 126175
423 Ga0496121_0001195 3300048924 Bacteria 45470
424 Ga0496124_0000847 3300048927 Bacteria 49898
425 Ga0496124_0002080 3300048927 Bacteria 27048
426 Ga0496124_0004840 3300048927 Bacteria 15484
427 Ga0496124_0012142 3300048927 Bacteria 8533
428 Ga0496124_0076319 3300048927 Bacteria 2767
429 Ga0496125_0006141 3300048928 Bacteria 13097
430 Ga0496126_0001598 3300048929 Bacteria 34515
431 Ga0496126_0002766 3300048929 Bacteria 23110
432 Ga0496126_0008543 3300048929 Bacteria 11038
433 Ga0496126_0050717 3300048929 Bacteria 3781
434 Ga0495678_001538 3300049459 Bacteria 17809
435 Ga0495678_002170 3300049459 Bacteria 13827
436 Ga0495678_002612 3300049459 Bacteria 12018
437 Ga0495678_003633 3300049459 Bacteria 9377
438 Ga0495678_027291 3300049459 Bacteria 2424
439 Ga0495682_0013691 3300049460 Bacteria 3084
440 Ga0501032_0025561 3300049569 Bacteria 4069
441 Ga0501033_0000394 3300049570 Bacteria 42043
442 Ga0501034_0000157 3300049571 Bacteria 128661
443 Ga0501036_0004467 3300049572 Bacteria 11303
444 Ga0501037_0017318 3300049573 Bacteria 5308
445 Ga0501038_0006974 3300049574 Bacteria 10434
446 Ga0501043_0001028 3300049579 Bacteria 24513
447 Ga0501047_0000166 3300049581 Bacteria 80743
448 Ga0501067_0047687 3300049583 Bacteria 2376
449 Ga0501069_0014107 3300049585 Bacteria 4266
450 Ga0501073_0000027 3300049589 Bacteria 121860
451 Ga0501074_0013938 3300049590 Bacteria 5843
452 Ga0501080_0006483 3300049742 Bacteria 10512
453 Ga0501083_0046568 3300049744 Bacteria 2932
454 Ga0501035_0000145 3300049822 Bacteria 86013
455 Ga0501035_0000418 3300049822 Bacteria 47993
456 Ga0501044_0000382 3300049823 Bacteria 55102
457 nmdc:mga03n38_24409_c1 3300050490 Bacteria 2472
458 nmdc:mga00v17_3714_c1 3300050491 Bacteria 7890
459 nmdc:mga0yw44_11779_c1 3300050492 Bacteria 4533
460 nmdc:mga06z11_14292_c1 3300050494 Bacteria 3513
461 nmdc:mga06z11_9275_c1 3300050494 Bacteria 4140
462 nmdc:mga07m45_39109_c1 3300050496 Bacteria 2650
463 nmdc:mga05p37_21815_c1 3300050507 Bacteria 7758
464 nmdc:mga06r32_46516_c1 3300050510 Bacteria 4140
465 nmdc:mga06r32_7913_c1 3300050510 Bacteria 9557
466 nmdc:mga08y16_3175_c1 3300050511 Bacteria 17014
467 nmdc:mga0n895_169848_c1 3300050512 Unclassified 2213
468 nmdc:mga0a205_2949_c1 3300050515 Bacteria 15081
469 Ga0500643_000040 3300053087 Bacteria 168108
470 Ga0500641_0012911 3300053096 Bacteria 3060
471 Ga0500557_000045 3300053105 Bacteria 61505
472 Ga0500562_001140 3300053108 Bacteria 6533
473 Ga0500572_008325 3300053111 Bacteria 2421
474 Ga0500595_009441 3300053119 Bacteria 3938
475 Ga0500614_004234 3300053123 Bacteria 3041
476 Ga0500658_0053855 3300053134 Bacteria 1651
477 Ga0500559_0003665 3300053136 Bacteria 7507
478 Ga0500559_0030682 3300053136 Bacteria 2305
479 Ga0500564_018962 3300053138 Bacteria 3141
480 Ga0500586_012291 3300053145 Bacteria 2486
481 Ga0500590_019094 3300053148 Bacteria 3551
482 Ga0500620_000589 3300053155 Bacteria 6240
483 Ga0500636_0000082 3300053177 Bacteria 47168
484 Ga0500601_000061 3300053737 Bacteria 22373
485 Ga0501082_0050956 3300060353 Bacteria 3569

