F464718

General Info

Members Datasets Scaffolds Average Seq Length
569 347 1138 186

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10032506|Ga0105240_100325067
Length 209
Sequence LSGEAVIRFAPGKTPNKIAGVLMKIYLAGPDVFLPDALDIGKRKAAICARHGMRGLYPLDNAVDLTASDASLEIFKGNEAMMDAADAVIANLTPLRGPGADAGTVYELGYMAGRGKFCLAYSNDPTAYAERVRRFDSVTKSADGRLTDSNGLTVEDFGWPDNLMMIHALDLHGAKLVTPRQAPPDIWHDLTSFEACVVLAAGHASGKTG

Samples

Sample ID Description Type Environment
1 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
85 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
86 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
87 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
88 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
132 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
138 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
139 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
140 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
141 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
142 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
145 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
149 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
150 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
151 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
152 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
153 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
159 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
160 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
161 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
166 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
170 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
171 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
172 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
173 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
178 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
181 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
182 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
183 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
184 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
185 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
186 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
187 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
190 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
191 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
197 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
198 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
199 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
200 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
201 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
204 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
205 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
206 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
207 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
211 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
212 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
213 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
219 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
222 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
223 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
224 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
225 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
226 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
227 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
230 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
231 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
232 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
237 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
238 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
239 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
246 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
250 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
251 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
256 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
257 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
268 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
269 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
270 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
271 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
272 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
273 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
274 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
275 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
276 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
277 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
278 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
279 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
280 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
281 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
282 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
286 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
287 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
288 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
289 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
290 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
291 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
292 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
299 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
300 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
301 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
302 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
303 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
304 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
305 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
306 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
307 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
308 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
309 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
310 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
311 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
312 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
