F464707

General Info

Members Datasets Scaffolds Average Seq Length
569 277 569 175

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100423694|Ga0070664_1004236943
Length 176
Sequence MTQMDFNLDDGIAVLERTPSTLSAMLSALPNDWIDGDEGPDTWSPYVIIGHLNHGERTDWIPRAQIILAQDGRRFTPFDRFAQFEESKGKSLADLLTEFAQLRAENLSTLRGWRLTNAQLALEGEHPELGTVTLSQLLATWVGHDLGHIAQTSRVMAKQYRDAVGPWRAYLPVMDR

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
75 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
81 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
87 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
88 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
89 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
90 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
91 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
153 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
154 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
155 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
156 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
157 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
161 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
162 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
163 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
164 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
165 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
166 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
170 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
171 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
175 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
180 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
181 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
187 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
193 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
194 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
195 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
200 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
201 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
202 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
203 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
206 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
207 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
208 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
209 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
216 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
217 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
218 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
219 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
220 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
221 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
222 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
225 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
226 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
227 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
228 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
229 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
230 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
231 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
232 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
235 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
236 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
237 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
238 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
239 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
240 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
241 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
242 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
243 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
244 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
245 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
246 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
247 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
248 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
249 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
250 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
253 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
254 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
255 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
256 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
257 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
258 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
259 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
260 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
261 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
262 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
263 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
264 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
265 3300049772 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control Metagenome Rhizosphere
266 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
267 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.04
Rhizosphere 95.61
Stem 0
Stem Tuber 0
Unclassified 0.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10119219 3300005289 Unclassified 1803
2 Ga0065704_10534838 3300005289 Unclassified 645
3 Ga0065712_10091475 3300005290 Bacteria 2371
4 Ga0070676_10079568 3300005328 Bacteria 1985
5 Ga0070676_10667308 3300005328 Unclassified 756
6 Ga0070683_100002164 3300005329 Bacteria 15542
7 Ga0070683_100027824 3300005329 Bacteria 5103
8 Ga0070683_100105865 3300005329 Bacteria 2651
9 Ga0070683_100439715 3300005329 Unclassified 1244
10 Ga0070683_100838355 3300005329 Unclassified 882
11 Ga0070683_101016963 3300005329 Unclassified 796
12 Ga0070683_101118170 3300005329 Bacteria 757
13 Ga0070690_100027814 3300005330 Bacteria 3498
14 Ga0070690_100055552 3300005330 Bacteria 2536
15 Ga0070670_100002170 3300005331 Bacteria 16123
16 Ga0070670_100272963 3300005331 Bacteria 1476
17 Ga0070670_100293206 3300005331 Bacteria 1422
18 Ga0070677_10038677 3300005333 Bacteria 1868
19 Ga0068869_100111168 3300005334 Bacteria 2085
20 Ga0070666_10007174 3300005335 Bacteria 6871
21 Ga0070682_100141832 3300005337 Bacteria 1639
22 Ga0068868_100022945 3300005338 Bacteria 4718
23 Ga0068868_100095274 3300005338 Bacteria 2402
24 Ga0068868_100457530 3300005338 Bacteria 1111
25 Ga0070660_100141365 3300005339 Bacteria 1931
26 Ga0070660_100159886 3300005339 Bacteria 1815
27 Ga0070689_100056494 3300005340 Bacteria 3043
28 Ga0070689_100210830 3300005340 Bacteria 1590
29 Ga0070691_10000560 3300005341 Bacteria 14136
30 Ga0070661_100007680 3300005344 Bacteria 7447
31 Ga0070661_100125390 3300005344 Unclassified 1926
32 Ga0070661_100233187 3300005344 Bacteria 1415
33 Ga0070661_100380967 3300005344 Bacteria 1112
34 Ga0070668_100006667 3300005347 Bacteria 8556
35 Ga0070668_100224390 3300005347 Bacteria 1551
36 Ga0070669_100581819 3300005353 Bacteria 936
37 Ga0070669_100742526 3300005353 Unclassified 831
38 Ga0070675_100077954 3300005354 Bacteria 2759
39 Ga0070675_100300877 3300005354 Bacteria 1413
40 Ga0070675_100483528 3300005354 Bacteria 1114
41 Ga0070671_100009661 3300005355 Bacteria 7749