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046501 Ga0495607_0014282 Ga0495607_0014282_2794_4152 405
2 3300046519 Ga0495632_0026747 Ga0495632_0026747_179_1537 405
3 3300046520 Ga0495637_0000209 Ga0495637_0000209_5409_6767 405
4 3300046694 Ga0495649_0000267 Ga0495649_0000267_39728_41086 405
5 3300046524 Ga0495648_0053752 Ga0495648_0053752_33_1397 416
6 3300046694 Ga0495649_0099475 Ga0495649_0099475_33_1397 416
7 3300048920 Ga0496117_0065926 Ga0496117_0065926_41_1447 421
8 iso_pu_bacteria 8019648815 8019657822 421
9 3300006881 Ga0068865_100034009 Ga0068865_1000340091 430
10 3300046519 Ga0495632_0055744 Ga0495632_0055744_511_1917 433
11 3300046663 Ga0495635_0105026 Ga0495635_0105026_460_1866 434
12 iso_pu_bacteria 8019638758 8019643891 435
13 3300046506 Ga0495583_0069839 Ga0495583_0069839_15_1439 436
14 3300053134 Ga0500658_0053855 Ga0500658_0053855_56_1537 442
15 3300046460 Ga0495638_0073321 Ga0495638_0073321_580_2070 458
16 3300046523 Ga0495644_0019207 Ga0495644_0019207_20_1510 458
17 3300047469 Ga0495673_0016622 Ga0495673_0016622_20_1510 458
18 3300009551 Ga0105238_10047100 Ga0105238_100471002 478
19 3300025924 Ga0207694_10047826 Ga0207694_100478262 478
20 iso_pu_bacteria 2849076700 2849078762 478
21 3300046530 Ga0495654_0059139 Ga0495654_0059139_281_1834 480
22 3300048917 Ga0496114_0000674 Ga0496114_0000674_16805_18487 480
23 3300037418 Ga0395900_0093154 Ga0395900_0093154_1026_2714 483
24 3300038443 Ga0395901_0081053 Ga0395901_0081053_880_2568 483
25 3300005434 Ga0070709_10000919 Ga0070709_100009195 490
26 3300025915 Ga0207693_10011815 Ga0207693_100118155 490
27 3300005436 Ga0070713_100043990 Ga0070713_1000439902 491
28 3300005439 Ga0070711_100006855 Ga0070711_1000068554 491
29 3300006173 Ga0070716_100049336 Ga0070716_1000493361 491
30 3300006175 Ga0070712_100002255 Ga0070712_1000022554 491
31 3300025906 Ga0207699_10007534 Ga0207699_100075343 491
32 3300038443 Ga0395901_0029678 Ga0395901_0029678_363_2051 499
33 3300048913 Ga0496110_0001928 Ga0496110_0001928_3906_5597 499
34 3300048927 Ga0496124_0004840 Ga0496124_0004840_4015_5706 499
35 3300013306 Ga0163162_10008002 Ga0163162_100080025 500
36 3300048920 Ga0496117_0002612 Ga0496117_0002612_18031_19722 500
37 3300048921 Ga0496118_0002927 Ga0496118_0002927_2677_4368 500
38 3300048929 Ga0496126_0002766 Ga0496126_0002766_10580_12268 500
39 3300036401 Ga0373937_0006557 Ga0373937_0006557_7931_9619 501
40 3300006353 Ga0075370_10031471 Ga0075370_100314713 502
41 3300048922 Ga0496119_0037223 Ga0496119_0037223_1359_2999 503
42 3300009036 Ga0105244_10000071 Ga0105244_1000007135 504
43 3300025728 Ga0207655_1000027 Ga0207655_1000027328 504
44 3300003215 JGI25153J46596_10000390 JGI25153J46596_100003909 505
45 3300005347 Ga0070668_100009153 Ga0070668_1000091538 505
46 3300005355 Ga0070671_100010474 Ga0070671_1000104742 505
47 3300005548 Ga0070665_100091722 Ga0070665_1000917222 505
48 3300005577 Ga0068857_100013610 Ga0068857_1000136102 505
49 3300005614 Ga0068856_100034730 Ga0068856_1000347303 505
50 3300005842 Ga0068858_100033437 Ga0068858_1000334374 505
51 3300006042 Ga0075368_10003552 Ga0075368_100035524 505
52 3300006048 Ga0075363_100015191 Ga0075363_1000151913 505
53 3300006051 Ga0075364_10001453 Ga0075364_1000145310 505
54 3300006177 Ga0075362_10022461 Ga0075362_100224612 505
55 3300006178 Ga0075367_10010612 Ga0075367_100106123 505
56 3300006353 Ga0075370_10008191 Ga0075370_100081913 505
57 3300009098 Ga0105245_10153273 Ga0105245_101532732 505
58 3300009101 Ga0105247_10003693 Ga0105247_100036932 505
59 3300009174 Ga0105241_10026293 Ga0105241_100262932 505
60 3300009545 Ga0105237_10005770 Ga0105237_100057708 505
61 3300025297 Ga0209758_1000131 Ga0209758_100013148 505
62 3300025904 Ga0207647_10000715 Ga0207647_100007154 505
63 3300025927 Ga0207687_10079351 Ga0207687_100793512 505
64 3300025972 Ga0207668_10020660 Ga0207668_100206603 505
65 3300026035 Ga0207703_10024189 Ga0207703_100241893 505
66 3300026078 Ga0207702_10043992 Ga0207702_100439923 505
67 3300028379 Ga0268266_10027424 Ga0268266_100274242 505
68 3300046522 Ga0495643_0007555 Ga0495643_0007555_808_2496 505
69 3300047443 Ga0495687_009092 Ga0495687_009092_2307_3995 505
70 3300048903 Ga0496100_0024732 Ga0496100_0024732_1640_3328 505
71 3300048906 Ga0496103_0001986 Ga0496103_0001986_7518_9206 505
72 3300048907 Ga0496104_0016750 Ga0496104_0016750_73_1761 505
73 3300048912 Ga0496109_0036892 Ga0496109_0036892_1578_3266 505
74 3300048916 Ga0496113_0002795 Ga0496113_0002795_899_2587 505
75 3300048921 Ga0496118_0044075 Ga0496118_0044075_1560_3248 505
76 3300050490 nmdc:mga03n38_24409_c1 nmdc:mga03n38_24409_c1_746_2434 505
77 3300050494 nmdc:mga06z11_14292_c1 nmdc:mga06z11_14292_c1_1146_2834 505
78 3300050496 nmdc:mga07m45_39109_c1 nmdc:mga07m45_39109_c1_132_1820 505
79 3300046452 Ga0495617_000265 Ga0495617_000265_21501_23192 506
80 3300046452 Ga0495617_001069 Ga0495617_001069_3046_4737 506
81 3300046452 Ga0495617_001700 Ga0495617_001700_3278_4969 506
82 3300046457 Ga0495590_0001063 Ga0495590_0001063_973_2664 506
83 3300046458 Ga0495591_000086 Ga0495591_000086_38410_40101 506
84 3300046460 Ga0495638_0002236 Ga0495638_0002236_12042_13733 506
85 3300046460 Ga0495638_0003298 Ga0495638_0003298_219_1910 506
86 3300046460 Ga0495638_0013370 Ga0495638_0013370_2150_3841 506
87 3300046471 Ga0495650_0000690 Ga0495650_0000690_22596_24287 506
88 3300046471 Ga0495650_0007766 Ga0495650_0007766_1042_2733 506
89 3300046492 Ga0495585_0000331 Ga0495585_0000331_25964_27655 506
90 3300046500 Ga0495596_0000027 Ga0495596_0000027_37963_39654 506
91 3300046501 Ga0495607_0006140 Ga0495607_0006140_5831_7522 506
92 3300046501 Ga0495607_0006522 Ga0495607_0006522_6178_7869 506
93 3300046507 Ga0495606_0004489 Ga0495606_0004489_6387_8078 506
94 3300046507 Ga0495606_0022098 Ga0495606_0022098_1915_3606 506