313 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
314 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
315 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
316 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
317 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
318 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
319 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
320 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
321 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
322 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
323 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
324 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
325 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
326 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
327 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
328 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
329 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
330 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
331 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
332 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
333 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
334 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
337 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
338 2791355199
339 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
340 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
341 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
342 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
343 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
344 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
345 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
346 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
347 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.89
Metatranscriptomes 0.18
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.99
Nodule 1.05
Rhizoplane 4.57
Rhizosphere 69.6
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105240_10032506 3300009093 Bacteria 6755
2 JGI24740J21852_10001727 3300001979 Bacteria 10038
3 JGI24739J22299_10018516 3300001989 Bacteria 2501
4 JGI24737J22298_10001974 3300001990 Bacteria 7331
5 JGI24735J21928_10075810 3300002067 Bacteria 963
6 JGI25153J46596_10004213 3300003215 Bacteria 7795
7 JGI25404J52841_10022335 3300003659 Bacteria 1367
8 Ga0055526_1031799 3300003771 Bacteria 1503
9 Ga0065165_1086739 3300005262 Bacteria 804
10 Ga0070690_100073701 3300005330 Bacteria 2222
11 Ga0070677_10306555 3300005333 Bacteria 809
12 Ga0068869_100109397 3300005334 Bacteria 2100
13 Ga0070680_100027552 3300005336 Bacteria 4549
14 Ga0070680_100282108 3300005336 Bacteria 1407
15 Ga0070660_100353840 3300005339 Bacteria 1210
16 Ga0070691_10541419 3300005341 Bacteria 679
17 Ga0070661_101232598 3300005344 Bacteria 626
18 Ga0070668_100473459 3300005347 Bacteria 1080
19 Ga0070669_100099354 3300005353 Bacteria 2193
20 Ga0070673_100472240 3300005364 Bacteria 1131
21 Ga0070688_100365806 3300005365 Bacteria 1059
22 Ga0070714_100428433 3300005435 Bacteria 1254
23 Ga0070710_10120684 3300005437 Bacteria 1587
24 Ga0070711_100348154 3300005439 Bacteria 1191
25 Ga0070711_100417289 3300005439 Bacteria 1093
26 Ga0070708_100482175 3300005445 Bacteria 1170
27 Ga0070663_100007429 3300005455 Bacteria 6667
28 Ga0070663_100104901 3300005455 Bacteria 2115
29 Ga0070678_100269321 3300005456 Bacteria 1436
30 Ga0070678_100377484 3300005456 Bacteria 1226
31 Ga0070678_101038603 3300005456 Bacteria 755
32 Ga0070681_10093558 3300005458 Bacteria 2954
33 Ga0070681_10592548 3300005458 Bacteria 1023
34 Ga0070685_10443765 3300005466 Bacteria 908
35 Ga0070706_100143695 3300005467 Bacteria 2228
36 Ga0070706_100257901 3300005467 Bacteria 1628
37 Ga0070706_100715066 3300005467 Bacteria 929
38 Ga0070707_100037942 3300005468 Bacteria 4600
39 Ga0070707_100403804 3300005468 Bacteria 1326
40 Ga0070698_100321222 3300005471 Bacteria 1479
41 Ga0070679_100608670 3300005530 Bacteria 1036
42 Ga0070684_100032347 3300005535 Bacteria 4457
43 Ga0070697_100209623 3300005536 Bacteria 1659
44 Ga0068853_100011055 3300005539 Bacteria 7321
45 Ga0068853_100494121 3300005539 Bacteria 1155
46 Ga0068853_100590088 3300005539 Bacteria 1055
47 Ga0070696_100202200 3300005546 Bacteria 1483
48 Ga0070665_100031480 3300005548 Bacteria 5339
49 Ga0070665_100210330 3300005548 Bacteria 1946
50 Ga0070665_100243303 3300005548 Bacteria 1799
51 Ga0068855_100010142 3300005563 Bacteria 11353
52 Ga0068855_100012537 3300005563 Bacteria 10230
53 Ga0068855_100012743 3300005563 Bacteria 10140
54 Ga0068855_100119566 3300005563 Bacteria 3016
55 Ga0070664_100164016 3300005564 Bacteria 1968
56 Ga0068857_100007716 3300005577 Bacteria 9273
57 Ga0068857_100029003 3300005577 Bacteria 4884
58 Ga0068854_100002531 3300005578 Bacteria 11319
59 Ga0068854_101071011 3300005578 Bacteria 717
60 Ga0068856_100003444 3300005614 Bacteria 16003
61 Ga0068856_100037113 3300005614 Bacteria 4780
62 Ga0068852_100160030 3300005616 Bacteria 2102
63 Ga0068852_101378251 3300005616 Bacteria 727
64 Ga0068859_100484363 3300005617 Bacteria 1332
65 Ga0068851_10001156 3300005834 Bacteria 11450
66 Ga0068851_10287587 3300005834 Bacteria 942
67 Ga0068863_100222523 3300005841 Bacteria 1819
68 Ga0068858_100122129 3300005842 Bacteria 2436
69 Ga0068860_101229216 3300005843 Bacteria 770
70 Ga0068862_100216819 3300005844 Bacteria 1731
71 Ga0068862_100237874 3300005844 Bacteria 1654
72 Ga0068862_100476810 3300005844 Bacteria 1180
73 Ga0081455_10011564 3300005937 Bacteria 8858
74 Ga0081455_10015842 3300005937 Bacteria 7301
75 Ga0081455_10577896 3300005937 Bacteria 737
76 Ga0081540_1003848 3300005983 Bacteria 11726
77 Ga0081540_1016848 3300005983 Bacteria 4551
78 Ga0081540_1018429 3300005983 Bacteria 4282
79 Ga0081540_1075474 3300005983 Bacteria 1540
80 Ga0081540_1125227 3300005983 Bacteria 1059
81 Ga0075365_10008908 3300006038 Bacteria 5729
82 Ga0075365_10325075 3300006038 Bacteria 1083
83 Ga0075365_10342481 3300006038 Bacteria 1054
84 Ga0075368_10038798 3300006042 Bacteria 1865
85 Ga0075368_10044750 3300006042 Bacteria 1747
86 Ga0075368_10143680 3300006042 Bacteria 995
87 Ga0075363_100007014 3300006048 Bacteria 5151
88 Ga0075363_100052737 3300006048 Bacteria 2171