42 Ga0070671_100033598 3300005355 Bacteria 4244
43 Ga0070674_100354333 3300005356 Unclassified 1186
44 Ga0070674_100569014 3300005356 Bacteria 953
45 Ga0070673_100038323 3300005364 Bacteria 3660
46 Ga0070673_100142643 3300005364 Bacteria 2022
47 Ga0070659_100004103 3300005366 Bacteria 10380
48 Ga0070667_100022071 3300005367 Bacteria 5281
49 Ga0070667_100186221 3300005367 Bacteria 1837
50 Ga0070667_100744847 3300005367 Unclassified 908
51 Ga0070714_101445944 3300005435 Bacteria 671
52 Ga0070708_100181564 3300005445 Bacteria 1967
53 Ga0070663_100017194 3300005455 Bacteria 4714
54 Ga0070678_100258228 3300005456 Bacteria 1464
55 Ga0070662_100002461 3300005457 Bacteria 11407
56 Ga0070662_100298909 3300005457 Bacteria 1307
57 Ga0070662_100899317 3300005457 Bacteria 755
58 Ga0070681_10557053 3300005458 Unclassified 1060
59 Ga0068867_100105023 3300005459 Bacteria 2163
60 Ga0068867_101087453 3300005459 Unclassified 729
61 Ga0070685_10078664 3300005466 Bacteria 1972
62 Ga0070707_100749020 3300005468 Bacteria 940
63 Ga0070698_100128563 3300005471 Bacteria 2489
64 Ga0070699_100242117 3300005518 Bacteria 1610
65 Ga0070699_100427382 3300005518 Unclassified 1199
66 Ga0070679_100049825 3300005530 Bacteria 4172
67 Ga0070679_100267571 3300005530 Unclassified 1664
68 Ga0070679_100393518 3300005530 Bacteria 1332
69 Ga0070679_100779695 3300005530 Unclassified 899
70 Ga0070684_100005156 3300005535 Bacteria 9989
71 Ga0070684_100005806 3300005535 Bacteria 9492
72 Ga0070684_100019205 3300005535 Bacteria 5651
73 Ga0070684_100020454 3300005535 Bacteria 5491
74 Ga0070684_100049809 3300005535 Bacteria 3637
75 Ga0070684_100261698 3300005535 Bacteria 1583
76 Ga0070684_100662339 3300005535 Bacteria 972
77 Ga0070684_101129317 3300005535 Unclassified 737
78 Ga0068853_100877614 3300005539 Bacteria 861
79 Ga0070672_100211026 3300005543 Bacteria 1626
80 Ga0070672_100323481 3300005543 Bacteria 1311
81 Ga0070672_100453468 3300005543 Bacteria 1105
82 Ga0070686_100086618 3300005544 Bacteria 2086
83 Ga0070693_100520887 3300005547 Unclassified 846
84 Ga0070665_100104416 3300005548 Bacteria 2836
85 Ga0070704_100109581 3300005549 Bacteria 2098
86 Ga0068855_100375026 3300005563 Bacteria 1563
87 Ga0070664_100027111 3300005564 Bacteria 4760
88 Ga0070664_100039316 3300005564 Bacteria 3986
89 Ga0070664_100070093 3300005564 Bacteria 3002
90 Ga0070664_100079878 3300005564 Bacteria 2816
91 Ga0070664_100115841 3300005564 Unclassified 2343
92 Ga0070664_100217138 3300005564 Bacteria 1710
93 Ga0070664_100370151 3300005564 Bacteria 1306
94 Ga0070664_100423694 3300005564 Bacteria 1219
95 Ga0068857_100003022 3300005577 Bacteria 13897
96 Ga0068857_100232058 3300005577 Bacteria 1688
97 Ga0068854_100703664 3300005578 Unclassified 872
98 Ga0068856_100278411 3300005614 Bacteria 1690
99 Ga0068856_100535653 3300005614 Bacteria 1192
100 Ga0068856_101369250 3300005614 Unclassified 722
101 Ga0068856_101721755 3300005614 Bacteria 639
102 Ga0070702_100005647 3300005615 Bacteria 5853
103 Ga0070702_100736183 3300005615 Bacteria 755
104 Ga0068852_100141538 3300005616 Bacteria 2227
105 Ga0068852_100164659 3300005616 Bacteria 2074
106 Ga0068859_100098340 3300005617 Bacteria 2980
107 Ga0068859_100181302 3300005617 Bacteria 2189
108 Ga0068859_100204627 3300005617 Bacteria 2059
109 Ga0068864_100016185 3300005618 Bacteria 6207
110 Ga0068864_100047560 3300005618 Unclassified 3685
111 Ga0068864_100089087 3300005618 Bacteria 2719
112 Ga0068864_100257410 3300005618 Bacteria 1622
113 Ga0068864_100397769 3300005618 Bacteria 1309
114 Ga0068864_100963564 3300005618 Bacteria 845
115 Ga0068864_101406130 3300005618 Unclassified 699
116 Ga0068861_100068587 3300005719 Bacteria 2741
117 Ga0068861_100129627 3300005719 Bacteria 2046
118 Ga0068851_10118174 3300005834 Bacteria 1422
119 Ga0068870_10028020 3300005840 Bacteria 2824
120 Ga0068870_10494073 3300005840 Unclassified 814
121 Ga0068863_100103551 3300005841 Bacteria 2707
122 Ga0068863_100184668 3300005841 Unclassified 2002
123 Ga0068863_100257536 3300005841 Bacteria 1686
124 Ga0068858_100120296 3300005842 Bacteria 2455
125 Ga0068860_100007345 3300005843 Bacteria 11015
126 Ga0068860_100139902 3300005843 Bacteria 2326
127 Ga0068860_100463658 3300005843 Bacteria 1261
128 Ga0068862_100485535 3300005844 Bacteria 1170
129 Ga0081539_10001600 3300005985 Bacteria 37341
130 Ga0070715_10269110 3300006163 Unclassified 898
131 Ga0097621_100020459 3300006237 Bacteria 5099
132 Ga0097621_100033298 3300006237 Unclassified 4102
133 Ga0068871_100079922 3300006358 Bacteria 2706
134 Ga0075428_100009929 3300006844 Bacteria 10573
135 Ga0075428_100119062 3300006844 Bacteria 2875
136 Ga0075433_10480487 3300006852 Bacteria 1095
137 Ga0075429_100373546 3300006880 Unclassified 1248
138 Ga0068865_100014306 3300006881 Bacteria 5039
139 Ga0068865_100090455 3300006881 Bacteria 2219
140 Ga0097620_100098349 3300006931 Bacteria 2980
141 Ga0097620_100181301 3300006931 Bacteria 2189
142 Ga0097620_100204640 3300006931 Bacteria 2059
143 Ga0099794_10224271 3300007265 Bacteria 966
144 Ga0111539_10001049 3300009094 Bacteria 36370
145 Ga0111539_10013647 3300009094 Bacteria 10147
146 Ga0111539_10090086 3300009094 Unclassified 3605
147 Ga0111539_10149946 3300009094 Bacteria 2730
148 Ga0111539_11389540 3300009094 Bacteria 814
149 Ga0105245_10022952 3300009098 Bacteria 5475
150 Ga0105245_10356606 3300009098 Bacteria 1450
151 Ga0105245_11400666 3300009098 Bacteria 749
152 Ga0105247_10153104 3300009101 Unclassified 1521
153 Ga0114129_10134377 3300009147 Bacteria 3395
154 Ga0114129_10338452 3300009147 Unclassified 1996
155 Ga0114129_11798353 3300009147 Unclassified 745
156 Ga0105243_10488330 3300009148 Unclassified 1164
157 Ga0105243_10756556 3300009148 Bacteria 953
158 Ga0105241_10061296 3300009174 Bacteria 2896
159 Ga0105241_10430820 3300009174 Bacteria 1163
160 Ga0105241_10472488 3300009174 Unclassified 1113
161 Ga0105242_10018377 3300009176 Bacteria 5464
162 Ga0105242_10021360 3300009176 Bacteria 5080
163 Ga0105242_10067419 3300009176 Bacteria 2959
164 Ga0105242_10649427 3300009176 Unclassified 1026
165 Ga0105248_10059481 3300009177 Unclassified 4292
166 Ga0105248_10220738 3300009177 Bacteria 2134
167 Ga0105248_10299129 3300009177 Bacteria 1812
168 Ga0105248_10312061 3300009177 Unclassified 1771
169 Ga0105248_10502327 3300009177 Unclassified 1367
170 Ga0105248_10834999 3300009177 Unclassified 1040
171 Ga0105248_11229560 3300009177 Unclassified 847
172 Ga0105248_11674710 3300009177 Unclassified 721
173 Ga0105238_10000225 3300009551 Bacteria 62813
174 Ga0105238_10009656 3300009551 Bacteria 9658
175 Ga0105238_10024744 3300009551 Bacteria 6120
176 Ga0105239_10064670 3300010375 Bacteria 4015
177 Ga0105246_10143008 3300011119 Bacteria 1801
178 Ga0105246_11237146 3300011119 Bacteria 689
179 Ga0157373_10152250 3300013100 Bacteria 1627
180 Ga0157371_10006495 3300013102 Bacteria 9628
181 Ga0157370_10290574 3300013104 Bacteria 1510
182 Ga0157370_10926687 3300013104 Unclassified 790
183 Ga0157369_10178607 3300013105 Unclassified 2234
184 Ga0157369_10511127 3300013105 Bacteria 1243
185 Ga0157369_10748441 3300013105 Bacteria 1005
186 Ga0157369_10956273 3300013105 Unclassified 878
187 Ga0157369_11323052 3300013105 Unclassified 734
188 Ga0157374_10009184 3300013296 Bacteria 8476
189 Ga0157374_10099399 3300013296 Unclassified 2787