95 3300046513 Ga0495616_0000769 Ga0495616_0000769_2078_3769 506
96 3300046513 Ga0495616_0025847 Ga0495616_0025847_246_1937 506
97 3300046519 Ga0495632_0004717 Ga0495632_0004717_246_1937 506
98 3300046519 Ga0495632_0036312 Ga0495632_0036312_497_2188 506
99 3300046520 Ga0495637_0000256 Ga0495637_0000256_1840_3531 506
100 3300046520 Ga0495637_0004354 Ga0495637_0004354_4165_5856 506
101 3300046522 Ga0495643_0003302 Ga0495643_0003302_4294_5985 506
102 3300046522 Ga0495643_0006140 Ga0495643_0006140_5757_7448 506
103 3300046530 Ga0495654_0001179 Ga0495654_0001179_16733_18424 506
104 3300046530 Ga0495654_0001819 Ga0495654_0001819_4164_5855 506
105 3300046530 Ga0495654_0004422 Ga0495654_0004422_850_2541 506
106 3300046530 Ga0495654_0032282 Ga0495654_0032282_495_2186 506
107 3300046542 Ga0495597_0004087 Ga0495597_0004087_6202_7893 506
108 3300046542 Ga0495597_0004751 Ga0495597_0004751_5423_7114 506
109 3300046558 Ga0495633_0000610 Ga0495633_0000610_10482_12173 506
110 3300046616 Ga0495668_0000281 Ga0495668_0000281_30689_32380 506
111 3300046691 Ga0495670_0027309 Ga0495670_0027309_206_1897 506
112 3300046692 Ga0495671_0012413 Ga0495671_0012413_2025_3716 506
113 3300046692 Ga0495671_0035854 Ga0495671_0035854_736_2427 506
114 3300046794 Ga0495589_0000565 Ga0495589_0000565_6322_8013 506
115 3300046794 Ga0495589_0000567 Ga0495589_0000567_19143_20834 506
116 3300046794 Ga0495589_0003971 Ga0495589_0003971_243_1934 506
117 3300047320 Ga0495672_0021209 Ga0495672_0021209_775_2466 506
118 3300047469 Ga0495673_0000354 Ga0495673_0000354_50106_51797 506
119 3300047469 Ga0495673_0000399 Ga0495673_0000399_23399_25090 506
120 3300047469 Ga0495673_0005174 Ga0495673_0005174_2132_3823 506
121 3300047472 Ga0495686_0001687 Ga0495686_0001687_16413_18104 506
122 3300048091 Ga0495626_0000077 Ga0495626_0000077_9144_10835 506
123 3300049459 Ga0495678_002170 Ga0495678_002170_11714_13405 506
124 3300049459 Ga0495678_003633 Ga0495678_003633_7264_8955 506
125 3300049460 Ga0495682_0013691 Ga0495682_0013691_972_2663 506
126 3300005288 Ga0065714_10064981 Ga0065714_1006498116 508
127 3300006946 Ga0079104_1000245 Ga0079104_100024530 508
128 3300009036 Ga0105244_10001439 Ga0105244_100014396 508
129 3300009036 Ga0105244_10022157 Ga0105244_100221571 508
130 3300013306 Ga0163162_10000085 Ga0163162_1000008515 508
131 3300013308 Ga0157375_10039541 Ga0157375_100395413 508
132 3300017792 Ga0163161_10000111 Ga0163161_1000011127 508
133 3300025728 Ga0207655_1001713 Ga0207655_10017138 508
134 3300025728 Ga0207655_1011942 Ga0207655_10119422 508
135 3300027111 Ga0209281_1000046 Ga0209281_100004627 508
136 3300046452 Ga0495617_000490 Ga0495617_000490_17409_19100 508
137 3300046452 Ga0495617_013898 Ga0495617_013898_171_1859 508
138 3300046452 Ga0495617_014837 Ga0495617_014837_525_2216 508
139 3300046453 Ga0495627_001943 Ga0495627_001943_1857_3548 508
140 3300046457 Ga0495590_0000062 Ga0495590_0000062_30458_32149 508
141 3300046458 Ga0495591_000305 Ga0495591_000305_17003_18691 508
142 3300046458 Ga0495591_005476 Ga0495591_005476_3068_4759 508
143 3300046460 Ga0495638_0000450 Ga0495638_0000450_19376_21067 508
144 3300046460 Ga0495638_0004555 Ga0495638_0004555_8363_10054 508
145 3300046471 Ga0495650_0000073 Ga0495650_0000073_119500_121188 508
146 3300046471 Ga0495650_0006563 Ga0495650_0006563_3592_5283 508
147 3300046474 Ga0495605_0004653 Ga0495605_0004653_5856_7547 508
148 3300046491 Ga0495584_0000389 Ga0495584_0000389_21140_22831 508
149 3300046491 Ga0495584_0005436 Ga0495584_0005436_4126_5814 508
150 3300046491 Ga0495584_0006036 Ga0495584_0006036_1374_3065 508
151 3300046492 Ga0495585_0000869 Ga0495585_0000869_23341_25032 508
152 3300046492 Ga0495585_0006797 Ga0495585_0006797_4020_5708 508
153 3300046492 Ga0495585_0007893 Ga0495585_0007893_3399_5090 508
154 3300046500 Ga0495596_0000681 Ga0495596_0000681_1810_3501 508
155 3300046500 Ga0495596_0034531 Ga0495596_0034531_95_1783 508
156 3300046501 Ga0495607_0004183 Ga0495607_0004183_7430_9121 508
157 3300046501 Ga0495607_0004824 Ga0495607_0004824_3712_5403 508
158 3300046501 Ga0495607_0007614 Ga0495607_0007614_5012_6700 508
159 3300046506 Ga0495583_0000380 Ga0495583_0000380_2654_4342 508
160 3300046506 Ga0495583_0001221 Ga0495583_0001221_7295_8986 508
161 3300046506 Ga0495583_0009449 Ga0495583_0009449_3257_4948 508
162 3300046507 Ga0495606_0000047 Ga0495606_0000047_48697_50385 508
163 3300046512 Ga0495610_0000192 Ga0495610_0000192_44820_46511 508
164 3300046512 Ga0495610_0011264 Ga0495610_0011264_1408_3099 508
165 3300046512 Ga0495610_0012486 Ga0495610_0012486_3242_4933 508
166 3300046512 Ga0495610_0023636 Ga0495610_0023636_245_1936 508
167 3300046513 Ga0495616_0000622 Ga0495616_0000622_15522_17213 508
168 3300046515 Ga0495620_0023598 Ga0495620_0023598_1198_2889 508
169 3300046518 Ga0495631_0001246 Ga0495631_0001246_5437_7128 508
170 3300046519 Ga0495632_0000346 Ga0495632_0000346_2732_4423 508
171 3300046520 Ga0495637_0000016 Ga0495637_0000016_153502_155190 508
172 3300046520 Ga0495637_0000060 Ga0495637_0000060_58116_59807 508
173 3300046520 Ga0495637_0005062 Ga0495637_0005062_4830_6521 508
174 3300046522 Ga0495643_0000536 Ga0495643_0000536_37820_39511 508
175 3300046522 Ga0495643_0012340 Ga0495643_0012340_3104_4792 508
176 3300046524 Ga0495648_0000185 Ga0495648_0000185_29436_31127 508
177 3300046524 Ga0495648_0000336 Ga0495648_0000336_11638_13329 508
178 3300046524 Ga0495648_0000405 Ga0495648_0000405_44459_46150 508
179 3300046524 Ga0495648_0001275 Ga0495648_0001275_7871_9562 508
180 3300046524 Ga0495648_0014973 Ga0495648_0014973_2967_4655 508
181 3300046528 Ga0495642_0000006 Ga0495642_0000006_96779_98470 508
182 3300046530 Ga0495654_0007747 Ga0495654_0007747_3259_4950 508
183 3300046538 Ga0495609_0003185 Ga0495609_0003185_1644_3335 508