89 Ga0075363_100095693 3300006048 Bacteria 1639
90 Ga0075363_100108783 3300006048 Bacteria 1539
91 Ga0075364_10417772 3300006051 Bacteria 915
92 Ga0070716_100380114 3300006173 Bacteria 1009
93 Ga0070712_100034259 3300006175 Bacteria 3440
94 Ga0070712_100142349 3300006175 Bacteria 1832
95 Ga0075362_10263267 3300006177 Bacteria 850
96 Ga0075367_10028484 3300006178 Bacteria 3187
97 Ga0075367_10110787 3300006178 Bacteria 1685
98 Ga0075367_10357117 3300006178 Bacteria 922
99 Ga0075369_10004594 3300006186 Bacteria 5120
100 Ga0075370_10066559 3300006353 Bacteria 2055
101 Ga0075370_10375114 3300006353 Bacteria 852
102 Ga0068871_100095558 3300006358 Bacteria 2482
103 Ga0068871_100689705 3300006358 Bacteria 935
104 Ga0068865_100380880 3300006881 Bacteria 1150
105 Ga0097620_100484359 3300006931 Bacteria 1332
106 Ga0099794_10004750 3300007265 Bacteria 5382
107 Ga0099794_10072307 3300007265 Bacteria 1690
108 Ga0099794_10323400 3300007265 Bacteria 800
109 Ga0099795_10012883 3300007788 Bacteria 2549
110 Ga0105240_10008073 3300009093 Bacteria 15126
111 Ga0105240_10014611 3300009093 Bacteria 10714
112 Ga0105240_10234412 3300009093 Bacteria 2131
113 Ga0105240_11503432 3300009093 Bacteria 706
114 Ga0111539_12139854 3300009094 Bacteria 649
115 Ga0105247_10083817 3300009101 Bacteria 2014
116 Ga0105243_10420285 3300009148 Bacteria 1247
117 Ga0105241_10016008 3300009174 Bacteria 5496
118 Ga0105241_11127965 3300009174 Bacteria 740
119 Ga0105241_11225443 3300009174 Bacteria 712
120 Ga0105242_10140185 3300009176 Bacteria 2097
121 Ga0105248_10156041 3300009177 Bacteria 2576
122 Ga0105248_10178264 3300009177 Bacteria 2395
123 Ga0105237_10032961 3300009545 Bacteria 5246
124 Ga0105237_10153004 3300009545 Bacteria 2303
125 Ga0105238_10000514 3300009551 Bacteria 40634
126 Ga0105238_10045534 3300009551 Bacteria 4431
127 Ga0105238_10303332 3300009551 Bacteria 1581
128 Ga0105238_10930919 3300009551 Bacteria 888
129 Ga0105249_10521665 3300009553 Bacteria 1235
130 Ga0105249_10576193 3300009553 Bacteria 1178
131 Ga0099796_10013013 3300010159 Bacteria 2366
132 Ga0099796_10073500 3300010159 Bacteria 1239
133 Ga0105239_10005274 3300010375 Bacteria 15193
134 Ga0105239_10006195 3300010375 Bacteria 13920
135 Ga0105239_10394303 3300010375 Bacteria 1566
136 Ga0105239_10820290 3300010375 Bacteria 1066
137 Ga0105239_10945727 3300010375 Bacteria 990
138 Ga0105246_10178660 3300011119 Bacteria 1632
139 Ga0105246_11534316 3300011119 Bacteria 627
140 Ga0157370_10013258 3300013104 Bacteria 8495
141 Ga0157374_10041407 3300013296 Bacteria 4245
142 Ga0157378_10071596 3300013297 Bacteria 3114
143 Ga0163162_10122697 3300013306 Bacteria 2703
144 Ga0163162_10845397 3300013306 Bacteria 1031
145 Ga0163162_10957718 3300013306 Bacteria 967
146 Ga0163163_10311886 3300014325 Bacteria 1626
147 Ga0163163_10927941 3300014325 Bacteria 934
148 Ga0157379_10628828 3300014968 Bacteria 1004
149 Ga0157379_10659428 3300014968 Bacteria 980
150 Ga0157376_10339133 3300014969 Bacteria 1435
151 Ga0163161_10455056 3300017792 Bacteria 1035
152 Ga0213871_10001561 3300021441 Bacteria 3887
153 Ga0209148_1008347 3300025254 Bacteria 2086
154 Ga0209233_1001048 3300025261 Bacteria 11595
155 Ga0209758_1000720 3300025297 Bacteria 48767
156 Ga0209758_1003178 3300025297 Bacteria 15387
157 Ga0207656_10112274 3300025321 Bacteria 1261
158 Ga0207692_10367961 3300025898 Bacteria 890
159 Ga0207710_10065485 3300025900 Bacteria 1657
160 Ga0207688_10147515 3300025901 Bacteria 1388
161 Ga0207647_10003122 3300025904 Bacteria 12444
162 Ga0207685_10028399 3300025905 Bacteria 1970
163 Ga0207684_10473726 3300025910 Bacteria 1074
164 Ga0207684_10483835 3300025910 Bacteria 1061
165 Ga0207684_10728317 3300025910 Bacteria 841
166 Ga0207654_10003678 3300025911 Bacteria 7731
167 Ga0207654_10865657 3300025911 Bacteria 654
168 Ga0207707_10210361 3300025912 Bacteria 1694
169 Ga0207707_10544528 3300025912 Bacteria 986
170 Ga0207695_10000286 3300025913 Bacteria 125310
171 Ga0207695_10289391 3300025913 Bacteria 1531
172 Ga0207695_10299341 3300025913 Bacteria 1500
173 Ga0207671_10019402 3300025914 Bacteria 5199
174 Ga0207671_10095419 3300025914 Bacteria 2246
175 Ga0207671_10689848 3300025914 Bacteria 812
176 Ga0207693_10057236 3300025915 Bacteria 3056
177 Ga0207663_10113340 3300025916 Bacteria 1844
178 Ga0207663_10652732 3300025916 Bacteria 830
179 Ga0207660_10086833 3300025917 Bacteria 2310
180 Ga0207660_10095691 3300025917 Bacteria 2210
181 Ga0207652_10064850 3300025921 Bacteria 3161
182 Ga0207652_10413580 3300025921 Bacteria 1216
183 Ga0207646_10397175 3300025922 Bacteria 1245
184 Ga0207681_10115055 3300025923 Bacteria 1963
185 Ga0207694_10000120 3300025924 Bacteria 83624
186 Ga0207694_10293445 3300025924 Bacteria 1337
187 Ga0207694_10505561 3300025924 Bacteria 1012
188 Ga0207706_10024109 3300025933 Bacteria 5456
189 Ga0207686_10048649 3300025934 Bacteria 2628
190 Ga0207686_10083003 3300025934 Bacteria 2096
191 Ga0207669_10436607 3300025937 Bacteria 1034
192 Ga0207669_10458451 3300025937 Bacteria 1012
193 Ga0207665_10025582 3300025939 Bacteria 3895
194 Ga0207711_10263526 3300025941 Bacteria 1585
195 Ga0207711_10307608 3300025941 Bacteria 1463
196 Ga0207661_10002592 3300025944 Bacteria 12429
197 Ga0207679_10132662 3300025945 Bacteria 2001
198 Ga0207667_10001834 3300025949 Bacteria 26705
199 Ga0207667_10067769 3300025949 Bacteria 3717
200 Ga0207667_10128470 3300025949 Bacteria 2610
201 Ga0207667_10760045 3300025949 Bacteria 968
202 Ga0207651_10144745 3300025960 Bacteria 1841
203 Ga0207651_10487842 3300025960 Bacteria 1063
204 Ga0207712_10147151 3300025961 Bacteria 1815
205 Ga0207712_10421826 3300025961 Bacteria 1126
206 Ga0207668_10215368 3300025972 Bacteria 1538
207 Ga0207668_10377874 3300025972 Bacteria 1192
208 Ga0207640_10001477 3300025981 Bacteria 12682
209 Ga0207677_11331264 3300026023 Bacteria 660
210 Ga0207639_10035687 3300026041 Bacteria 3680
211 Ga0207639_10841756 3300026041 Bacteria 856
212 Ga0207639_10972987 3300026041 Bacteria 794
213 Ga0207678_10018630 3300026067 Bacteria 6094
214 Ga0207678_10060684 3300026067 Bacteria 3252
215 Ga0207678_10259850 3300026067 Bacteria 1488
216 Ga0207678_10314748 3300026067 Bacteria 1346
217 Ga0207678_10407506 3300026067 Bacteria 1178
218 Ga0207678_10815482 3300026067 Bacteria 824
219 Ga0207708_10792986 3300026075 Bacteria 815