190 Ga0157374_10142928 3300013296 Bacteria 2323
191 Ga0157378_10231349 3300013297 Bacteria 1762
192 Ga0157378_10248288 3300013297 Unclassified 1703
193 Ga0157378_10591813 3300013297 Bacteria 1119
194 Ga0163162_10087820 3300013306 Unclassified 3189
195 Ga0163162_10192326 3300013306 Unclassified 2168
196 Ga0163162_11036873 3300013306 Bacteria 928
197 Ga0163162_11090697 3300013306 Unclassified 904
198 Ga0157372_10000695 3300013307 Bacteria 36964
199 Ga0157372_10014061 3300013307 Bacteria 8548
200 Ga0157372_10053394 3300013307 Unclassified 4504
201 Ga0157372_10157673 3300013307 Bacteria 2622
202 Ga0157372_10202493 3300013307 Bacteria 2300
203 Ga0157372_10413778 3300013307 Bacteria 1571
204 Ga0157372_10769265 3300013307 Bacteria 1119
205 Ga0157372_10968926 3300013307 Unclassified 986
206 Ga0157375_10095014 3300013308 Unclassified 3051
207 Ga0157375_10134168 3300013308 Bacteria 2598
208 Ga0157375_10796320 3300013308 Unclassified 1094
209 Ga0157375_10914018 3300013308 Bacteria 1021
210 Ga0157375_11454701 3300013308 Unclassified 808
211 Ga0157375_11730116 3300013308 Bacteria 741
212 Ga0163163_10177062 3300014325 Bacteria 2180
213 Ga0163163_10318560 3300014325 Bacteria 1609
214 Ga0163163_10538062 3300014325 Bacteria 1231
215 Ga0157380_10027225 3300014326 Bacteria 4347
216 Ga0157377_10061572 3300014745 Bacteria 2145
217 Ga0157379_10760321 3300014968 Bacteria 913
218 Ga0157379_11060168 3300014968 Bacteria 775
219 Ga0157376_10181388 3300014969 Unclassified 1925
220 Ga0182007_10014049 3300015262 Bacteria 3033
221 Ga0163161_10001671 3300017792 Bacteria 16268
222 Ga0163161_10059121 3300017792 Bacteria 2787
223 Ga0207713_1193309 3300025735 Bacteria 628
224 Ga0207682_10014497 3300025893 Unclassified 3072
225 Ga0207710_10069350 3300025900 Bacteria 1614
226 Ga0207680_10015800 3300025903 Bacteria 3948
227 Ga0207647_10152364 3300025904 Bacteria 1351
228 Ga0207645_10065419 3300025907 Bacteria 2324
229 Ga0207645_10070511 3300025907 Bacteria 2235
230 Ga0207645_10091116 3300025907 Bacteria 1961
231 Ga0207645_10391265 3300025907 Unclassified 934
232 Ga0207643_10296650 3300025908 Unclassified 1005
233 Ga0207705_10045525 3300025909 Bacteria 3153
234 Ga0207705_10119112 3300025909 Unclassified 1957
235 Ga0207654_10280338 3300025911 Bacteria 1127
236 Ga0207654_10430038 3300025911 Bacteria 923
237 Ga0207707_10044048 3300025912 Bacteria 3891
238 Ga0207707_10340842 3300025912 Unclassified 1292
239 Ga0207707_10845772 3300025912 Unclassified 760
240 Ga0207695_10003493 3300025913 Bacteria 22094
241 Ga0207695_10221269 3300025913 Bacteria 1800
242 Ga0207662_10389046 3300025918 Bacteria 943
243 Ga0207657_10036831 3300025919 Bacteria 4376
244 Ga0207649_10012635 3300025920 Bacteria 4690
245 Ga0207649_10052574 3300025920 Bacteria 2528
246 Ga0207649_10129597 3300025920 Unclassified 1711
247 Ga0207652_10184775 3300025921 Unclassified 1874
248 Ga0207652_10191968 3300025921 Unclassified 1837
249 Ga0207652_10196263 3300025921 Unclassified 1816
250 Ga0207652_10237392 3300025921 Bacteria 1643
251 Ga0207646_10551757 3300025922 Bacteria 1036
252 Ga0207681_10197745 3300025923 Bacteria 1542
253 Ga0207681_10545242 3300025923 Bacteria 954
254 Ga0207694_10000013 3300025924 Bacteria 384823
255 Ga0207694_10139648 3300025924 Bacteria 1948
256 Ga0207650_10016951 3300025925 Bacteria 5096
257 Ga0207650_10134000 3300025925 Bacteria 1941
258 Ga0207650_10217429 3300025925 Bacteria 1537
259 Ga0207659_10113034 3300025926 Bacteria 2067
260 Ga0207659_10906919 3300025926 Unclassified 758
261 Ga0207687_10095326 3300025927 Unclassified 2179
262 Ga0207644_10063759 3300025931 Bacteria 2676
263 Ga0207644_10129932 3300025931 Bacteria 1927
264 Ga0207690_10033208 3300025932 Bacteria 3317
265 Ga0207706_10000223 3300025933 Bacteria 62189
266 Ga0207706_10030153 3300025933 Bacteria 4839
267 Ga0207706_10579076 3300025933 Unclassified 965
268 Ga0207686_10022283 3300025934 Bacteria 3647
269 Ga0207686_10023738 3300025934 Bacteria 3544
270 Ga0207686_10025077 3300025934 Bacteria 3464
271 Ga0207686_10555328 3300025934 Bacteria 898
272 Ga0207670_10025722 3300025936 Bacteria 3699
273 Ga0207670_10213543 3300025936 Bacteria 1473
274 Ga0207670_10229625 3300025936 Bacteria 1425
275 Ga0207669_10245811 3300025937 Bacteria 1329
276 Ga0207704_10014330 3300025938 Bacteria 4000
277 Ga0207704_10973523 3300025938 Unclassified 716
278 Ga0207691_10098564 3300025940 Bacteria 2610
279 Ga0207691_10127741 3300025940 Bacteria 2248
280 Ga0207691_10134566 3300025940 Bacteria 2181
281 Ga0207711_10006772 3300025941 Bacteria 9633
282 Ga0207711_10126884 3300025941 Bacteria 2283
283 Ga0207711_10368378 3300025941 Unclassified 1332
284 Ga0207711_10371449 3300025941 Bacteria 1326
285 Ga0207711_10397968 3300025941 Bacteria 1279
286 Ga0207711_10883484 3300025941 Unclassified 831
287 Ga0207689_10324347 3300025942 Unclassified 1278
288 Ga0207661_10000364 3300025944 Bacteria 29069
289 Ga0207661_10005648 3300025944 Bacteria 8825
290 Ga0207661_10024755 3300025944 Bacteria 4554
291 Ga0207661_10099719 3300025944 Bacteria 2436
292 Ga0207661_10138260 3300025944 Bacteria 2094
293 Ga0207661_10218605 3300025944 Bacteria 1683
294 Ga0207661_10559704 3300025944 Unclassified 1048
295 Ga0207679_10300679 3300025945 Bacteria 1383
296 Ga0207679_10814280 3300025945 Unclassified 852
297 Ga0207679_11026988 3300025945 Unclassified 756
298 Ga0207667_10033553 3300025949 Bacteria 5517
299 Ga0207667_10198330 3300025949 Bacteria 2059
300 Ga0207651_10876640 3300025960 Bacteria 798
301 Ga0207712_10358563 3300025961 Bacteria 1214
302 Ga0207668_10148917 3300025972 Bacteria 1809
303 Ga0207668_10547989 3300025972 Unclassified 1001
304 Ga0207640_10004904 3300025981 Bacteria 7271
305 Ga0207658_10150105 3300025986 Bacteria 1897
306 Ga0207658_10753142 3300025986 Bacteria 882
307 Ga0207677_10015015 3300026023 Bacteria 4541
308 Ga0207703_10025536 3300026035 Bacteria 4646
309 Ga0207703_10207465 3300026035 Bacteria 1745
310 Ga0207703_10836742 3300026035 Bacteria 880
311 Ga0207639_10832553 3300026041 Bacteria 861
312 Ga0207678_10000621 3300026067 Bacteria 32462
313 Ga0207708_11596906 3300026075 Bacteria 573
314 Ga0207702_10151806 3300026078 Bacteria 2108
315 Ga0207702_11266356 3300026078 Unclassified 732
316 Ga0207641_10007119 3300026088 Bacteria 9343
317 Ga0207641_10233715 3300026088 Bacteria 1710
318 Ga0207648_10008371 3300026089 Bacteria 10027
319 Ga0207648_10176427 3300026089 Bacteria 1890
320 Ga0207676_10001991 3300026095 Bacteria 14870
321 Ga0207676_10144226 3300026095 Bacteria 2043
322 Ga0207676_10163976 3300026095 Bacteria 1929
323 Ga0207676_10215105 3300026095 Bacteria 1708
324 Ga0207676_10304519 3300026095 Bacteria 1456
325 Ga0207676_10381946 3300026095 Bacteria 1311
326 Ga0207676_10906355 3300026095 Bacteria 865
327 Ga0207674_10002317 3300026116 Bacteria 24108
328 Ga0207674_10046996 3300026116 Bacteria 4428
329 Ga0207674_10071495 3300026116 Bacteria 3486
330 Ga0207675_100073068 3300026118 Bacteria 3208
331 Ga0207683_11000012 3300026121 Unclassified 776
332 Ga0207698_10128892 3300026142 Bacteria 2158
333 Ga0207698_10467158 3300026142 Unclassified 1221
334 Ga0209995_1019361 3300027471 Bacteria 1123
335 Ga0209999_1002986 3300027543 Bacteria 3007
336 Ga0268266_10149480 3300028379 Bacteria 2104
337 Ga0268264_10010562 3300028381 Bacteria 7636
338 Ga0316182_1262167 3300030745 Bacteria 1291