184 3300046538 Ga0495609_0025231 Ga0495609_0025231_592_2283 508
185 3300046542 Ga0495597_0003852 Ga0495597_0003852_2389_4080 508
186 3300046542 Ga0495597_0003905 Ga0495597_0003905_1854_3545 508
187 3300046557 Ga0495622_0008117 Ga0495622_0008117_1133_2824 508
188 3300046557 Ga0495622_0009036 Ga0495622_0009036_1020_2711 508
189 3300046558 Ga0495633_0012353 Ga0495633_0012353_645_2336 508
190 3300046616 Ga0495668_0019585 Ga0495668_0019585_667_2358 508
191 3300046648 Ga0495611_0000012 Ga0495611_0000012_74268_75959 508
192 3300046648 Ga0495611_0001133 Ga0495611_0001133_4444_6132 508
193 3300046648 Ga0495611_0006395 Ga0495611_0006395_2906_4597 508
194 3300046660 Ga0495625_0000886 Ga0495625_0000886_8785_10476 508
195 3300046660 Ga0495625_0000921 Ga0495625_0000921_25702_27393 508
196 3300046660 Ga0495625_0066204 Ga0495625_0066204_201_1889 508
197 3300046665 Ga0495661_0000001 Ga0495661_0000001_419557_421245 508
198 3300046665 Ga0495661_0000425 Ga0495661_0000425_7371_9062 508
199 3300046674 Ga0495588_0025959 Ga0495588_0025959_363_2054 508
200 3300046684 Ga0495669_0027259 Ga0495669_0027259_417_2108 508
201 3300046691 Ga0495670_0000035 Ga0495670_0000035_24151_25842 508
202 3300046692 Ga0495671_0000588 Ga0495671_0000588_9687_11378 508
203 3300046692 Ga0495671_0011481 Ga0495671_0011481_2151_3842 508
204 3300046694 Ga0495649_0000128 Ga0495649_0000128_21790_23481 508
205 3300046694 Ga0495649_0000502 Ga0495649_0000502_27484_29175 508
206 3300046694 Ga0495649_0000632 Ga0495649_0000632_24832_26523 508
207 3300046694 Ga0495649_0003916 Ga0495649_0003916_884_2575 508
208 3300046694 Ga0495649_0042050 Ga0495649_0042050_140_1831 508
209 3300046794 Ga0495589_0000499 Ga0495589_0000499_7539_9230 508
210 3300046794 Ga0495589_0006474 Ga0495589_0006474_3248_4939 508
211 3300046810 Ga0495660_0000210 Ga0495660_0000210_24740_26431 508
212 3300046810 Ga0495660_0041460 Ga0495660_0041460_409_2097 508
213 3300046810 Ga0495660_0042754 Ga0495660_0042754_571_2262 508
214 3300047320 Ga0495672_0000158 Ga0495672_0000158_72003_73694 508
215 3300047320 Ga0495672_0001010 Ga0495672_0001010_21949_23640 508
216 3300047320 Ga0495672_0053849 Ga0495672_0053849_356_2044 508
217 3300047321 Ga0495676_0000001 Ga0495676_0000001_465163_466851 508
218 3300047323 Ga0495683_0000111 Ga0495683_0000111_78620_80311 508
219 3300047323 Ga0495683_0002716 Ga0495683_0002716_2511_4202 508
220 3300047323 Ga0495683_0003120 Ga0495683_0003120_2737_4425 508
221 3300047446 Ga0495679_000166 Ga0495679_000166_49748_51436 508
222 3300047469 Ga0495673_0001866 Ga0495673_0001866_13309_15000 508
223 3300047469 Ga0495673_0001998 Ga0495673_0001998_1054_2745 508
224 3300047469 Ga0495673_0029878 Ga0495673_0029878_745_2436 508
225 3300047470 Ga0495681_0004842 Ga0495681_0004842_5668_7359 508
226 3300047470 Ga0495681_0004995 Ga0495681_0004995_2157_3845 508
227 3300047470 Ga0495681_0013330 Ga0495681_0013330_1858_3549 508
228 3300047472 Ga0495686_0003224 Ga0495686_0003224_1028_2719 508
229 3300047472 Ga0495686_0057076 Ga0495686_0057076_128_1816 508
230 3300048091 Ga0495626_0000008 Ga0495626_0000008_115248_116936 508
231 3300048091 Ga0495626_0001286 Ga0495626_0001286_15387_17078 508
232 3300048091 Ga0495626_0002093 Ga0495626_0002093_3348_5039 508
233 3300048091 Ga0495626_0013065 Ga0495626_0013065_1755_3446 508
234 3300048920 Ga0496117_0000842 Ga0496117_0000842_39420_41111 508
235 3300048921 Ga0496118_0000883 Ga0496118_0000883_6190_7881 508
236 3300048924 Ga0496121_0001195 Ga0496121_0001195_37399_39090 508
237 3300048929 Ga0496126_0050717 Ga0496126_0050717_1316_3007 508
238 3300049459 Ga0495678_001538 Ga0495678_001538_1671_3359 508
239 3300049459 Ga0495678_002612 Ga0495678_002612_6756_8447 508
240 3300053145 Ga0500586_012291 Ga0500586_012291_252_1943 508
241 3300013105 Ga0157369_10002741 Ga0157369_100027416 510
242 3300014968 Ga0157379_10152227 Ga0157379_101522272 510
243 3300060353 Ga0501082_0050956 Ga0501082_0050956_379_2067 510
244 3300035695 Ga0373927_0011770 Ga0373927_0011770_1824_3527 511
245 3300013104 Ga0157370_10048292 Ga0157370_100482924 512
246 3300037471 Ga0395905_0000838 Ga0395905_0000838_14261_15949 512
247 3300048904 Ga0496101_0033536 Ga0496101_0033536_865_2661 512
248 3300046491 Ga0495584_0002599 Ga0495584_0002599_3656_5347 513
249 3300046512 Ga0495610_0003732 Ga0495610_0003732_232_1923 513
250 3300005983 Ga0081540_1004378 Ga0081540_10043783 514
251 3300046512 Ga0495610_0034824 Ga0495610_0034824_741_2435 515
252 3300046519 Ga0495632_0000021 Ga0495632_0000021_182464_184152 515
253 3300046522 Ga0495643_0001277 Ga0495643_0001277_3209_4897 515
254 3300046524 Ga0495648_0000156 Ga0495648_0000156_13680_15374 515
255 3300048913 Ga0496110_0019731 Ga0496110_0019731_2317_3999 515
256 3300048927 Ga0496124_0000847 Ga0496124_0000847_17217_18899 515
257 3300048927 Ga0496124_0012142 Ga0496124_0012142_916_2610 515
258 3300048928 Ga0496125_0006141 Ga0496125_0006141_2299_3981 515
259 3300048929 Ga0496126_0008543 Ga0496126_0008543_7017_8699 515
260 3300053108 Ga0500562_001140 Ga0500562_001140_271_1965 515
261 3300046507 Ga0495606_0000177 Ga0495606_0000177_21394_23085 516
262 3300046522 Ga0495643_0001236 Ga0495643_0001236_20721_22412 516
263 3300046692 Ga0495671_0002165 Ga0495671_0002165_1297_2988 516
264 3300046694 Ga0495649_0001060 Ga0495649_0001060_13512_15203 516
265 3300046694 Ga0495649_0043049 Ga0495649_0043049_222_1913 516
266 3300046524 Ga0495648_0015336 Ga0495648_0015336_3078_4772 517
267 3300053111 Ga0500572_008325 Ga0500572_008325_614_2302 517
268 3300053136 Ga0500559_0030682 Ga0500559_0030682_162_1850 517
269 3300053138 Ga0500564_018962 Ga0500564_018962_61_1749 517
270 3300053148 Ga0500590_019094 Ga0500590_019094_1102_2790 517
271 3300053155 Ga0500620_000589 Ga0500620_000589_3446_5134 517
272 3300053177 Ga0500636_0000082 Ga0500636_0000082_35425_37113 517