220 Ga0207702_10000019 3300026078 Bacteria 211843
221 Ga0207702_10073735 3300026078 Bacteria 2944
222 Ga0207702_10649803 3300026078 Bacteria 1037
223 Ga0207702_11429762 3300026078 Bacteria 685
224 Ga0207674_10004566 3300026116 Bacteria 16628
225 Ga0207674_10008031 3300026116 Bacteria 12231
226 Ga0207674_10032600 3300026116 Bacteria 5463
227 Ga0207675_100062798 3300026118 Bacteria 3470
228 Ga0207683_10067537 3300026121 Bacteria 3154
229 Ga0207683_10543462 3300026121 Bacteria 1074
230 Ga0207698_10018526 3300026142 Bacteria 4746
231 Ga0207698_10104322 3300026142 Bacteria 2358
232 Ga0209588_1000499 3300027671 Bacteria 10047
233 Ga0209813_10043373 3300027866 Bacteria 1378
234 Ga0268266_10002993 3300028379 Bacteria 17411
235 Ga0268266_10016781 3300028379 Bacteria 6259
236 Ga0268266_10158306 3300028379 Bacteria 2047
237 Ga0268266_10361973 3300028379 Bacteria 1365
238 Ga0268265_10052898 3300028380 Bacteria 3073
239 Ga0268265_10084226 3300028380 Bacteria 2520
240 Ga0268265_10220446 3300028380 Bacteria 1659
241 Ga0268265_10936729 3300028380 Bacteria 852
242 Ga0268264_10394151 3300028381 Bacteria 1329
243 Ga0268264_11428462 3300028381 Bacteria 702
244 Ga0265334_10017005 3300028573 Bacteria 3008
245 Ga0265318_10065474 3300028577 Bacteria 1351
246 Ga0265322_10023262 3300028654 Bacteria 1772
247 Ga0265336_10000921 3300028666 Bacteria 14920
248 Ga0307517_10000744 3300028786 Bacteria 56253
249 Ga0307517_10266311 3300028786 Bacteria 990
250 Ga0307515_10088090 3300028794 Bacteria 3929
251 Ga0307515_10447223 3300028794 Bacteria 908
252 Ga0307515_10464263 3300028794 Bacteria 880
253 Ga0265338_10000085 3300028800 Bacteria 175080
254 Ga0265330_10006427 3300031235 Bacteria 5809
255 Ga0265332_10100342 3300031238 Bacteria 1221
256 Ga0265339_10011293 3300031249 Bacteria 5508
257 Ga0307513_10356443 3300031456 Bacteria 1209
258 Ga0307509_10412725 3300031507 Bacteria 1053
259 Ga0307508_10168356 3300031616 Bacteria 1795
260 Ga0307508_10275919 3300031616 Bacteria 1275
261 Ga0265314_10247283 3300031711 Bacteria 1026
262 Ga0265342_10017850 3300031712 Bacteria 4606
263 Ga0307516_10092011 3300031730 Bacteria 2860
264 Ga0307516_10267339 3300031730 Bacteria 1398
265 Ga0307406_11029870 3300031901 Bacteria 708
266 Ga0307406_11173857 3300031901 Bacteria 666
267 Ga0307412_10165123 3300031911 Bacteria 1650
268 Ga0307412_10281574 3300031911 Bacteria 1306
269 Ga0307416_100333731 3300032002 Bacteria 1525
270 Ga0307411_10281147 3300032005 Bacteria 1325
271 Ga0307411_10856520 3300032005 Bacteria 804
272 Ga0307510_10047808 3300033180 Bacteria 4576
273 Ga0307510_10052296 3300033180 Bacteria 4308
274 Ga0373930_0005188 3300034816 Bacteria 2155
275 Ga0373951_0074903 3300035091 Bacteria 868
276 Ga0373923_0002765 3300035111 Bacteria 5481
277 Ga0373923_0220274 3300035111 Bacteria 882
278 Ga0373932_0017902 3300035112 Bacteria 1826
279 Ga0373936_0011613 3300035113 Bacteria 3340
280 Ga0373953_0099398 3300035117 Bacteria 1223
281 Ga0373954_0007936 3300035118 Bacteria 4650
282 Ga0373957_0067375 3300035120 Bacteria 1395
283 Ga0373943_0016035 3300035170 Bacteria 3412
284 Ga0373946_0117587 3300035171 Bacteria 1210
285 Ga0373924_0003083 3300035410 Bacteria 5689
286 Ga0373931_0001492 3300035691 Bacteria 10065
287 Ga0373931_0310029 3300035691 Bacteria 977
288 Ga0373935_0093997 3300035692 Bacteria 1967
289 Ga0373935_0149010 3300035692 Bacteria 1586
290 Ga0373935_0661076 3300035692 Bacteria 767
291 Ga0373935_0850921 3300035692 Bacteria 674
292 Ga0373927_0014122 3300035695 Bacteria 5296
293 Ga0373927_0034276 3300035695 Bacteria 3303
294 Ga0373927_0096359 3300035695 Bacteria 1923
295 Ga0373933_0007801 3300035724 Bacteria 5847
296 Ga0373933_0119101 3300035724 Bacteria 1652
297 Ga0373933_0187132 3300035724 Bacteria 1322
298 Ga0373947_0010871 3300035725 Bacteria 5224
299 Ga0373947_0047088 3300035725 Bacteria 2583
300 Ga0373947_0052004 3300035725 Bacteria 2467
301 Ga0373947_0773997 3300035725 Bacteria 655
302 Ga0373937_0496579 3300036401 Bacteria 1159
303 Ga0373937_0500121 3300036401 Bacteria 1155
304 Ga0372808_002808 3300036459 Bacteria 2060
305 Ga0373925_0029763 3300037068 Bacteria 4006
306 Ga0395899_0378074 3300037312 Bacteria 942
307 Ga0395900_0114406 3300037418 Bacteria 2769
308 Ga0436364_0469187 3300037853 Bacteria 1532
309 Ga0436364_1441693 3300037853 Bacteria 978
310 Ga0436365_0480480 3300039437 Bacteria 2412
311 Ga0436360_1339136 3300039438 Bacteria 710
312 Ga0439461_0024741 3300041410 Bacteria 1216
313 Ga0451791_1051241 3300041451 Bacteria 1248
314 Ga0451797_1258096 3300041453 Bacteria 727
315 Ga0451800_1024136 3300041459 Bacteria 1144
316 Ga0451837_0903081 3300041494 Bacteria 1169
317 Ga0451841_1138233 3300041498 Bacteria 874
318 Ga0439454_055185 3300042011 Bacteria 679
319 Ga0466969_0188036 3300044656 Bacteria 944
320 Ga0466966_0186978 3300044684 Bacteria 1256
321 Ga0466968_0159861 3300044735 Bacteria 1039
322 Ga0495617_111906 3300046452 Bacteria 883
323 Ga0495592_0012012 3300046454 Bacteria 6562
324 Ga0495603_0013820 3300046455 Bacteria 4886
325 Ga0495603_0014368 3300046455 Bacteria 4788
326 Ga0495603_0166277 3300046455 Bacteria 1278
327 Ga0495629_0000439 3300046459 Bacteria 34692
328 Ga0495638_0369198 3300046460 Bacteria 753
329 Ga0495638_0454351 3300046460 Bacteria 653
330 Ga0495651_0104547 3300046462 Bacteria 2102
331 Ga0495653_0307115 3300046463 Bacteria 1033
332 Ga0495650_0056397 3300046471 Bacteria 1594
333 Ga0495580_0183954 3300046472 Bacteria 1442
334 Ga0495580_0364283 3300046472 Bacteria 978
335 Ga0495605_0183686 3300046474 Bacteria 918
336 Ga0495664_0367259 3300046477 Bacteria 866
337 Ga0495585_0191958 3300046492 Bacteria 1044
338 Ga0495594_0073850 3300046499 Bacteria 1899
339 Ga0495594_0165051 3300046499 Bacteria 1259
340 Ga0495607_0044925 3300046501 Bacteria 2601
341 Ga0495583_0042017 3300046506 Bacteria 2138
342 Ga0495606_0107739 3300046507 Bacteria 1685
343 Ga0495616_0138796 3300046513 Bacteria 1108
344 Ga0495616_0313227 3300046513 Bacteria 660
345 Ga0495620_0055725 3300046515 Bacteria 1665
346 Ga0495628_0052614 3300046516 Bacteria 3216
347 Ga0495630_0968582 3300046517 Bacteria 647
348 Ga0495631_0077122 3300046518 Bacteria 1438
349 Ga0495631_0132626 3300046518 Bacteria 1070
350 Ga0495632_0026476 3300046519 Bacteria 3052
351 Ga0495632_0073222 3300046519 Bacteria 1643
352 Ga0495637_0047996 3300046520 Bacteria 1800