339 Ga0265332_10053275 3300031238 Bacteria 1736
340 Ga0265325_10393912 3300031241 Bacteria 607
341 Ga0265327_10019927 3300031251 Bacteria 4106
342 Ga0307408_100018775 3300031548 Bacteria 4647
343 Ga0307408_100129201 3300031548 Unclassified 1969
344 Ga0307408_100154980 3300031548 Unclassified 1813
345 Ga0307408_100291302 3300031548 Bacteria 1363
346 Ga0307408_100423994 3300031548 Bacteria 1148
347 Ga0307408_100675926 3300031548 Unclassified 926
348 Ga0307408_100817917 3300031548 Bacteria 847
349 Ga0265314_10016381 3300031711 Bacteria 5855
350 Ga0307405_10016104 3300031731 Bacteria 4068
351 Ga0307405_10286968 3300031731 Bacteria 1242
352 Ga0307405_11522146 3300031731 Unclassified 588
353 Ga0307413_10010803 3300031824 Bacteria 4451
354 Ga0307413_10034748 3300031824 Bacteria 2884
355 Ga0307413_10098172 3300031824 Bacteria 1928
356 Ga0307413_10936222 3300031824 Bacteria 738
357 Ga0307410_10027268 3300031852 Bacteria 3608
358 Ga0307410_10119582 3300031852 Unclassified 1919
359 Ga0307410_11338445 3300031852 Unclassified 627
360 Ga0307406_10013118 3300031901 Bacteria 4739
361 Ga0307406_10051007 3300031901 Bacteria 2625
362 Ga0307406_10308108 3300031901 Bacteria 1219
363 Ga0307406_10464056 3300031901 Unclassified 1019
364 Ga0307407_10002325 3300031903 Bacteria 7395
365 Ga0307407_10003498 3300031903 Bacteria 6461
366 Ga0307407_10017929 3300031903 Bacteria 3566
367 Ga0307407_10155397 3300031903 Bacteria 1491
368 Ga0307407_10494691 3300031903 Unclassified 895
369 Ga0307407_10520521 3300031903 Unclassified 875
370 Ga0307407_11171608 3300031903 Unclassified 599
371 Ga0307412_10020524 3300031911 Bacteria 4022
372 Ga0307412_10049644 3300031911 Bacteria 2765
373 Ga0307412_10068467 3300031911 Bacteria 2414
374 Ga0307412_10130958 3300031911 Unclassified 1821
375 Ga0307409_100013660 3300031995 Bacteria 5241
376 Ga0307409_100017769 3300031995 Bacteria 4753
377 Ga0307409_100109565 3300031995 Bacteria 2312
378 Ga0307409_100170214 3300031995 Unclassified 1916
379 Ga0307409_100248698 3300031995 Unclassified 1624
380 Ga0307409_100268240 3300031995 Bacteria 1570
381 Ga0307409_100429244 3300031995 Bacteria 1270
382 Ga0307409_100522784 3300031995 Bacteria 1159
383 Ga0307409_101290497 3300031995 Unclassified 755
384 Ga0307416_100003107 3300032002 Bacteria 9722
385 Ga0307416_100005086 3300032002 Bacteria 8025
386 Ga0307416_100328177 3300032002 Bacteria 1536
387 Ga0307416_101127697 3300032002 Unclassified 889
388 Ga0307416_101571810 3300032002 Unclassified 763
389 Ga0307416_101577074 3300032002 Bacteria 762
390 Ga0307416_102054559 3300032002 Unclassified 674
391 Ga0307414_10040985 3300032004 Bacteria 3132
392 Ga0307414_10053418 3300032004 Bacteria 2817
393 Ga0307414_11158472 3300032004 Bacteria 715
394 Ga0307411_10166042 3300032005 Unclassified 1659
395 Ga0307411_10220696 3300032005 Bacteria 1470
396 Ga0307411_10778956 3300032005 Unclassified 840
397 Ga0307411_10845346 3300032005 Bacteria 809
398 Ga0307411_10869913 3300032005 Unclassified 799
399 Ga0307415_100005994 3300032126 Bacteria 6513
400 Ga0307415_100086067 3300032126 Unclassified 2260
401 Ga0307415_100283800 3300032126 Unclassified 1363
402 Ga0307415_100398539 3300032126 Unclassified 1174
403 Ga0307415_100634391 3300032126 Bacteria 955
404 Ga0373934_0060679 3300035086 Bacteria 1506
405 Ga0373940_0095668 3300035088 Unclassified 895
406 Ga0373949_0071929 3300035090 Bacteria 907
407 Ga0373923_0127279 3300035111 Bacteria 1142
408 Ga0373936_0080587 3300035113 Bacteria 1355
409 Ga0373953_0054815 3300035117 Unclassified 1618
410 Ga0373957_0388455 3300035120 Bacteria 599
411 Ga0373943_0014633 3300035170 Unclassified 3556
412 Ga0373955_0040040 3300035172 Unclassified 2504
413 Ga0373931_0070479 3300035691 Unclassified 1907
414 Ga0373931_0104751 3300035691 Bacteria 1596
415 Ga0373927_0050336 3300035695 Bacteria 2694
416 Ga0373933_0274695 3300035724 Bacteria 1088
417 Ga0373937_0007000 3300036401 Bacteria 9734
418 Ga0373937_0132304 3300036401 Bacteria 2330
419 Ga0373925_0073278 3300037068 Bacteria 2592
420 Ga0395905_0613972 3300037471 Unclassified 989
421 Ga0395901_0410147 3300038443 Bacteria 1391
422 Ga0395901_0451330 3300038443 Bacteria 1315
423 Ga0436365_0917686 3300039437 Unclassified 696
424 Ga0451853_2262551 3300041512 Bacteria 848
425 Ga0439460_0009970 3300042461 Bacteria 2423
426 Ga0439460_0078994 3300042461 Unclassified 1030
427 Ga0466966_0085464 3300044684 Unclassified 1961
428 Ga0466961_0215188 3300044693 Bacteria 1185
429 Ga0466963_0137878 3300044694 Bacteria 1689
430 Ga0466957_0164824 3300044842 Bacteria 1441
431 Ga0466959_0265591 3300045049 Bacteria 1181
432 Ga0466959_0306565 3300045049 Bacteria 1087
433 Ga0451576_0039022 3300045051 Bacteria 5026
434 Ga0451576_1191295 3300045051 Bacteria 796
435 Ga0466958_0361278 3300045836 Bacteria 935
436 Ga0466967_1527341 3300045976 Bacteria 665
437 Ga0495603_0423085 3300046455 Unclassified 763
438 Ga0495629_0066561 3300046459 Bacteria 2515
439 Ga0495651_0014779 3300046462 Bacteria 6036
440 Ga0495580_0008420 3300046472 Bacteria 8205
441 Ga0495582_0014739 3300046473 Unclassified 4296
442 Ga0495582_0291760 3300046473 Bacteria 937
443 Ga0495664_0041346 3300046477 Bacteria 2727
444 Ga0495664_0055043 3300046477 Bacteria 2367
445 Ga0495594_0002629 3300046499 Bacteria 9335
446 Ga0495594_0006066 3300046499 Bacteria 6210
447 Ga0495594_0088633 3300046499 Bacteria 1732
448 Ga0495608_0197555 3300046511 Bacteria 1268
449 Ga0495628_0272718 3300046516 Bacteria 1258
450 Ga0495630_0019101 3300046517 Bacteria 5037
451 Ga0495630_0135727 3300046517 Bacteria 1869
452 Ga0495630_0280285 3300046517 Bacteria 1273
453 Ga0495630_0349480 3300046517 Bacteria 1132
454 Ga0495642_0172147 3300046528 Unclassified 941
455 Ga0495652_0120770 3300046529 Bacteria 2090
456 Ga0495652_0308398 3300046529 Bacteria 1148
457 Ga0495665_0015138 3300046531 Bacteria 4156
458 Ga0495665_0074893 3300046531 Bacteria 1782
459 Ga0495640_0058754 3300046533 Bacteria 2622
460 Ga0495640_0079215 3300046533 Bacteria 2188
461 Ga0495640_0793542 3300046533 Bacteria 565
462 Ga0495587_0001345 3300046536 Bacteria 16323
463 Ga0495587_0206200 3300046536 Bacteria 1111
464 Ga0495645_0000591 3300046543 Bacteria 24957
465 Ga0495645_0046224 3300046543 Bacteria 3173
466 Ga0495645_0144752 3300046543 Bacteria 1656
467 Ga0495667_0046495 3300046559 Bacteria 2870
468 Ga0495667_0088654 3300046559 Bacteria 2005
469 Ga0495667_0122993 3300046559 Bacteria 1675
470 Ga0495634_0028366 3300046642 Bacteria 3886
471 Ga0495634_0167570 3300046642 Bacteria 1382
472 Ga0495635_0094498 3300046663 Bacteria 2044
473 Ga0495588_0145822 3300046674 Bacteria 1251
474 Ga0495599_0003629 3300046678 Bacteria 9057
475 Ga0495623_0002264 3300046679 Bacteria 12809
476 Ga0495646_0044425 3300046680 Bacteria 2717
477 Ga0495646_0092411 3300046680 Bacteria 1745
478 Ga0495647_0058185 3300046681 Unclassified 1519
479 Ga0495658_0028304 3300046683 Bacteria 3024
480 Ga0495658_0392431 3300046683 Unclassified 884
481 Ga0495613_0394629 3300046689 Unclassified 945
482 Ga0495613_0432359 3300046689 Bacteria 894
483 Ga0495600_0040605 3300046809 Bacteria 3031
484 Ga0495581_0006434 3300047315 Bacteria 6817
485 Ga0495581_0014508 3300047315 Unclassified 4570
486 Ga0495581_0069314 3300047315 Bacteria 2039
487 Ga0495581_0190631 3300047315 Bacteria 1199
488 Ga0495604_0023776 3300047317 Bacteria 4890