273 3300049822 Ga0501035_0000418 Ga0501035_0000418_8615_10303 518
274 3300053136 Ga0500559_0003665 Ga0500559_0003665_2740_4428 518
275 3300005347 Ga0070668_100004843 Ga0070668_1000048435 519
276 3300005455 Ga0070663_100013717 Ga0070663_1000137173 519
277 3300006038 Ga0075365_10037446 Ga0075365_100374462 519
278 3300009101 Ga0105247_10072787 Ga0105247_100727871 519
279 3300014969 Ga0157376_10098304 Ga0157376_100983042 519
280 3300025972 Ga0207668_10027117 Ga0207668_100271172 519
281 3300026035 Ga0207703_10085343 Ga0207703_100853432 519
282 3300026067 Ga0207678_10005395 Ga0207678_1000539510 519
283 3300046524 Ga0495648_0000062 Ga0495648_0000062_127945_129636 519
284 3300046533 Ga0495640_0022430 Ga0495640_0022430_2149_3837 519
285 3300046674 Ga0495588_0021294 Ga0495588_0021294_485_2173 519
286 3300046689 Ga0495613_0037296 Ga0495613_0037296_1163_2851 519
287 3300046690 Ga0495624_0072305 Ga0495624_0072305_297_1985 519
288 3300047315 Ga0495581_0034206 Ga0495581_0034206_27_1715 519
289 3300047317 Ga0495604_0006641 Ga0495604_0006641_6089_7777 519
290 3300047469 Ga0495673_0039248 Ga0495673_0039248_63_1751 519
291 3300048903 Ga0496100_0100165 Ga0496100_0100165_229_1917 519
292 3300048904 Ga0496101_0037700 Ga0496101_0037700_318_2006 519
293 3300048905 Ga0496102_0016670 Ga0496102_0016670_4120_5808 519
294 3300048906 Ga0496103_0060577 Ga0496103_0060577_182_1870 519
295 3300048907 Ga0496104_0074813 Ga0496104_0074813_757_2445 519
296 3300048908 Ga0496105_0002112 Ga0496105_0002112_8178_9866 519
297 3300048908 Ga0496105_0015397 Ga0496105_0015397_2619_4307 519
298 3300048910 Ga0496107_0028479 Ga0496107_0028479_1654_3342 519
299 3300048915 Ga0496112_0130287 Ga0496112_0130287_568_2256 519
300 3300048917 Ga0496114_0084134 Ga0496114_0084134_780_2468 519
301 3300048923 Ga0496120_0008150 Ga0496120_0008150_17_1705 519
302 3300049585 Ga0501069_0014107 Ga0501069_0014107_1552_3240 519
303 iso_pu_bacteria 2511231024 2511375919 519
304 iso_pu_bacteria 2765235841 2765583568 519
305 iso_pu_bacteria 8019547302 8019554327 519
306 3300010375 Ga0105239_10051798 Ga0105239_100517983 520
307 3300048908 Ga0496105_0149456 Ga0496105_0149456_212_1900 520
308 3300048909 Ga0496106_0027733 Ga0496106_0027733_821_2509 520
309 3300048917 Ga0496114_0001850 Ga0496114_0001850_3739_5427 520
310 iso_pu_bacteria 3007803356 3007808606 520
311 3300050510 nmdc:mga06r32_46516_c1 nmdc:mga06r32_46516_c1_915_2600 521
312 iso_pu_bacteria 2511231023 2511369700 521
313 iso_pu_bacteria 2511231031 2511413182 521
314 iso_pu_bacteria 2643221589 2643954576 521
315 iso_pu_bacteria 2643221602 2644023385 521
316 iso_pu_bacteria 3007614139 3007619103 521
317 iso_pu_bacteria 8056177738 8056178167 521
318 3300005327 Ga0070658_10075856 Ga0070658_100758562 522
319 3300005337 Ga0070682_100036010 Ga0070682_1000360102 522
320 3300005339 Ga0070660_100111295 Ga0070660_1001112951 522
321 3300005455 Ga0070663_100016602 Ga0070663_1000166024 522
322 3300025909 Ga0207705_10071243 Ga0207705_100712432 522
323 3300025919 Ga0207657_10071251 Ga0207657_100712512 522
324 3300026067 Ga0207678_10004072 Ga0207678_1000407219 522
325 3300036401 Ga0373937_0083190 Ga0373937_0083190_178_1866 522
326 3300044684 Ga0466966_0001768 Ga0466966_0001768_3897_5585 522
327 3300044693 Ga0466961_0000009 Ga0466961_0000009_114752_116440 522
328 3300045049 Ga0466959_0003178 Ga0466959_0003178_5182_6870 522
329 3300046462 Ga0495651_0011984 Ga0495651_0011984_3402_5090 522
330 3300046507 Ga0495606_0008334 Ga0495606_0008334_6562_8250 522
331 3300048907 Ga0496104_0056659 Ga0496104_0056659_1920_3608 522
332 3300048908 Ga0496105_0134015 Ga0496105_0134015_76_1872 522
333 3300048913 Ga0496110_0069850 Ga0496110_0069850_344_2032 522
334 3300048914 Ga0496111_0025069 Ga0496111_0025069_2022_3710 522
335 3300048915 Ga0496112_0049898 Ga0496112_0049898_306_1994 522
336 3300048917 Ga0496114_0098638 Ga0496114_0098638_776_2476 522
337 3300053119 Ga0500595_009441 Ga0500595_009441_1267_2955 522
338 3300010375 Ga0105239_10103975 Ga0105239_101039752 523
339 3300030521 Ga0307511_10034544 Ga0307511_100345443 523
340 3300031507 Ga0307509_10003603 Ga0307509_1000360319 523
341 3300035692 Ga0373935_0015603 Ga0373935_0015603_1314_3002 523
342 3300035695 Ga0373927_0020298 Ga0373927_0020298_844_2532 523
343 3300046507 Ga0495606_0005687 Ga0495606_0005687_1242_2930 523
344 3300046557 Ga0495622_0026546 Ga0495622_0026546_786_2474 523
345 3300046694 Ga0495649_0016077 Ga0495649_0016077_2192_3880 523
346 3300048909 Ga0496106_0001640 Ga0496106_0001640_4072_5760 523
347 3300048920 Ga0496117_0020165 Ga0496117_0020165_1152_2840 523
348 3300048921 Ga0496118_0007918 Ga0496118_0007918_1775_3463 523
349 3300048924 Ga0496121_0000218 Ga0496121_0000218_102899_104587 523
350 3300048927 Ga0496124_0002080 Ga0496124_0002080_3537_5225 523
351 3300048929 Ga0496126_0001598 Ga0496126_0001598_2265_3953 523
352 3300005288 Ga0065714_10066318 Ga0065714_100663182 524
353 3300006844 Ga0075428_100008624 Ga0075428_1000086244 524
354 3300006846 Ga0075430_100075448 Ga0075430_1000754482 524
355 3300006847 Ga0075431_100058689 Ga0075431_1000586893 524
356 3300006880 Ga0075429_100023272 Ga0075429_1000232724 524
357 3300009094 Ga0111539_10005573 Ga0111539_100055736 524
358 3300009147 Ga0114129_10029146 Ga0114129_100291466 524
359 3300025261 Ga0209233_1000599 Ga0209233_10005997 524
360 3300042115 Ga0450911_000652 Ga0450911_000652_5152_6843 524
361 3300046452 Ga0495617_006363 Ga0495617_006363_224_1915 524
362 3300046458 Ga0495591_000181 Ga0495591_000181_44989_46680 524
363 3300046458 Ga0495591_024490 Ga0495591_024490_146_1837 524
364 3300046460 Ga0495638_0002048 Ga0495638_0002048_2166_3857 524
365 3300046471 Ga0495650_0004735 Ga0495650_0004735_3333_5024 524
366 3300046492 Ga0495585_0000054 Ga0495585_0000054_95885_97576 524
367 3300046492 Ga0495585_0000208 Ga0495585_0000208_31197_32888 524