353 Ga0495643_0074376 3300046522 Bacteria 1779
354 Ga0495643_0123475 3300046522 Bacteria 1306
355 Ga0495644_0030214 3300046523 Bacteria 2046
356 Ga0495642_0122385 3300046528 Bacteria 1117
357 Ga0495642_0145565 3300046528 Bacteria 1024
358 Ga0495652_0143257 3300046529 Bacteria 1877
359 Ga0495652_0409701 3300046529 Bacteria 958
360 Ga0495640_0015529 3300046533 Bacteria 5727
361 Ga0495621_0059468 3300046539 Bacteria 1384
362 Ga0495621_0121032 3300046539 Bacteria 1011
363 Ga0495597_0066400 3300046542 Bacteria 1563
364 Ga0495645_0007838 3300046543 Bacteria 7432
365 Ga0495622_0250351 3300046557 Bacteria 779
366 Ga0495633_0140729 3300046558 Bacteria 1115
367 Ga0495633_0178374 3300046558 Bacteria 978
368 Ga0495667_0003416 3300046559 Bacteria 10642
369 Ga0495656_0053225 3300046615 Bacteria 1739
370 Ga0495668_0029805 3300046616 Bacteria 3083
371 Ga0495668_0132909 3300046616 Bacteria 1362
372 Ga0495668_0395050 3300046616 Bacteria 760
373 Ga0495634_0019547 3300046642 Bacteria 4812
374 Ga0495611_0086703 3300046648 Bacteria 1444
375 Ga0495625_0094620 3300046660 Bacteria 2061
376 Ga0495625_0122459 3300046660 Bacteria 1768
377 Ga0495625_0136112 3300046660 Bacteria 1660
378 Ga0495625_0313788 3300046660 Bacteria 1000
379 Ga0495625_0443907 3300046660 Bacteria 803
380 Ga0495625_0474756 3300046660 Bacteria 769
381 Ga0495635_0009930 3300046663 Bacteria 6653
382 Ga0495635_0121454 3300046663 Bacteria 1782
383 Ga0495635_0626616 3300046663 Bacteria 701
384 Ga0495659_0058301 3300046664 Bacteria 1420
385 Ga0495661_0065666 3300046665 Bacteria 2137
386 Ga0495588_0119446 3300046674 Bacteria 1389
387 Ga0495588_0301408 3300046674 Bacteria 844
388 Ga0495657_0018194 3300046675 Bacteria 5090
389 Ga0495599_0001369 3300046678 Bacteria 13928
390 Ga0495623_0212221 3300046679 Bacteria 1107
391 Ga0495623_0265808 3300046679 Bacteria 959
392 Ga0495669_0044352 3300046684 Bacteria 1981
393 Ga0495613_0022008 3300046689 Bacteria 4753
394 Ga0495613_0062110 3300046689 Bacteria 2735
395 Ga0495613_0513360 3300046689 Bacteria 806
396 Ga0495670_0003464 3300046691 Bacteria 7752
397 Ga0495670_0053833 3300046691 Bacteria 2015
398 Ga0495589_0079301 3300046794 Bacteria 1598
399 Ga0495600_0001020 3300046809 Bacteria 15122
400 Ga0495660_0069300 3300046810 Bacteria 1875
401 Ga0495581_0044899 3300047315 Bacteria 2555
402 Ga0495581_0443307 3300047315 Bacteria 756
403 Ga0495581_0561360 3300047315 Bacteria 662
404 Ga0495581_0565659 3300047315 Bacteria 659
405 Ga0495604_0151712 3300047317 Bacteria 1646
406 Ga0495636_0083668 3300047318 Bacteria 1377
407 Ga0495674_0110158 3300047319 Bacteria 2335
408 Ga0495674_0122742 3300047319 Bacteria 2194
409 Ga0495674_0438884 3300047319 Bacteria 1050
410 Ga0495674_0593866 3300047319 Bacteria 878
411 Ga0495672_0153312 3300047320 Bacteria 1193
412 Ga0495680_0013039 3300047322 Bacteria 7270
413 Ga0495680_0770185 3300047322 Bacteria 631
414 Ga0495675_0088933 3300047444 Bacteria 1939
415 Ga0495685_144544 3300047447 Bacteria 774
416 Ga0495673_0044453 3300047469 Bacteria 1981
417 Ga0495681_0056700 3300047470 Bacteria 1822
418 Ga0495681_0203062 3300047470 Bacteria 803
419 Ga0495684_0007607 3300047471 Bacteria 8383
420 Ga0495686_0090470 3300047472 Bacteria 1858
421 Ga0495686_0141879 3300047472 Bacteria 1417
422 Ga0495593_0000687 3300047673 Bacteria 19500
423 Ga0495602_0385075 3300048088 Bacteria 1004
424 Ga0495626_0045559 3300048091 Bacteria 2047
425 Ga0496100_0131728 3300048903 Bacteria 1762
426 Ga0496100_0147903 3300048903 Bacteria 1672
427 Ga0496102_0052436 3300048905 Bacteria 3717
428 Ga0496103_0060637 3300048906 Bacteria 2351
429 Ga0496104_0019459 3300048907 Bacteria 6212
430 Ga0496104_0340191 3300048907 Bacteria 1413
431 Ga0496104_1309344 3300048907 Bacteria 628
432 Ga0496105_0031850 3300048908 Bacteria 4324
433 Ga0496106_0005785 3300048909 Bacteria 9143
434 Ga0496106_0284741 3300048909 Bacteria 1324
435 Ga0496106_0498006 3300048909 Bacteria 979
436 Ga0496107_0028023 3300048910 Bacteria 4002
437 Ga0496108_0066535 3300048911 Bacteria 3039
438 Ga0496108_0089034 3300048911 Bacteria 2623
439 Ga0496108_0871392 3300048911 Bacteria 774
440 Ga0496109_0030152 3300048912 Bacteria 4862
441 Ga0496110_0431215 3300048913 Bacteria 1201
442 Ga0496110_0522782 3300048913 Bacteria 1079
443 Ga0496110_0653545 3300048913 Bacteria 951
444 Ga0496113_0005714 3300048916 Bacteria 7791
445 Ga0496114_0008753 3300048917 Bacteria 8017
446 Ga0496115_0278856 3300048918 Bacteria 1372
447 Ga0496116_0006870 3300048919 Bacteria 10220
448 Ga0496118_0036120 3300048921 Bacteria 4001
449 Ga0496118_0053343 3300048921 Bacteria 3075
450 Ga0496119_0048811 3300048922 Bacteria 2622
451 Ga0496120_0026065 3300048923 Bacteria 3618
452 Ga0496120_0184307 3300048923 Bacteria 1022
453 Ga0496121_0008678 3300048924 Bacteria 11871
454 Ga0496121_0094717 3300048924 Bacteria 2322
455 Ga0496121_0105954 3300048924 Bacteria 2156
456 Ga0496121_0323945 3300048924 Bacteria 1036
457 Ga0496122_0045713 3300048925 Bacteria 3399
458 Ga0496122_0171959 3300048925 Bacteria 1304
459 Ga0496122_0250006 3300048925 Bacteria 992
460 Ga0496123_0032387 3300048926 Bacteria 3786
461 Ga0496123_0040443 3300048926 Bacteria 3246
462 Ga0496123_0213662 3300048926 Bacteria 978
463 Ga0496124_0036240 3300048927 Bacteria 4305
464 Ga0496124_0131156 3300048927 Bacteria 1991
465 Ga0496124_0196768 3300048927 Bacteria 1537
466 Ga0496125_0005864 3300048928 Bacteria 13489
467 Ga0496125_0022614 3300048928 Bacteria 5832
468 Ga0496125_0057850 3300048928 Bacteria 3136
469 Ga0496125_0145474 3300048928 Bacteria 1639
470 Ga0496126_0029128 3300048929 Bacteria 5248
471 Ga0496126_0138554 3300048929 Bacteria 2096
472 Ga0496126_0159847 3300048929 Bacteria 1926
473 Ga0495678_184019 3300049459 Bacteria 653
474 Ga0495682_0074146 3300049460 Bacteria 1224
475 Ga0501048_0140175 3300049582 Bacteria 1710
476 Ga0501072_0422520 3300049588 Bacteria 1056
477 Ga0501080_0642727 3300049742 Bacteria 939
478 Ga0501035_0848037 3300049822 Bacteria 727
479 nmdc:mga03683_46429_c2 3300050489 Bacteria 1498
480 nmdc:mga03n38_134762_c1 3300050490 Bacteria 1228
481 nmdc:mga03n38_274300_c1 3300050490 Bacteria 898
482 nmdc:mga03n38_52067_c1 3300050490 Bacteria 1831
483 nmdc:mga03n38_65711_c1 3300050490 Bacteria 1664
484 nmdc:mga00v17_338640_c1 3300050491 Bacteria 978
485 nmdc:mga0yw44_141626_c1 3300050492 Bacteria 1563
486 nmdc:mga0yw44_26547_c1 3300050492 Bacteria 3309