489 Ga0495674_0106773 3300047319 Bacteria 2377
490 Ga0495674_0126375 3300047319 Bacteria 2157
491 Ga0495674_0211420 3300047319 Unclassified 1606
492 Ga0495672_0007338 3300047320 Bacteria 8312
493 Ga0495680_0639940 3300047322 Bacteria 708
494 Ga0495675_0005472 3300047444 Bacteria 7747
495 Ga0495675_0022368 3300047444 Bacteria 4030
496 Ga0495675_0067056 3300047444 Bacteria 2268
497 Ga0495684_0003259 3300047471 Bacteria 12756
498 Ga0495684_0005039 3300047471 Bacteria 10309
499 Ga0495684_0025296 3300047471 Unclassified 4564
500 Ga0495684_0041202 3300047471 Bacteria 3539
501 Ga0495593_0480032 3300047673 Unclassified 623
502 Ga0495602_0003596 3300048088 Bacteria 16052
503 Ga0495602_0303178 3300048088 Bacteria 1168
504 Ga0495614_0152567 3300048089 Bacteria 1031
505 Ga0496101_0662068 3300048904 Unclassified 825
506 Ga0496101_0709850 3300048904 Unclassified 794
507 Ga0496104_0024693 3300048907 Bacteria 5532
508 Ga0496104_0339650 3300048907 Bacteria 1415
509 Ga0496105_0308189 3300048908 Unclassified 1272
510 Ga0496105_0406542 3300048908 Bacteria 1080
511 Ga0496106_0041635 3300048909 Bacteria 3443
512 Ga0496108_0012356 3300048911 Bacteria 6948
513 Ga0496108_0323414 3300048911 Bacteria 1345
514 Ga0496109_0001037 3300048912 Bacteria 22996
515 Ga0496109_0144307 3300048912 Bacteria 2227
516 Ga0496110_0176244 3300048913 Bacteria 1940
517 Ga0496110_0594054 3300048913 Bacteria 1005
518 Ga0496110_0954960 3300048913 Bacteria 764
519 Ga0496111_0212075 3300048914 Unclassified 1438
520 Ga0496112_0000129 3300048915 Bacteria 47173
521 Ga0496112_0050080 3300048915 Bacteria 4095
522 Ga0496112_0134629 3300048915 Bacteria 2441
523 Ga0496112_0146155 3300048915 Bacteria 2333
524 Ga0496112_0600100 3300048915 Bacteria 1033
525 Ga0496113_0000062 3300048916 Bacteria 46801
526 Ga0496113_0282212 3300048916 Bacteria 1328
527 Ga0496114_1071186 3300048917 Bacteria 690
528 Ga0501294_013978 3300049517 Unclassified 818
529 Ga0501298_004883 3300049521 Bacteria 2134
530 Ga0501067_0151259 3300049583 Bacteria 1293
531 Ga0501069_0314241 3300049585 Bacteria 920
532 Ga0501073_0011175 3300049589 Bacteria 6565
533 Ga0501077_0610395 3300049593 Bacteria 701
534 Ga0501216_000925 3300049660 Bacteria 3727
535 Ga0501217_002548 3300049661 Bacteria 3600
536 Ga0501230_000515 3300049667 Bacteria 3919
537 Ga0501235_000383 3300049669 Bacteria 8478
538 Ga0501239_002706 3300049672 Unclassified 1630
539 Ga0501242_000318 3300049674 Bacteria 3943
540 Ga0501249_011837 3300049679 Bacteria 1837
541 Ga0501249_029971 3300049679 Bacteria 1211
542 Ga0501251_008581 3300049681 Unclassified 1161
543 Ga0501257_007318 3300049686 Bacteria 2466
544 Ga0501258_000403 3300049687 Bacteria 2859
545 Ga0501225_0000567 3300049705 Bacteria 11585
546 Ga0501234_001484 3300049707 Bacteria 3688
547 Ga0501268_000218 3300049765 Bacteria 5662
548 Ga0501269_041133 3300049766 Unclassified 616
549 Ga0501272_000961 3300049769 Bacteria 2639
550 Ga0501275_009096 3300049772 Unclassified 1035
551 nmdc:mga05p37_129673_c1 3300050507 Bacteria 3094
552 nmdc:mga05p37_1454562_c1 3300050507 Unclassified 686
553 nmdc:mga05p37_74710_c1 3300050507 Bacteria 4171
554 nmdc:mga09592_43091_c1 3300050508 Bacteria 3797
555 nmdc:mga06r32_354107_c1 3300050510 Bacteria 1452
556 nmdc:mga08y16_1154059_c1 3300050511 Bacteria 747
557 nmdc:mga08y16_188305_c1 3300050511 Bacteria 2141
558 nmdc:mga08y16_3729_c1 3300050511 Bacteria 15864
559 nmdc:mga08y16_467602_c1 3300050511 Unclassified 1284
560 nmdc:mga0n895_436296_c1 3300050512 Bacteria 1323
561 nmdc:mga0rr50_580444_c1 3300050513 Unclassified 955
562 nmdc:mga08x19_5623_c1 3300050514 Bacteria 7405
563 nmdc:mga0a205_880773_c1 3300050515 Bacteria 742
564 Ga0495601_0010964 3300053077 Bacteria 5412
565 Ga0495601_0085043 3300053077 Bacteria 2032
566 Ga0495612_0029121 3300053078 Bacteria 2223
567 Ga0495619_0093698 3300053085 Bacteria 2036
568 Ga0495619_0099901 3300053085 Unclassified 1974
569 Ga0530510_0666377 3300061734 Bacteria 792

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046681 Ga0495647_0058185 Ga0495647_0058185_62_523 137
2 3300009177 Ga0105248_10059481 Ga0105248_100594813 158
3 3300013296 Ga0157374_10142928 Ga0157374_101429285 158
4 3300013306 Ga0163162_11090697 Ga0163162_110906971 158
5 3300013308 Ga0157375_10796320 Ga0157375_107963202 158
6 3300025941 Ga0207711_10397968 Ga0207711_103979682 158
7 3300005535 Ga0070684_100019205 Ga0070684_1000192055 168
8 3300005614 Ga0068856_101369250 Ga0068856_1013692501 168
9 3300013307 Ga0157372_10000695 Ga0157372_1000069534 168
10 3300005289 Ga0065704_10534838 Ga0065704_105348381 173
11 3300005290 Ga0065712_10091475 Ga0065712_100914753 173
12 3300005330 Ga0070690_100055552 Ga0070690_1000555522 173
13 3300005335 Ga0070666_10007174 Ga0070666_100071742 173
14 3300005338 Ga0068868_100022945 Ga0068868_1000229452 173
15 3300005340 Ga0070689_100056494 Ga0070689_1000564942 173
16 3300005355 Ga0070671_100033598 Ga0070671_1000335982 173
17 3300005364 Ga0070673_100038323 Ga0070673_1000383232 173
18 3300005367 Ga0070667_100022071 Ga0070667_1000220712 173
19 3300005457 Ga0070662_100298909 Ga0070662_1002989091 173
20 3300005466 Ga0070685_10078664 Ga0070685_100786642 173
21 3300005468 Ga0070707_100749020 Ga0070707_1007490201 173
22 3300005539 Ga0068853_100877614 Ga0068853_1008776142 173
23 3300005543 Ga0070672_100211026 Ga0070672_1002110262 173
24 3300005544 Ga0070686_100086618 Ga0070686_1000866182 173
25 3300005547 Ga0070693_100520887 Ga0070693_1005208872 173
26 3300005564 Ga0070664_100079878 Ga0070664_1000798782 173
27 3300005564 Ga0070664_100217138 Ga0070664_1002171382 173
28 3300005564 Ga0070664_100423694 Ga0070664_1004236943 173
29 3300005578 Ga0068854_100703664 Ga0068854_1007036642 173
30 3300005615 Ga0070702_100005647 Ga0070702_1000056473 173
31 3300005616 Ga0068852_100141538 Ga0068852_1001415382 173
32 3300005617 Ga0068859_100098340 Ga0068859_1000983402 173
33 3300005618 Ga0068864_100257410 Ga0068864_1002574102 173
34 3300005834 Ga0068851_10118174 Ga0068851_101181741 173
35 3300005841 Ga0068863_100103551 Ga0068863_1001035512 173
36 3300005842 Ga0068858_100120296 Ga0068858_1001202962 173
37 3300005843 Ga0068860_100007345 Ga0068860_1000073451 173
38 3300006237 Ga0097621_100020459 Ga0097621_1000204594 173
39 3300006358 Ga0068871_100079922 Ga0068871_1000799222 173
40 3300006844 Ga0075428_100119062 Ga0075428_1001190623 173
41 3300006880 Ga0075429_100373546 Ga0075429_1003735462 173
42 3300006881 Ga0068865_100014306 Ga0068865_1000143064 173
43 3300006931 Ga0097620_100098349 Ga0097620_1000983492 173
44 3300017792 Ga0163161_10001671 Ga0163161_100016713 173
45 3300025900 Ga0207710_10069350 Ga0207710_100693502 173
46 3300025903 Ga0207680_10015800 Ga0207680_100158003 173
47 3300025907 Ga0207645_10391265 Ga0207645_103912651 173
48 3300025922 Ga0207646_10551757 Ga0207646_105517571 173
49 3300025931 Ga0207644_10063759 Ga0207644_100637592 173
50 3300025933 Ga0207706_10579076 Ga0207706_105790762 173
51 3300025934 Ga0207686_10022283 Ga0207686_100222832 173
52 3300025936 Ga0207670_10025722 Ga0207670_100257222 173
53 3300025938 Ga0207704_10014330 Ga0207704_100143302 173
54 3300025940 Ga0207691_10127741 Ga0207691_101277412 173
55 3300025941 Ga0207711_10006772 Ga0207711_100067723 173
56 3300025945 Ga0207679_10300679 Ga0207679_103006792 173