368 3300046492 Ga0495585_0000417 Ga0495585_0000417_5496_7187 524
369 3300046507 Ga0495606_0002916 Ga0495606_0002916_16528_18219 524
370 3300046507 Ga0495606_0003003 Ga0495606_0003003_16287_17978 524
371 3300046507 Ga0495606_0050889 Ga0495606_0050889_181_1872 524
372 3300046512 Ga0495610_0005268 Ga0495610_0005268_4943_6634 524
373 3300046512 Ga0495610_0005610 Ga0495610_0005610_561_2252 524
374 3300046519 Ga0495632_0005072 Ga0495632_0005072_3578_5269 524
375 3300046520 Ga0495637_0029634 Ga0495637_0029634_171_1862 524
376 3300046524 Ga0495648_0000280 Ga0495648_0000280_19530_21221 524
377 3300046530 Ga0495654_0003563 Ga0495654_0003563_7276_8967 524
378 3300046543 Ga0495645_0090401 Ga0495645_0090401_175_1875 524
379 3300046616 Ga0495668_0000365 Ga0495668_0000365_9197_10888 524
380 3300046660 Ga0495625_0003916 Ga0495625_0003916_10311_12002 524
381 3300046660 Ga0495625_0083684 Ga0495625_0083684_25_1716 524
382 3300046691 Ga0495670_0004943 Ga0495670_0004943_1889_3580 524
383 3300046694 Ga0495649_0000306 Ga0495649_0000306_34823_36514 524
384 3300046810 Ga0495660_0046217 Ga0495660_0046217_632_2323 524
385 3300047323 Ga0495683_0000750 Ga0495683_0000750_10008_11699 524
386 3300047446 Ga0495679_000199 Ga0495679_000199_6658_8349 524
387 3300047469 Ga0495673_0022056 Ga0495673_0022056_869_2560 524
388 3300047469 Ga0495673_0023286 Ga0495673_0023286_888_2579 524
389 3300047470 Ga0495681_0000069 Ga0495681_0000069_70309_72000 524
390 3300047470 Ga0495681_0004059 Ga0495681_0004059_1455_3146 524
391 3300047472 Ga0495686_0000291 Ga0495686_0000291_61732_63423 524
392 3300048091 Ga0495626_0000778 Ga0495626_0000778_6787_8478 524
393 3300049459 Ga0495678_027291 Ga0495678_027291_171_1862 524
394 3300050507 nmdc:mga05p37_21815_c1 nmdc:mga05p37_21815_c1_312_2000 524
395 3300050510 nmdc:mga06r32_7913_c1 nmdc:mga06r32_7913_c1_1521_3209 524
396 3300050511 nmdc:mga08y16_3175_c1 nmdc:mga08y16_3175_c1_5769_7457 524
397 iso_pu_bacteria 2507262055 2507508096 524
398 iso_pu_bacteria 2508501009 2508542883 524
399 iso_pu_bacteria 2508501042 2508692256 524
400 iso_pu_bacteria 2513237094 2513643670 524
401 iso_pu_bacteria 2513237095 2513646985 524
402 iso_pu_bacteria 2513237139 2513877692 524
403 iso_pu_bacteria 2513237161 2514015750 524
404 iso_pu_bacteria 2617270735 2617346348 524
405 iso_pu_bacteria 2728368998 2728748181 524
406 iso_pu_bacteria 2791355196 2793060738 524
407 iso_pu_bacteria 2802429603 2805918294 524
408 iso_pu_bacteria 2816332527 2818236025 524
409 iso_pu_bacteria 2824600985 2824606441 524
410 iso_pu_bacteria 2824609381 2824616361 524
411 iso_pu_bacteria 2824617872 2824621577 524
412 iso_pu_bacteria 2824626560 2824629233 524
413 iso_pu_bacteria 2824635225 2824637311 524
414 iso_pu_bacteria 2824644064 2824645221 524
415 iso_pu_bacteria 2824653114 2824657792 524
416 iso_pu_bacteria 2824687955 2824693849 524
417 iso_pu_bacteria 2824714736 2824716700 524
418 iso_pu_bacteria 2824723954 2824724931 524
419 iso_pu_bacteria 2824773399 2824774596 524
420 iso_pu_bacteria 2838122688 2838123225 524
421 iso_pu_bacteria 2841941048 2841946500 524
422 iso_pu_bacteria 2841949485 2841954257 524
423 iso_pu_bacteria 2841966195 2841969630 524
424 iso_pu_bacteria 2841974524 2841978933 524
425 iso_pu_bacteria 2841983080 2841983950 524
426 iso_pu_bacteria 2844315083 2844318717 524
427 iso_pu_bacteria 2847939898 2847947328 524
428 iso_pu_bacteria 2874590934 2874596443 524
429 iso_pu_bacteria 2874645413 2874653327 524
430 iso_pu_bacteria 2876761206 2876763927 524
431 iso_pu_bacteria 2876771140 2876777260 524
432 iso_pu_bacteria 2876818435 2876824990 524
433 iso_pu_bacteria 2879074833 2879081398 524
434 iso_pu_bacteria 2879127579 2879132023 524
435 iso_pu_bacteria 2879142872 2879149057 524
436 iso_pu_bacteria 2885366525 2885367960 524
437 iso_pu_bacteria 2888378607 2888384911 524
438 iso_pu_bacteria 2888419890 2888425111 524
439 iso_pu_bacteria 2903727486 2903728848 524
440 iso_pu_bacteria 2906602504 2906604454 524
441 iso_pu_bacteria 2906610324 2906611994 524
442 iso_pu_bacteria 2922425934 2922427303 524
443 iso_pu_bacteria 2935608549 2935609409 524
444 iso_pu_bacteria 2935648319 2935655557 524
445 iso_pu_bacteria 2935656913 2935664403 524
446 iso_pu_bacteria 2935819856 2935822571 524
447 iso_pu_bacteria 2935847175 2935848152 524
448 iso_pu_bacteria 2935908558 2935908624 524
449 iso_pu_bacteria 2935916978 2935917769 524
450 iso_pu_bacteria 2935926038 2935926803 524
451 iso_pu_bacteria 2935934488 2935935252 524
452 iso_pu_bacteria 2935942939 2935943703 524
453 iso_pu_bacteria 2935951376 2935952140 524
454 iso_pu_bacteria 2935967501 2935968265 524
455 iso_pu_bacteria 2935984226 2935986905 524
456 iso_pu_bacteria 2936011229 2936018472 524
457 iso_pu_bacteria 2936019824 2936026990 524
458 iso_pu_bacteria 2936028420 2936035907 524
459 iso_pu_bacteria 2936046547 2936053951 524
460 iso_pu_bacteria 2936055302 2936062952 524
461 iso_pu_bacteria 3005506211 3005508122 524
462 iso_pu_bacteria 3005594810 3005596756 524
463 iso_pu_bacteria 3005718088 3005721912 524
464 iso_pu_bacteria 8019555841 8019560809 524
465 iso_pu_bacteria 8019565922 8019570887 524
466 iso_pu_bacteria 8019687851 8019690586 524
467 3300005539 Ga0068853_100214508 Ga0068853_1002145081 525
468 3300005614 Ga0068856_100054526 Ga0068856_1000545263 525
469 3300005616 Ga0068852_100030149 Ga0068852_1000301493 525
470 3300006871 Ga0075434_100154594 Ga0075434_1001545942 525
471 3300007076 Ga0075435_100071358 Ga0075435_1000713583 525
472 3300009094 Ga0111539_10019435 Ga0111539_100194353 525
473 3300009101 Ga0105247_10006321 Ga0105247_100063214 525
474 3300026142 Ga0207698_10008980 Ga0207698_100089804 525
475 3300035691 Ga0373931_0074190 Ga0373931_0074190_79_1761 525
476 3300046507 Ga0495606_0020924 Ga0495606_0020924_3041_4729 525