487 nmdc:mga0yw44_296464_c1 3300050492 Bacteria 1083
488 nmdc:mga06z11_31376_c1 3300050494 Bacteria 2581
489 nmdc:mga06z11_5795_c1 3300050494 Bacteria 4982
490 nmdc:mga06z11_94615_c1 3300050494 Bacteria 1628
491 nmdc:mga04h51_3413_c1 3300050495 Bacteria 3861
492 nmdc:mga04h51_70181_c1 3300050495 Bacteria 1221
493 nmdc:mga04h51_97161_c1 3300050495 Bacteria 1068
494 nmdc:mga0sz30_39467_c2 3300050516 Bacteria 1660
495 Ga0495601_0036758 3300053077 Bacteria 3060
496 Ga0495601_0087862 3300053077 Bacteria 1999
497 Ga0495601_0192270 3300053077 Bacteria 1334
498 Ga0495601_0330130 3300053077 Bacteria 993
499 Ga0495612_0091125 3300053078 Bacteria 1291
500 Ga0495655_0002763 3300053083 Bacteria 2823
501 Ga0495655_0066832 3300053083 Bacteria 995
502 Ga0495595_0004450 3300053084 Bacteria 5640
503 Ga0495595_0130280 3300053084 Bacteria 1229
504 Ga0495619_0001280 3300053085 Bacteria 16510
505 Ga0495619_0012374 3300053085 Bacteria 5372
506 Ga0495619_0123675 3300053085 Bacteria 1775
507 Ga0495619_0237595 3300053085 Bacteria 1263
508 Ga0500578_0510293 3300053086 Bacteria 675
509 Ga0500581_089178 3300053089 Bacteria 1530
510 Ga0500581_123978 3300053089 Bacteria 1244
511 Ga0500646_0187726 3300053090 Bacteria 703
512 Ga0500583_0124093 3300053092 Bacteria 1279
513 Ga0500651_0037433 3300053093 Bacteria 3058
514 Ga0500566_0000647 3300053094 Bacteria 19487
515 Ga0500566_0039634 3300053094 Bacteria 2723
516 Ga0500566_0322347 3300053094 Bacteria 719
517 Ga0500641_0041178 3300053096 Bacteria 1868
518 Ga0500554_024041 3300053102 Bacteria 1721
519 Ga0500554_029602 3300053102 Bacteria 1602
520 Ga0500556_0000003 3300053104 Bacteria 679379
521 Ga0500562_019073 3300053108 Bacteria 1772
522 Ga0500569_007057 3300053109 Bacteria 2501
523 Ga0500592_012206 3300053116 Bacteria 1373
524 Ga0500595_001395 3300053119 Bacteria 12953
525 Ga0500595_009512 3300053119 Bacteria 3919
526 Ga0500595_022906 3300053119 Bacteria 2201
527 Ga0500618_006530 3300053125 Bacteria 3412
528 Ga0500642_0000104 3300053130 Bacteria 40747
529 Ga0500652_000138 3300053131 Bacteria 27584
530 Ga0500559_0000117 3300053136 Bacteria 62940
531 Ga0500559_0328992 3300053136 Bacteria 716
532 Ga0500568_0000838 3300053139 Bacteria 21617
533 Ga0500568_0056276 3300053139 Bacteria 1533
534 Ga0500577_0154229 3300053142 Bacteria 975
535 Ga0500577_0286280 3300053142 Bacteria 718
536 Ga0500586_000325 3300053145 Bacteria 9490
537 Ga0500589_114328 3300053147 Bacteria 1153
538 Ga0500590_089034 3300053148 Bacteria 1502
539 Ga0500603_021589 3300053150 Bacteria 1585
540 Ga0500604_0002239 3300053151 Bacteria 5295
541 Ga0500616_0000033 3300053153 Bacteria 398830
542 Ga0500622_0001002 3300053156 Bacteria 23819
543 Ga0500627_0250702 3300053158 Bacteria 783
544 Ga0500633_0166577 3300053160 Bacteria 827
545 Ga0500634_0023749 3300053161 Bacteria 3334
546 Ga0500634_0088259 3300053161 Bacteria 1581
547 Ga0500638_003647 3300053162 Bacteria 5752
548 Ga0500636_0003823 3300053177 Bacteria 8511
549 Ga0500636_0014131 3300053177 Bacteria 4692
550 Ga0500637_0000262 3300053178 Bacteria 19711
551 Ga0500637_0142123 3300053178 Bacteria 1389
552 Ga0500611_163689 3300053727 Bacteria 616
553 Ga0500645_055454 3300053730 Bacteria 1151
554 Ga0500609_006359 3300053731 Bacteria 1610
555 Ga0500601_028101 3300053737 Bacteria 662
556 Ga0500661_001756 3300055283 Bacteria 4085
557 Ga0501082_0192295 3300060353 Bacteria 1775
558 2513693049 2513237101 Bacteria 7952346
559 2603860397 2602042107 Bacteria 6226103
560 2793080691
561 2857525344 2857524615 Bacteria 6615449
562 2874611797 2874604998 Bacteria 7834745
563 2889037634 2889033259 Bacteria 9099371
564 2893066290 2893066018 Bacteria 6158120
565 2919074965 2919073203 Bacteria 6531949
566 2922361593 2922361189 Bacteria 7436256
567 2922387181 2922386360 Bacteria 7017218
568 8006972353 8006964411 Bacteria 8966052
569 8006999750 8006994254 Bacteria 8309700
570 Ga0105240_10032506
571 JGI24740J21852_10001727
572 JGI24739J22299_10018516
573 JGI24737J22298_10001974
574 JGI24735J21928_10075810
575 JGI25153J46596_10004213
576 JGI25404J52841_10022335
577 Ga0055526_1031799
578 Ga0065165_1086739
579 Ga0070690_100073701
580 Ga0070677_10306555
581 Ga0068869_100109397
582 Ga0070680_100027552
583 Ga0070680_100282108
584 Ga0070660_100353840
585 Ga0070691_10541419
586 Ga0070661_101232598
587 Ga0070668_100473459
588 Ga0070669_100099354
589 Ga0070673_100472240
590 Ga0070688_100365806
591 Ga0070714_100428433
592 Ga0070710_10120684
593 Ga0070711_100348154
594 Ga0070711_100417289
595 Ga0070708_100482175
596 Ga0070663_100007429
597 Ga0070663_100104901
598 Ga0070678_100269321
599 Ga0070678_100377484
600 Ga0070678_101038603
601 Ga0070681_10093558
602 Ga0070681_10592548
603 Ga0070685_10443765
604 Ga0070706_100143695
605 Ga0070706_100257901
606 Ga0070706_100715066
607 Ga0070707_100037942
608 Ga0070707_100403804
609 Ga0070698_100321222
610 Ga0070679_100608670
611 Ga0070684_100032347
612 Ga0070697_100209623
613 Ga0068853_100011055
614 Ga0068853_100494121
615 Ga0068853_100590088
616 Ga0070696_100202200
617 Ga0070665_100031480
618 Ga0070665_100210330
619 Ga0070665_100243303
620 Ga0068855_100010142
621 Ga0068855_100012537
622 Ga0068855_100012743
623 Ga0068855_100119566
624 Ga0070664_100164016
625 Ga0068857_100007716
626 Ga0068857_100029003
627 Ga0068854_100002531
628 Ga0068854_101071011
629 Ga0068856_100003444
630 Ga0068856_100037113
631 Ga0068852_100160030
632 Ga0068852_101378251
633 Ga0068859_100484363
634 Ga0068851_10001156
635 Ga0068851_10287587
636 Ga0068863_100222523
637 Ga0068858_100122129
638 Ga0068860_101229216
639 Ga0068862_100216819
640 Ga0068862_100237874
641 Ga0068862_100476810
642 Ga0081455_10011564
643 Ga0081455_10015842
644 Ga0081455_10577896
645 Ga0081540_1003848
646 Ga0081540_1016848
647 Ga0081540_1018429
648 Ga0081540_1075474
649 Ga0081540_1125227
650 Ga0075365_10008908
651 Ga0075365_10325075
652 Ga0075365_10342481
653 Ga0075368_10038798
654 Ga0075368_10044750
655 Ga0075368_10143680
656 Ga0075363_100007014
657 Ga0075363_100052737
658 Ga0075363_100095693
659 Ga0075363_100108783
660 Ga0075364_10417772
661 Ga0070716_100380114
662 Ga0070712_100034259
663 Ga0070712_100142349
664 Ga0075362_10263267
665 Ga0075367_10028484
666 Ga0075367_10110787
667 Ga0075367_10357117
668 Ga0075369_10004594
669 Ga0075370_10066559
670 Ga0075370_10375114