57 3300025945 Ga0207679_11026988 Ga0207679_110269882 173
58 3300025960 Ga0207651_10876640 Ga0207651_108766401 173
59 3300025986 Ga0207658_10150105 Ga0207658_101501052 173
60 3300026023 Ga0207677_10015015 Ga0207677_100150152 173
61 3300026035 Ga0207703_10025536 Ga0207703_100255362 173
62 3300026041 Ga0207639_10832553 Ga0207639_108325532 173
63 3300026088 Ga0207641_10007119 Ga0207641_100071194 173
64 3300026095 Ga0207676_10144226 Ga0207676_101442262 173
65 3300026142 Ga0207698_10467158 Ga0207698_104671582 173
66 3300028381 Ga0268264_10010562 Ga0268264_100105626 173
67 3300031548 Ga0307408_100675926 Ga0307408_1006759262 173
68 3300031731 Ga0307405_11522146 Ga0307405_115221461 173
69 3300031824 Ga0307413_10098172 Ga0307413_100981723 173
70 3300031852 Ga0307410_10119582 Ga0307410_101195823 173
71 3300031852 Ga0307410_11338445 Ga0307410_113384451 173
72 3300031911 Ga0307412_10068467 Ga0307412_100684672 173
73 3300032002 Ga0307416_102054559 Ga0307416_1020545591 173
74 3300049589 Ga0501073_0011175 Ga0501073_0011175_5596_6117 173
75 3300050513 nmdc:mga0rr50_580444_c1 nmdc:mga0rr50_580444_c1_372_902 173
76 3300005289 Ga0065704_10119219 Ga0065704_101192193 174
77 3300005328 Ga0070676_10079568 Ga0070676_100795683 174
78 3300005328 Ga0070676_10667308 Ga0070676_106673082 174
79 3300005329 Ga0070683_100002164 Ga0070683_1000021644 174
80 3300005329 Ga0070683_100027824 Ga0070683_1000278242 174
81 3300005329 Ga0070683_100105865 Ga0070683_1001058654 174
82 3300005329 Ga0070683_100439715 Ga0070683_1004397152 174
83 3300005329 Ga0070683_100838355 Ga0070683_1008383551 174
84 3300005329 Ga0070683_101016963 Ga0070683_1010169632 174
85 3300005329 Ga0070683_101118170 Ga0070683_1011181701 174
86 3300005330 Ga0070690_100027814 Ga0070690_1000278145 174
87 3300005331 Ga0070670_100002170 Ga0070670_10000217012 174
88 3300005331 Ga0070670_100272963 Ga0070670_1002729631 174
89 3300005331 Ga0070670_100293206 Ga0070670_1002932062 174
90 3300005333 Ga0070677_10038677 Ga0070677_100386772 174
91 3300005334 Ga0068869_100111168 Ga0068869_1001111682 174
92 3300005337 Ga0070682_100141832 Ga0070682_1001418323 174
93 3300005338 Ga0068868_100095274 Ga0068868_1000952742 174
94 3300005338 Ga0068868_100457530 Ga0068868_1004575302 174
95 3300005339 Ga0070660_100141365 Ga0070660_1001413651 174
96 3300005339 Ga0070660_100159886 Ga0070660_1001598863 174
97 3300005340 Ga0070689_100210830 Ga0070689_1002108302 174
98 3300005341 Ga0070691_10000560 Ga0070691_100005607 174
99 3300005344 Ga0070661_100007680 Ga0070661_1000076807 174
100 3300005344 Ga0070661_100125390 Ga0070661_1001253903 174
101 3300005344 Ga0070661_100233187 Ga0070661_1002331871 174
102 3300005344 Ga0070661_100380967 Ga0070661_1003809672 174
103 3300005347 Ga0070668_100006667 Ga0070668_10000666712 174
104 3300005347 Ga0070668_100224390 Ga0070668_1002243902 174
105 3300005353 Ga0070669_100581819 Ga0070669_1005818192 174
106 3300005353 Ga0070669_100742526 Ga0070669_1007425261 174
107 3300005354 Ga0070675_100077954 Ga0070675_1000779542 174
108 3300005354 Ga0070675_100300877 Ga0070675_1003008773 174
109 3300005354 Ga0070675_100483528 Ga0070675_1004835282 174
110 3300005355 Ga0070671_100009661 Ga0070671_1000096613 174
111 3300005356 Ga0070674_100354333 Ga0070674_1003543332 174
112 3300005356 Ga0070674_100569014 Ga0070674_1005690142 174
113 3300005364 Ga0070673_100142643 Ga0070673_1001426432 174
114 3300005366 Ga0070659_100004103 Ga0070659_1000041034 174
115 3300005367 Ga0070667_100186221 Ga0070667_1001862213 174
116 3300005367 Ga0070667_100744847 Ga0070667_1007448471 174
117 3300005435 Ga0070714_101445944 Ga0070714_1014459441 174
118 3300005445 Ga0070708_100181564 Ga0070708_1001815641 174
119 3300005455 Ga0070663_100017194 Ga0070663_1000171941 174
120 3300005456 Ga0070678_100258228 Ga0070678_1002582282 174
121 3300005457 Ga0070662_100002461 Ga0070662_1000024617 174
122 3300005457 Ga0070662_100899317 Ga0070662_1008993171 174
123 3300005458 Ga0070681_10557053 Ga0070681_105570532 174
124 3300005459 Ga0068867_100105023 Ga0068867_1001050232 174
125 3300005459 Ga0068867_101087453 Ga0068867_1010874531 174
126 3300005471 Ga0070698_100128563 Ga0070698_1001285634 174
127 3300005518 Ga0070699_100242117 Ga0070699_1002421172 174
128 3300005518 Ga0070699_100427382 Ga0070699_1004273821 174
129 3300005530 Ga0070679_100049825 Ga0070679_1000498253 174
130 3300005530 Ga0070679_100267571 Ga0070679_1002675712 174
131 3300005530 Ga0070679_100393518 Ga0070679_1003935181 174
132 3300005530 Ga0070679_100779695 Ga0070679_1007796951 174
133 3300005535 Ga0070684_100005156 Ga0070684_10000515611 174
134 3300005535 Ga0070684_100005806 Ga0070684_1000058066 174
135 3300005535 Ga0070684_100020454 Ga0070684_1000204545 174
136 3300005535 Ga0070684_100049809 Ga0070684_1000498094 174
137 3300005535 Ga0070684_100261698 Ga0070684_1002616982 174
138 3300005535 Ga0070684_100662339 Ga0070684_1006623392 174
139 3300005535 Ga0070684_101129317 Ga0070684_1011293171 174
140 3300005543 Ga0070672_100323481 Ga0070672_1003234812 174
141 3300005543 Ga0070672_100453468 Ga0070672_1004534682 174
142 3300005548 Ga0070665_100104416 Ga0070665_1001044163 174
143 3300005549 Ga0070704_100109581 Ga0070704_1001095814 174
144 3300005563 Ga0068855_100375026 Ga0068855_1003750261 174
145 3300005564 Ga0070664_100027111 Ga0070664_1000271112 174
146 3300005564 Ga0070664_100039316 Ga0070664_1000393163 174
147 3300005564 Ga0070664_100070093 Ga0070664_1000700932 174
148 3300005564 Ga0070664_100115841 Ga0070664_1001158413 174
149 3300005564 Ga0070664_100370151 Ga0070664_1003701512 174
150 3300005577 Ga0068857_100003022 Ga0068857_10000302218 174
151 3300005577 Ga0068857_100232058 Ga0068857_1002320582 174
152 3300005614 Ga0068856_100278411 Ga0068856_1002784112 174
153 3300005614 Ga0068856_100535653 Ga0068856_1005356532 174
154 3300005614 Ga0068856_101721755 Ga0068856_1017217552 174
155 3300005615 Ga0070702_100736183 Ga0070702_1007361832 174
156 3300005616 Ga0068852_100164659 Ga0068852_1001646592 174
157 3300005617 Ga0068859_100181302 Ga0068859_1001813023 174
158 3300005617 Ga0068859_100204627 Ga0068859_1002046272 174
159 3300005618 Ga0068864_100016185 Ga0068864_1000161855 174
160 3300005618 Ga0068864_100047560 Ga0068864_1000475603 174
161 3300005618 Ga0068864_100089087 Ga0068864_1000890873 174
162 3300005618 Ga0068864_100397769 Ga0068864_1003977692 174
163 3300005618 Ga0068864_100963564 Ga0068864_1009635642 174
164 3300005618 Ga0068864_101406130 Ga0068864_1014061301 174
165 3300005719 Ga0068861_100068587 Ga0068861_1000685873 174
166 3300005719 Ga0068861_100129627 Ga0068861_1001296272 174
167 3300005840 Ga0068870_10028020 Ga0068870_100280204 174
168 3300005840 Ga0068870_10494073 Ga0068870_104940731 174
169 3300005841 Ga0068863_100184668 Ga0068863_1001846683 174
170 3300005841 Ga0068863_100257536 Ga0068863_1002575362 174
171 3300005843 Ga0068860_100139902 Ga0068860_1001399022 174
172 3300005843 Ga0068860_100463658 Ga0068860_1004636581 174
173 3300005844 Ga0068862_100485535 Ga0068862_1004855352 174
174 3300005985 Ga0081539_10001600 Ga0081539_1000160013 174
175 3300006163 Ga0070715_10269110 Ga0070715_102691102 174
176 3300006237 Ga0097621_100033298 Ga0097621_1000332982 174
177 3300006844 Ga0075428_100009929 Ga0075428_1000099295 174
178 3300006852 Ga0075433_10480487 Ga0075433_104804871 174