477 3300046529 Ga0495652_0042818 Ga0495652_0042818_965_2653 525
478 3300046663 Ga0495635_0004801 Ga0495635_0004801_1520_3208 525
479 3300048907 Ga0496104_0007828 Ga0496104_0007828_6327_8015 525
480 3300048922 Ga0496119_0009366 Ga0496119_0009366_426_2114 525
481 3300048927 Ga0496124_0076319 Ga0496124_0076319_225_1913 525
482 3300050512 nmdc:mga0n895_169848_c1 nmdc:mga0n895_169848_c1_408_2090 525
483 3300050515 nmdc:mga0a205_2949_c1 nmdc:mga0a205_2949_c1_3280_4962 525
484 3300053123 Ga0500614_004234 Ga0500614_004234_1191_2879 525
485 3300005327 Ga0070658_10136593 Ga0070658_101365931 527
486 3300006844 Ga0075428_100040822 Ga0075428_1000408222 527
487 3300010375 Ga0105239_10012754 Ga0105239_1001275410 527
488 3300044658 Ga0466972_0001886 Ga0466972_0001886_1934_3715 527
489 3300049569 Ga0501032_0025561 Ga0501032_0025561_1158_2969 527
490 3300049570 Ga0501033_0000394 Ga0501033_0000394_10169_11980 527
491 3300049571 Ga0501034_0000157 Ga0501034_0000157_52834_54645 527
492 3300049572 Ga0501036_0004467 Ga0501036_0004467_6758_8569 527
493 3300049573 Ga0501037_0017318 Ga0501037_0017318_2216_4027 527
494 3300049574 Ga0501038_0006974 Ga0501038_0006974_7853_9664 527
495 3300049579 Ga0501043_0001028 Ga0501043_0001028_17355_19166 527
496 3300049581 Ga0501047_0000166 Ga0501047_0000166_54652_56463 527
497 3300049583 Ga0501067_0047687 Ga0501067_0047687_79_1890 527
498 3300049589 Ga0501073_0000027 Ga0501073_0000027_90413_92224 527
499 3300049590 Ga0501074_0013938 Ga0501074_0013938_2385_4196 527
500 3300049742 Ga0501080_0006483 Ga0501080_0006483_7616_9427 527
501 3300049822 Ga0501035_0000145 Ga0501035_0000145_46834_48645 527
502 3300049823 Ga0501044_0000382 Ga0501044_0000382_23767_25578 527
503 3300053087 Ga0500643_000040 Ga0500643_000040_78387_80075 527
504 3300053105 Ga0500557_000045 Ga0500557_000045_18943_20631 527
505 3300053737 Ga0500601_000061 Ga0500601_000061_9314_11002 527
506 3300003215 JGI25153J46596_10000180 JGI25153J46596_1000018029 528
507 3300003794 Ga0055531_10006480 Ga0055531_100064802 528
508 3300005262 Ga0065165_1003135 Ga0065165_10031356 528
509 3300005336 Ga0070680_100003387 Ga0070680_1000033875 528
510 3300005406 Ga0070703_10001256 Ga0070703_100012564 528
511 3300005438 Ga0070701_10001252 Ga0070701_100012524 528
512 3300005440 Ga0070705_100005364 Ga0070705_1000053643 528
513 3300005441 Ga0070700_100006452 Ga0070700_1000064523 528
514 3300005444 Ga0070694_100002725 Ga0070694_1000027252 528
515 3300005455 Ga0070663_100027863 Ga0070663_1000278632 528
516 3300005458 Ga0070681_10008340 Ga0070681_100083404 528
517 3300005518 Ga0070699_100015055 Ga0070699_1000150553 528
518 3300005530 Ga0070679_100119871 Ga0070679_1001198712 528
519 3300005545 Ga0070695_100002263 Ga0070695_1000022633 528
520 3300005546 Ga0070696_100003676 Ga0070696_1000036763 528
521 3300005547 Ga0070693_100017581 Ga0070693_1000175812 528
522 3300005549 Ga0070704_100006686 Ga0070704_1000066863 528
523 3300005564 Ga0070664_100043358 Ga0070664_1000433582 528
524 3300005577 Ga0068857_100020216 Ga0068857_1000202162 528
525 3300005615 Ga0070702_100005120 Ga0070702_1000051203 528
526 3300005617 Ga0068859_100025533 Ga0068859_1000255333 528
527 3300005841 Ga0068863_100110397 Ga0068863_1001103972 528
528 3300005843 Ga0068860_100006519 Ga0068860_1000065195 528
529 3300005844 Ga0068862_100014046 Ga0068862_1000140463 528
530 3300006038 Ga0075365_10005441 Ga0075365_100054415 528
531 3300006038 Ga0075365_10057389 Ga0075365_100573892 528
532 3300006048 Ga0075363_100002557 Ga0075363_1000025574 528
533 3300006051 Ga0075364_10006874 Ga0075364_100068744 528
534 3300006051 Ga0075364_10025038 Ga0075364_100250382 528
535 3300006178 Ga0075367_10002881 Ga0075367_100028812 528
536 3300006931 Ga0097620_100025533 Ga0097620_1000255333 528
537 3300007788 Ga0099795_10001105 Ga0099795_100011052 528
538 3300009174 Ga0105241_10024641 Ga0105241_100246412 528
539 3300009553 Ga0105249_10022566 Ga0105249_100225663 528
540 3300011119 Ga0105246_10047117 Ga0105246_100471172 528
541 3300025297 Ga0209758_1000024 Ga0209758_1000024424 528
542 3300025299 Ga0209256_1001434 Ga0209256_100143417 528
543 3300025304 Ga0209257_1001033 Ga0209257_100103333 528
544 3300025885 Ga0207653_10000657 Ga0207653_100006576 528
545 3300025904 Ga0207647_10056308 Ga0207647_100563081 528
546 3300025912 Ga0207707_10052256 Ga0207707_100522562 528
547 3300025917 Ga0207660_10046818 Ga0207660_100468182 528
548 3300025945 Ga0207679_10086794 Ga0207679_100867941 528
549 3300025961 Ga0207712_10012146 Ga0207712_100121461 528
550 3300026067 Ga0207678_10028066 Ga0207678_100280662 528
551 3300026075 Ga0207708_10003023 Ga0207708_100030237 528
552 3300026116 Ga0207674_10002183 Ga0207674_100021833 528
553 3300028380 Ga0268265_10000961 Ga0268265_1000096113 528
554 3300028381 Ga0268264_10012167 Ga0268264_100121672 528
555 3300035691 Ga0373931_0001957 Ga0373931_0001957_1593_3281 528
556 3300037312 Ga0395899_0034737 Ga0395899_0034737_848_2536 528
557 3300037418 Ga0395900_0000962 Ga0395900_0000962_29177_30865 528
558 3300037466 Ga0395898_0010314 Ga0395898_0010314_5778_7466 528
559 3300038443 Ga0395901_0074337 Ga0395901_0074337_1105_2793 528
560 3300048905 Ga0496102_0002826 Ga0496102_0002826_1502_3196 528
561 3300048906 Ga0496103_0030213 Ga0496103_0030213_619_2313 528
562 3300048909 Ga0496106_0014282 Ga0496106_0014282_965_2659 528
563 3300048910 Ga0496107_0001499 Ga0496107_0001499_8862_10556 528
564 3300049744 Ga0501083_0046568 Ga0501083_0046568_310_2121 528
565 3300050491 nmdc:mga00v17_3714_c1 nmdc:mga00v17_3714_c1_5434_7122 528
566 3300050492 nmdc:mga0yw44_11779_c1 nmdc:mga0yw44_11779_c1_1165_2880 528
567 3300050494 nmdc:mga06z11_9275_c1 nmdc:mga06z11_9275_c1_1562_3250 528
568 3300053096 Ga0500641_0012911 Ga0500641_0012911_28_1752 528
569 iso_pu_bacteria 2881364244 2881370492 528