671 Ga0068871_100095558
672 Ga0068871_100689705
673 Ga0068865_100380880
674 Ga0097620_100484359
675 Ga0099794_10004750
676 Ga0099794_10072307
677 Ga0099794_10323400
678 Ga0099795_10012883
679 Ga0105240_10008073
680 Ga0105240_10014611
681 Ga0105240_10234412
682 Ga0105240_11503432
683 Ga0111539_12139854
684 Ga0105247_10083817
685 Ga0105243_10420285
686 Ga0105241_10016008
687 Ga0105241_11127965
688 Ga0105241_11225443
689 Ga0105242_10140185
690 Ga0105248_10156041
691 Ga0105248_10178264
692 Ga0105237_10032961
693 Ga0105237_10153004
694 Ga0105238_10000514
695 Ga0105238_10045534
696 Ga0105238_10303332
697 Ga0105238_10930919
698 Ga0105249_10521665
699 Ga0105249_10576193
700 Ga0099796_10013013
701 Ga0099796_10073500
702 Ga0105239_10005274
703 Ga0105239_10006195
704 Ga0105239_10394303
705 Ga0105239_10820290
706 Ga0105239_10945727
707 Ga0105246_10178660
708 Ga0105246_11534316
709 Ga0157370_10013258
710 Ga0157374_10041407
711 Ga0157378_10071596
712 Ga0163162_10122697
713 Ga0163162_10845397
714 Ga0163162_10957718
715 Ga0163163_10311886
716 Ga0163163_10927941
717 Ga0157379_10628828
718 Ga0157379_10659428
719 Ga0157376_10339133
720 Ga0163161_10455056
721 Ga0213871_10001561
722 Ga0209148_1008347
723 Ga0209233_1001048
724 Ga0209758_1000720
725 Ga0209758_1003178
726 Ga0207656_10112274
727 Ga0207692_10367961
728 Ga0207710_10065485
729 Ga0207688_10147515
730 Ga0207647_10003122
731 Ga0207685_10028399
732 Ga0207684_10473726
733 Ga0207684_10483835
734 Ga0207684_10728317
735 Ga0207654_10003678
736 Ga0207654_10865657
737 Ga0207707_10210361
738 Ga0207707_10544528
739 Ga0207695_10000286
740 Ga0207695_10289391
741 Ga0207695_10299341
742 Ga0207671_10019402
743 Ga0207671_10095419
744 Ga0207671_10689848
745 Ga0207693_10057236
746 Ga0207663_10113340
747 Ga0207663_10652732
748 Ga0207660_10086833
749 Ga0207660_10095691
750 Ga0207652_10064850
751 Ga0207652_10413580
752 Ga0207646_10397175
753 Ga0207681_10115055
754 Ga0207694_10000120
755 Ga0207694_10293445
756 Ga0207694_10505561
757 Ga0207706_10024109
758 Ga0207686_10048649
759 Ga0207686_10083003
760 Ga0207669_10436607
761 Ga0207669_10458451
762 Ga0207665_10025582
763 Ga0207711_10263526
764 Ga0207711_10307608
765 Ga0207661_10002592
766 Ga0207679_10132662
767 Ga0207667_10001834
768 Ga0207667_10067769
769 Ga0207667_10128470
770 Ga0207667_10760045
771 Ga0207651_10144745
772 Ga0207651_10487842
773 Ga0207712_10147151
774 Ga0207712_10421826
775 Ga0207668_10215368
776 Ga0207668_10377874
777 Ga0207640_10001477
778 Ga0207677_11331264
779 Ga0207639_10035687
780 Ga0207639_10841756
781 Ga0207639_10972987
782 Ga0207678_10018630
783 Ga0207678_10060684
784 Ga0207678_10259850
785 Ga0207678_10314748
786 Ga0207678_10407506
787 Ga0207678_10815482
788 Ga0207708_10792986
789 Ga0207702_10000019
790 Ga0207702_10073735
791 Ga0207702_10649803
792 Ga0207702_11429762
793 Ga0207674_10004566
794 Ga0207674_10008031
795 Ga0207674_10032600
796 Ga0207675_100062798
797 Ga0207683_10067537
798 Ga0207683_10543462
799 Ga0207698_10018526
800 Ga0207698_10104322
801 Ga0209588_1000499
802 Ga0209813_10043373
803 Ga0268266_10002993
804 Ga0268266_10016781
805 Ga0268266_10158306
806 Ga0268266_10361973
807 Ga0268265_10052898
808 Ga0268265_10084226
809 Ga0268265_10220446
810 Ga0268265_10936729
811 Ga0268264_10394151
812 Ga0268264_11428462
813 Ga0265334_10017005
814 Ga0265318_10065474
815 Ga0265322_10023262
816 Ga0265336_10000921
817 Ga0307517_10000744
818 Ga0307517_10266311
819 Ga0307515_10088090
820 Ga0307515_10447223
821 Ga0307515_10464263
822 Ga0265338_10000085
823 Ga0265330_10006427
824 Ga0265332_10100342
825 Ga0265339_10011293
826 Ga0307513_10356443
827 Ga0307509_10412725
828 Ga0307508_10168356
829 Ga0307508_10275919
830 Ga0265314_10247283
831 Ga0265342_10017850
832 Ga0307516_10092011
833 Ga0307516_10267339
834 Ga0307406_11029870
835 Ga0307406_11173857
836 Ga0307412_10165123
837 Ga0307412_10281574
838 Ga0307416_100333731
839 Ga0307411_10281147
840 Ga0307411_10856520
841 Ga0307510_10047808
842 Ga0307510_10052296
843 Ga0373930_0005188
844 Ga0373951_0074903
845 Ga0373923_0002765
846 Ga0373923_0220274
847 Ga0373932_0017902
848 Ga0373936_0011613
849 Ga0373953_0099398
850 Ga0373954_0007936
851 Ga0373957_0067375
852 Ga0373943_0016035
853 Ga0373946_0117587
854 Ga0373924_0003083
855 Ga0373931_0001492
856 Ga0373931_0310029
857 Ga0373935_0093997
858 Ga0373935_0149010
859 Ga0373935_0661076
860 Ga0373935_0850921
861 Ga0373927_0014122
862 Ga0373927_0034276
863 Ga0373927_0096359
864 Ga0373933_0007801
865 Ga0373933_0119101
866 Ga0373933_0187132
867 Ga0373947_0010871
868 Ga0373947_0047088
869 Ga0373947_0052004
870 Ga0373947_0773997
871 Ga0373937_0496579
872 Ga0373937_0500121
873 Ga0372808_002808
874 Ga0373925_0029763
875 Ga0395899_0378074
876 Ga0395900_0114406
877 Ga0436364_0469187
878 Ga0436364_1441693
879 Ga0436365_0480480
880 Ga0436360_1339136
881 Ga0439461_0024741
882 Ga0451791_1051241
883 Ga0451797_1258096
884 Ga0451800_1024136
885 Ga0451837_0903081
886 Ga0451841_1138233
887 Ga0439454_055185
888 Ga0466969_0188036
889 Ga0466966_0186978
890 Ga0466968_0159861
891 Ga0495617_111906
892 Ga0495592_0012012
893 Ga0495603_0013820
894 Ga0495603_0014368
895 Ga0495603_0166277
896 Ga0495629_0000439
897 Ga0495638_0369198
898 Ga0495638_0454351
899 Ga0495651_0104547
900 Ga0495653_0307115
901 Ga0495650_0056397
902 Ga0495580_0183954
903 Ga0495580_0364283
904 Ga0495605_0183686
905 Ga0495664_0367259
906 Ga0495585_0191958
907 Ga0495594_0073850
908 Ga0495594_0165051
909 Ga0495607_0044925
910 Ga0495583_0042017
911 Ga0495606_0107739
912 Ga0495616_0138796
913 Ga0495616_0313227
914 Ga0495620_0055725
915 Ga0495628_0052614
916 Ga0495630_0968582
917 Ga0495631_0077122
918 Ga0495631_0132626
919 Ga0495632_0026476
920 Ga0495632_0073222
921 Ga0495637_0047996
922 Ga0495643_0074376
923 Ga0495643_0123475
924 Ga0495644_0030214
925 Ga0495642_0122385
926 Ga0495642_0145565
927 Ga0495652_0143257
928 Ga0495652_0409701
929 Ga0495640_0015529
930 Ga0495621_0059468
931 Ga0495621_0121032
932 Ga0495597_0066400
933 Ga0495645_0007838
934 Ga0495622_0250351
935 Ga0495633_0140729
936 Ga0495633_0178374
937 Ga0495667_0003416
938 Ga0495656_0053225
939 Ga0495668_0029805
940 Ga0495668_0132909
941 Ga0495668_0395050
942 Ga0495634_0019547
943 Ga0495611_0086703
944 Ga0495625_0094620
945 Ga0495625_0122459
946 Ga0495625_0136112
947 Ga0495625_0313788
948 Ga0495625_0443907