179 3300006881 Ga0068865_100090455 Ga0068865_1000904553 174
180 3300006931 Ga0097620_100181301 Ga0097620_1001813013 174
181 3300006931 Ga0097620_100204640 Ga0097620_1002046402 174
182 3300007265 Ga0099794_10224271 Ga0099794_102242711 174
183 3300009094 Ga0111539_10001049 Ga0111539_1000104945 174
184 3300009094 Ga0111539_10013647 Ga0111539_100136472 174
185 3300009094 Ga0111539_10090086 Ga0111539_100900862 174
186 3300009094 Ga0111539_10149946 Ga0111539_101499463 174
187 3300009094 Ga0111539_11389540 Ga0111539_113895402 174
188 3300009098 Ga0105245_10022952 Ga0105245_100229524 174
189 3300009098 Ga0105245_10356606 Ga0105245_103566063 174
190 3300009098 Ga0105245_11400666 Ga0105245_114006661 174
191 3300009101 Ga0105247_10153104 Ga0105247_101531042 174
192 3300009147 Ga0114129_10134377 Ga0114129_101343772 174
193 3300009147 Ga0114129_10338452 Ga0114129_103384522 174
194 3300009147 Ga0114129_11798353 Ga0114129_117983532 174
195 3300009148 Ga0105243_10488330 Ga0105243_104883301 174
196 3300009148 Ga0105243_10756556 Ga0105243_107565562 174
197 3300009174 Ga0105241_10061296 Ga0105241_100612965 174
198 3300009174 Ga0105241_10430820 Ga0105241_104308202 174
199 3300009174 Ga0105241_10472488 Ga0105241_104724882 174
200 3300009176 Ga0105242_10018377 Ga0105242_100183772 174
201 3300009176 Ga0105242_10021360 Ga0105242_100213605 174
202 3300009176 Ga0105242_10067419 Ga0105242_100674192 174
203 3300009176 Ga0105242_10649427 Ga0105242_106494271 174
204 3300009177 Ga0105248_10220738 Ga0105248_102207382 174
205 3300009177 Ga0105248_10299129 Ga0105248_102991293 174
206 3300009177 Ga0105248_10312061 Ga0105248_103120611 174
207 3300009177 Ga0105248_10502327 Ga0105248_105023272 174
208 3300009177 Ga0105248_10834999 Ga0105248_108349992 174
209 3300009177 Ga0105248_11229560 Ga0105248_112295601 174
210 3300009177 Ga0105248_11674710 Ga0105248_116747102 174
211 3300009551 Ga0105238_10000225 Ga0105238_1000022542 174
212 3300009551 Ga0105238_10009656 Ga0105238_100096565 174
213 3300009551 Ga0105238_10024744 Ga0105238_100247445 174
214 3300010375 Ga0105239_10064670 Ga0105239_100646704 174
215 3300011119 Ga0105246_10143008 Ga0105246_101430082 174
216 3300011119 Ga0105246_11237146 Ga0105246_112371461 174
217 3300013100 Ga0157373_10152250 Ga0157373_101522502 174
218 3300013102 Ga0157371_10006495 Ga0157371_100064956 174
219 3300013104 Ga0157370_10290574 Ga0157370_102905742 174
220 3300013104 Ga0157370_10926687 Ga0157370_109266872 174
221 3300013105 Ga0157369_10178607 Ga0157369_101786073 174
222 3300013105 Ga0157369_10511127 Ga0157369_105111272 174
223 3300013105 Ga0157369_10748441 Ga0157369_107484411 174
224 3300013105 Ga0157369_10956273 Ga0157369_109562731 174
225 3300013105 Ga0157369_11323052 Ga0157369_113230521 174
226 3300013296 Ga0157374_10009184 Ga0157374_100091842 174
227 3300013296 Ga0157374_10099399 Ga0157374_100993991 174
228 3300013297 Ga0157378_10231349 Ga0157378_102313492 174
229 3300013297 Ga0157378_10248288 Ga0157378_102482881 174
230 3300013297 Ga0157378_10591813 Ga0157378_105918131 174
231 3300013306 Ga0163162_10087820 Ga0163162_100878202 174
232 3300013306 Ga0163162_10192326 Ga0163162_101923263 174
233 3300013306 Ga0163162_11036873 Ga0163162_110368732 174
234 3300013307 Ga0157372_10014061 Ga0157372_100140614 174
235 3300013307 Ga0157372_10053394 Ga0157372_100533942 174
236 3300013307 Ga0157372_10157673 Ga0157372_101576734 174
237 3300013307 Ga0157372_10202493 Ga0157372_102024932 174
238 3300013307 Ga0157372_10413778 Ga0157372_104137782 174
239 3300013307 Ga0157372_10769265 Ga0157372_107692652 174
240 3300013307 Ga0157372_10968926 Ga0157372_109689261 174
241 3300013308 Ga0157375_10095014 Ga0157375_100950143 174
242 3300013308 Ga0157375_10134168 Ga0157375_101341682 174
243 3300013308 Ga0157375_10914018 Ga0157375_109140182 174
244 3300013308 Ga0157375_11454701 Ga0157375_114547011 174
245 3300013308 Ga0157375_11730116 Ga0157375_117301162 174
246 3300014325 Ga0163163_10177062 Ga0163163_101770622 174
247 3300014325 Ga0163163_10318560 Ga0163163_103185602 174
248 3300014325 Ga0163163_10538062 Ga0163163_105380622 174
249 3300014326 Ga0157380_10027225 Ga0157380_100272254 174
250 3300014745 Ga0157377_10061572 Ga0157377_100615723 174
251 3300014968 Ga0157379_10760321 Ga0157379_107603212 174
252 3300014968 Ga0157379_11060168 Ga0157379_110601682 174
253 3300014969 Ga0157376_10181388 Ga0157376_101813882 174
254 3300015262 Ga0182007_10014049 Ga0182007_100140492 174
255 3300017792 Ga0163161_10059121 Ga0163161_100591213 174
256 3300025735 Ga0207713_1193309 Ga0207713_11933091 174
257 3300025893 Ga0207682_10014497 Ga0207682_100144972 174
258 3300025904 Ga0207647_10152364 Ga0207647_101523642 174
259 3300025907 Ga0207645_10065419 Ga0207645_100654192 174
260 3300025907 Ga0207645_10070511 Ga0207645_100705113 174
261 3300025907 Ga0207645_10091116 Ga0207645_100911163 174
262 3300025908 Ga0207643_10296650 Ga0207643_102966502 174
263 3300025909 Ga0207705_10045525 Ga0207705_100455254 174
264 3300025909 Ga0207705_10119112 Ga0207705_101191122 174
265 3300025911 Ga0207654_10280338 Ga0207654_102803382 174
266 3300025911 Ga0207654_10430038 Ga0207654_104300381 174
267 3300025912 Ga0207707_10044048 Ga0207707_100440484 174
268 3300025912 Ga0207707_10340842 Ga0207707_103408422 174
269 3300025912 Ga0207707_10845772 Ga0207707_108457721 174
270 3300025913 Ga0207695_10003493 Ga0207695_100034937 174
271 3300025913 Ga0207695_10221269 Ga0207695_102212691 174
272 3300025918 Ga0207662_10389046 Ga0207662_103890461 174
273 3300025919 Ga0207657_10036831 Ga0207657_100368313 174
274 3300025920 Ga0207649_10012635 Ga0207649_100126354 174
275 3300025920 Ga0207649_10052574 Ga0207649_100525744 174
276 3300025920 Ga0207649_10129597 Ga0207649_101295973 174
277 3300025921 Ga0207652_10184775 Ga0207652_101847753 174
278 3300025921 Ga0207652_10191968 Ga0207652_101919682 174
279 3300025921 Ga0207652_10196263 Ga0207652_101962632 174
280 3300025921 Ga0207652_10237392 Ga0207652_102373923 174
281 3300025923 Ga0207681_10197745 Ga0207681_101977452 174
282 3300025923 Ga0207681_10545242 Ga0207681_105452422 174
283 3300025924 Ga0207694_10000013 Ga0207694_10000013268 174
284 3300025924 Ga0207694_10139648 Ga0207694_101396482 174
285 3300025925 Ga0207650_10016951 Ga0207650_100169514 174
286 3300025925 Ga0207650_10134000 Ga0207650_101340002 174
287 3300025925 Ga0207650_10217429 Ga0207650_102174292 174
288 3300025926 Ga0207659_10113034 Ga0207659_101130343 174
289 3300025926 Ga0207659_10906919 Ga0207659_109069192 174
290 3300025927 Ga0207687_10095326 Ga0207687_100953262 174
291 3300025931 Ga0207644_10129932 Ga0207644_101299322 174
292 3300025932 Ga0207690_10033208 Ga0207690_100332081 174
293 3300025933 Ga0207706_10000223 Ga0207706_1000022370 174
294 3300025933 Ga0207706_10030153 Ga0207706_100301534 174
295 3300025934 Ga0207686_10023738 Ga0207686_100237383 174
296 3300025934 Ga0207686_10025077 Ga0207686_100250773 174
297 3300025934 Ga0207686_10555328 Ga0207686_105553281 174
298 3300025936 Ga0207670_10213543 Ga0207670_102135432 174
299 3300025936 Ga0207670_10229625 Ga0207670_102296252 174
300 3300025937 Ga0207669_10245811 Ga0207669_102458112 174
301 3300025938 Ga0207704_10973523 Ga0207704_109735231 174
302 3300025940 Ga0207691_10098564 Ga0207691_100985642 174
303 3300025940 Ga0207691_10134566 Ga0207691_101345662 174