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06826

Asp-Al_Ex

Predicted Permease Membrane Region

418

579

0.98

PF06826

Asp-Al_Ex

Predicted Permease Membrane Region

56

215

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jxo-assembly1.cif.gz_B crystal structure of an octomeric two-subunit trka k+ channel ring gating assembly, tm1088a:tm1088b, from thermotoga maritima 0.8483 196 271
4xtt-assembly1.cif.gz_B structural studies of potassium transport protein ktra regulator of conductance of k+ (rck) c domain in complex with cyclic diadenosine monophosphate (c-di-amp) 0.8445 200 269
8djb-assembly1.cif.gz_A mthk-a90l mutant in closed state with 0 ca2+ 0.8248 286 358
6i8v-assembly1.cif.gz_A-2 ktrc with atp bound 0.8207 197 269
8fz7-assembly1.cif.gz_A tpea bound closed mthk-a88f mutant in nanodisc 0.8135 280 358
ID Description Score Start End Superfamily
af_P60869_303_372_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8943 285 358 3.30.70.1450
af_P60872_288_364_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8845 201 270 3.30.70.1450
af_P60869_303_372_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8824 285 358 3.30.70.1450
af_P60872_206_272_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8717 288 354 3.30.70.1450
af_P76007_411_484_3.30.70.1450 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Regulator of K+ conductance, C-terminal domain 0.8634 201 264 3.30.70.1450
ID Description Score Start End GO Terms
AF-A0A855HGH2-F1-model_v4 deleted 0.9247 197 279
AF-A0A343THS1-F1-model_v4 TrkA-N domain protein 0.9175 200 265 GO:0005886
GO:0015079
GO:0015297
GO:1902600
AF-A0A256LE67-F1-model_v4 deleted 0.9154 201 269
AF-A0A661YMI4-F1-model_v4 deleted 0.9141 286 357
AF-A0A2E0BAJ9-F1-model_v4 RCK C-terminal domain-containing protein 0.9132 285 357 GO:0006813
GO:0008324
GO:0015297
GO:0016020
GO:1902600

Feature Viewer

pLDDT pTM Quality
69.33 0.57 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map