949 Ga0495625_0474756
950 Ga0495635_0009930
951 Ga0495635_0121454
952 Ga0495635_0626616
953 Ga0495659_0058301
954 Ga0495661_0065666
955 Ga0495588_0119446
956 Ga0495588_0301408
957 Ga0495657_0018194
958 Ga0495599_0001369
959 Ga0495623_0212221
960 Ga0495623_0265808
961 Ga0495669_0044352
962 Ga0495613_0022008
963 Ga0495613_0062110
964 Ga0495613_0513360
965 Ga0495670_0003464
966 Ga0495670_0053833
967 Ga0495589_0079301
968 Ga0495600_0001020
969 Ga0495660_0069300
970 Ga0495581_0044899
971 Ga0495581_0443307
972 Ga0495581_0561360
973 Ga0495581_0565659
974 Ga0495604_0151712
975 Ga0495636_0083668
976 Ga0495674_0110158
977 Ga0495674_0122742
978 Ga0495674_0438884
979 Ga0495674_0593866
980 Ga0495672_0153312
981 Ga0495680_0013039
982 Ga0495680_0770185
983 Ga0495675_0088933
984 Ga0495685_144544
985 Ga0495673_0044453
986 Ga0495681_0056700
987 Ga0495681_0203062
988 Ga0495684_0007607
989 Ga0495686_0090470
990 Ga0495686_0141879
991 Ga0495593_0000687
992 Ga0495602_0385075
993 Ga0495626_0045559
994 Ga0496100_0131728
995 Ga0496100_0147903
996 Ga0496102_0052436
997 Ga0496103_0060637
998 Ga0496104_0019459
999 Ga0496104_0340191
1000 Ga0496104_1309344
1001 Ga0496105_0031850
1002 Ga0496106_0005785
1003 Ga0496106_0284741
1004 Ga0496106_0498006
1005 Ga0496107_0028023
1006 Ga0496108_0066535
1007 Ga0496108_0089034
1008 Ga0496108_0871392
1009 Ga0496109_0030152
1010 Ga0496110_0431215
1011 Ga0496110_0522782
1012 Ga0496110_0653545
1013 Ga0496113_0005714
1014 Ga0496114_0008753
1015 Ga0496115_0278856
1016 Ga0496116_0006870
1017 Ga0496118_0036120
1018 Ga0496118_0053343
1019 Ga0496119_0048811
1020 Ga0496120_0026065
1021 Ga0496120_0184307
1022 Ga0496121_0008678
1023 Ga0496121_0094717
1024 Ga0496121_0105954
1025 Ga0496121_0323945
1026 Ga0496122_0045713
1027 Ga0496122_0171959
1028 Ga0496122_0250006
1029 Ga0496123_0032387
1030 Ga0496123_0040443
1031 Ga0496123_0213662
1032 Ga0496124_0036240
1033 Ga0496124_0131156
1034 Ga0496124_0196768
1035 Ga0496125_0005864
1036 Ga0496125_0022614
1037 Ga0496125_0057850
1038 Ga0496125_0145474
1039 Ga0496126_0029128
1040 Ga0496126_0138554
1041 Ga0496126_0159847
1042 Ga0495678_184019
1043 Ga0495682_0074146
1044 Ga0501048_0140175
1045 Ga0501072_0422520
1046 Ga0501080_0642727
1047 Ga0501035_0848037
1048 nmdc:mga03683_46429_c2
1049 nmdc:mga03n38_134762_c1
1050 nmdc:mga03n38_274300_c1
1051 nmdc:mga03n38_52067_c1
1052 nmdc:mga03n38_65711_c1
1053 nmdc:mga00v17_338640_c1
1054 nmdc:mga0yw44_141626_c1
1055 nmdc:mga0yw44_26547_c1
1056 nmdc:mga0yw44_296464_c1
1057 nmdc:mga06z11_31376_c1
1058 nmdc:mga06z11_5795_c1
1059 nmdc:mga06z11_94615_c1
1060 nmdc:mga04h51_3413_c1
1061 nmdc:mga04h51_70181_c1
1062 nmdc:mga04h51_97161_c1
1063 nmdc:mga0sz30_39467_c2
1064 Ga0495601_0036758
1065 Ga0495601_0087862
1066 Ga0495601_0192270
1067 Ga0495601_0330130
1068 Ga0495612_0091125
1069 Ga0495655_0002763
1070 Ga0495655_0066832
1071 Ga0495595_0004450
1072 Ga0495595_0130280
1073 Ga0495619_0001280
1074 Ga0495619_0012374
1075 Ga0495619_0123675
1076 Ga0495619_0237595
1077 Ga0500578_0510293
1078 Ga0500581_089178
1079 Ga0500581_123978
1080 Ga0500646_0187726
1081 Ga0500583_0124093
1082 Ga0500651_0037433
1083 Ga0500566_0000647
1084 Ga0500566_0039634
1085 Ga0500566_0322347
1086 Ga0500641_0041178
1087 Ga0500554_024041
1088 Ga0500554_029602
1089 Ga0500556_0000003
1090 Ga0500562_019073
1091 Ga0500569_007057
1092 Ga0500592_012206
1093 Ga0500595_001395
1094 Ga0500595_009512
1095 Ga0500595_022906
1096 Ga0500618_006530
1097 Ga0500642_0000104
1098 Ga0500652_000138
1099 Ga0500559_0000117
1100 Ga0500559_0328992
1101 Ga0500568_0000838
1102 Ga0500568_0056276
1103 Ga0500577_0154229
1104 Ga0500577_0286280
1105 Ga0500586_000325
1106 Ga0500589_114328
1107 Ga0500590_089034
1108 Ga0500603_021589
1109 Ga0500604_0002239
1110 Ga0500616_0000033
1111 Ga0500622_0001002
1112 Ga0500627_0250702
1113 Ga0500633_0166577
1114 Ga0500634_0023749
1115 Ga0500634_0088259
1116 Ga0500638_003647
1117 Ga0500636_0003823
1118 Ga0500636_0014131
1119 Ga0500637_0000262
1120 Ga0500637_0142123
1121 Ga0500611_163689
1122 Ga0500645_055454
1123 Ga0500609_006359
1124 Ga0500601_028101
1125 Ga0500661_001756
1126 Ga0501082_0192295
1127 2513693049
1128 2603860397
1129 2793080691
1130 2857525344
1131 2874611797
1132 2889037634
1133 2893066290
1134 2919074965
1135 2922361593
1136 2922387181
1137 8006972353
1138 8006999750

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05014

Nuc_deoxyrib_tr

Nucleoside 2-deoxyribosyltransferase

25

164

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7o62-assembly1.cif.gz_C crystal structure of a 2`-deoxyribosyltransferase from the psychrophilic bacterium desulfotalea psychrophila. 0.8627 2 105
6evs-assembly1.cif.gz_A characterization of 2-deoxyribosyltransferase from psychrotolerant bacterium bacillus psychrosaccharolyticus: a suitable biocatalyst for the industrial synthesis of antiviral and antitumoral nucleosides 0.8314 1 100
2f64-assembly1.cif.gz_B crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.6 a resolution with 1-methylquinolin-2(1h)-one bound 0.816 2 175
1s2l-assembly1.cif.gz_C-2 purine 2'deoxyribosyltransferase native structure 0.8119 2 100
8os9-assembly2.cif.gz_B structure of homo sapiens 2'-deoxynucleoside 5'-phosphate n-hydrolase 1 (dnph1) 0.8104 2 100
ID Description Score Start End Superfamily
af_Q9Y7P9_15_204_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.876 2 175 3.40.50.450
af_Q4DTB2_2_103_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8727 58 142 3.40.50.450
2a0kA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8224 2 175 3.40.50.450
af_Q9Y7P9_15_204_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8136 2 175 3.40.50.450
af_Q4E5V4_2_152_3.40.50.450 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8133 1 187 3.40.50.450
ID Description Score Start End GO Terms
AF-A0A0E4FWC4-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9977 1 85 GO:0009159
GO:0070694
AF-A0A537XP52-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9867 1 94 GO:0009159
GO:0016740
GO:0070694
AF-A0A537XP52-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9764 1 94 GO:0009159
GO:0016740
GO:0070694
AF-A0A158HQ26-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.976 1 100 GO:0009159
GO:0016740
GO:0070694
AF-A0A3M4NW77-F1-model_v4 Nucleoside 2-deoxyribosyltransferase 0.9739 2 66 GO:0016740

Map