304 3300025941 Ga0207711_10126884 Ga0207711_101268842 174
305 3300025941 Ga0207711_10368378 Ga0207711_103683782 174
306 3300025941 Ga0207711_10371449 Ga0207711_103714491 174
307 3300025941 Ga0207711_10883484 Ga0207711_108834841 174
308 3300025942 Ga0207689_10324347 Ga0207689_103243472 174
309 3300025944 Ga0207661_10000364 Ga0207661_100003648 174
310 3300025944 Ga0207661_10005648 Ga0207661_100056486 174
311 3300025944 Ga0207661_10024755 Ga0207661_100247553 174
312 3300025944 Ga0207661_10099719 Ga0207661_100997194 174
313 3300025944 Ga0207661_10138260 Ga0207661_101382602 174
314 3300025944 Ga0207661_10218605 Ga0207661_102186051 174
315 3300025944 Ga0207661_10559704 Ga0207661_105597042 174
316 3300025945 Ga0207679_10814280 Ga0207679_108142802 174
317 3300025949 Ga0207667_10033553 Ga0207667_100335532 174
318 3300025949 Ga0207667_10198330 Ga0207667_101983302 174
319 3300025961 Ga0207712_10358563 Ga0207712_103585632 174
320 3300025972 Ga0207668_10148917 Ga0207668_101489172 174
321 3300025972 Ga0207668_10547989 Ga0207668_105479892 174
322 3300025981 Ga0207640_10004904 Ga0207640_100049046 174
323 3300025986 Ga0207658_10753142 Ga0207658_107531422 174
324 3300026035 Ga0207703_10207465 Ga0207703_102074652 174
325 3300026035 Ga0207703_10836742 Ga0207703_108367421 174
326 3300026067 Ga0207678_10000621 Ga0207678_1000062126 174
327 3300026075 Ga0207708_11596906 Ga0207708_115969061 174
328 3300026078 Ga0207702_10151806 Ga0207702_101518062 174
329 3300026078 Ga0207702_11266356 Ga0207702_112663561 174
330 3300026088 Ga0207641_10233715 Ga0207641_102337151 174
331 3300026089 Ga0207648_10008371 Ga0207648_100083716 174
332 3300026089 Ga0207648_10176427 Ga0207648_101764272 174
333 3300026095 Ga0207676_10001991 Ga0207676_1000199113 174
334 3300026095 Ga0207676_10163976 Ga0207676_101639762 174
335 3300026095 Ga0207676_10215105 Ga0207676_102151052 174
336 3300026095 Ga0207676_10304519 Ga0207676_103045192 174
337 3300026095 Ga0207676_10381946 Ga0207676_103819462 174
338 3300026095 Ga0207676_10906355 Ga0207676_109063552 174
339 3300026116 Ga0207674_10002317 Ga0207674_1000231711 174
340 3300026116 Ga0207674_10046996 Ga0207674_100469964 174
341 3300026116 Ga0207674_10071495 Ga0207674_100714953 174
342 3300026118 Ga0207675_100073068 Ga0207675_1000730686 174
343 3300026121 Ga0207683_11000012 Ga0207683_110000121 174
344 3300026142 Ga0207698_10128892 Ga0207698_101288922 174
345 3300027471 Ga0209995_1019361 Ga0209995_10193611 174
346 3300027543 Ga0209999_1002986 Ga0209999_10029862 174
347 3300028379 Ga0268266_10149480 Ga0268266_101494802 174
348 3300030745 Ga0316182_1262167 Ga0316182_12621672 174
349 3300031238 Ga0265332_10053275 Ga0265332_100532752 174
350 3300031241 Ga0265325_10393912 Ga0265325_103939121 174
351 3300031251 Ga0265327_10019927 Ga0265327_100199274 174
352 3300031548 Ga0307408_100018775 Ga0307408_1000187753 174
353 3300031548 Ga0307408_100129201 Ga0307408_1001292012 174
354 3300031548 Ga0307408_100154980 Ga0307408_1001549802 174
355 3300031548 Ga0307408_100291302 Ga0307408_1002913023 174
356 3300031548 Ga0307408_100423994 Ga0307408_1004239942 174
357 3300031548 Ga0307408_100817917 Ga0307408_1008179171 174
358 3300031711 Ga0265314_10016381 Ga0265314_1001638110 174
359 3300031731 Ga0307405_10016104 Ga0307405_100161043 174
360 3300031731 Ga0307405_10286968 Ga0307405_102869681 174
361 3300031824 Ga0307413_10010803 Ga0307413_100108036 174
362 3300031824 Ga0307413_10034748 Ga0307413_100347483 174
363 3300031824 Ga0307413_10936222 Ga0307413_109362222 174
364 3300031852 Ga0307410_10027268 Ga0307410_100272685 174
365 3300031901 Ga0307406_10013118 Ga0307406_100131186 174
366 3300031901 Ga0307406_10051007 Ga0307406_100510073 174
367 3300031901 Ga0307406_10308108 Ga0307406_103081082 174
368 3300031901 Ga0307406_10464056 Ga0307406_104640562 174
369 3300031903 Ga0307407_10002325 Ga0307407_100023251 174
370 3300031903 Ga0307407_10003498 Ga0307407_100034986 174
371 3300031903 Ga0307407_10017929 Ga0307407_100179293 174
372 3300031903 Ga0307407_10155397 Ga0307407_101553971 174
373 3300031903 Ga0307407_10494691 Ga0307407_104946912 174
374 3300031903 Ga0307407_10520521 Ga0307407_105205211 174
375 3300031903 Ga0307407_11171608 Ga0307407_111716081 174
376 3300031911 Ga0307412_10020524 Ga0307412_100205246 174
377 3300031911 Ga0307412_10049644 Ga0307412_100496443 174
378 3300031911 Ga0307412_10130958 Ga0307412_101309582 174
379 3300031995 Ga0307409_100013660 Ga0307409_1000136605 174
380 3300031995 Ga0307409_100017769 Ga0307409_1000177696 174
381 3300031995 Ga0307409_100109565 Ga0307409_1001095653 174
382 3300031995 Ga0307409_100170214 Ga0307409_1001702141 174
383 3300031995 Ga0307409_100248698 Ga0307409_1002486981 174
384 3300031995 Ga0307409_100268240 Ga0307409_1002682402 174
385 3300031995 Ga0307409_100429244 Ga0307409_1004292442 174
386 3300031995 Ga0307409_100522784 Ga0307409_1005227842 174
387 3300031995 Ga0307409_101290497 Ga0307409_1012904972 174
388 3300032002 Ga0307416_100003107 Ga0307416_1000031078 174
389 3300032002 Ga0307416_100005086 Ga0307416_1000050867 174
390 3300032002 Ga0307416_100328177 Ga0307416_1003281773 174
391 3300032002 Ga0307416_101127697 Ga0307416_1011276972 174
392 3300032002 Ga0307416_101571810 Ga0307416_1015718102 174
393 3300032002 Ga0307416_101577074 Ga0307416_1015770741 174
394 3300032004 Ga0307414_10040985 Ga0307414_100409852 174
395 3300032004 Ga0307414_10053418 Ga0307414_100534183 174
396 3300032004 Ga0307414_11158472 Ga0307414_111584721 174
397 3300032005 Ga0307411_10166042 Ga0307411_101660421 174
398 3300032005 Ga0307411_10220696 Ga0307411_102206963 174
399 3300032005 Ga0307411_10778956 Ga0307411_107789562 174
400 3300032005 Ga0307411_10845346 Ga0307411_108453462 174
401 3300032005 Ga0307411_10869913 Ga0307411_108699132 174
402 3300032126 Ga0307415_100005994 Ga0307415_1000059946 174
403 3300032126 Ga0307415_100086067 Ga0307415_1000860673 174
404 3300032126 Ga0307415_100283800 Ga0307415_1002838002 174
405 3300032126 Ga0307415_100398539 Ga0307415_1003985392 174
406 3300032126 Ga0307415_100634391 Ga0307415_1006343911 174
407 3300035086 Ga0373934_0060679 Ga0373934_0060679_209_733 174
408 3300035088 Ga0373940_0095668 Ga0373940_0095668_131_655 174
409 3300035090 Ga0373949_0071929 Ga0373949_0071929_10_630 174
410 3300035111 Ga0373923_0127279 Ga0373923_0127279_377_901 174
411 3300035113 Ga0373936_0080587 Ga0373936_0080587_119_643 174
412 3300035117 Ga0373953_0054815 Ga0373953_0054815_284_808 174
413 3300035120 Ga0373957_0388455 Ga0373957_0388455_13_537 174
414 3300035170 Ga0373943_0014633 Ga0373943_0014633_2309_2845 174
415 3300035172 Ga0373955_0040040 Ga0373955_0040040_1970_2494 174
416 3300035691 Ga0373931_0070479 Ga0373931_0070479_1019_1543 174
417 3300035691 Ga0373931_0104751 Ga0373931_0104751_575_1099 174
418 3300035695 Ga0373927_0050336 Ga0373927_0050336_823_1347 174
419 3300035724 Ga0373933_0274695 Ga0373933_0274695_502_1026 174
420 3300036401 Ga0373937_0007000 Ga0373937_0007000_7327_7851 174
421 3300036401 Ga0373937_0132304 Ga0373937_0132304_122_646 174
422 3300037068 Ga0373925_0073278 Ga0373925_0073278_1826_2350 174
423 3300037471 Ga0395905_0613972 Ga0395905_0613972_134_658 174
424 3300038443 Ga0395901_0410147 Ga0395901_0410147_799_1341 174
425 3300038443 Ga0395901_0451330 Ga0395901_0451330_101_643 174
426 3300039437 Ga0436365_0917686 Ga0436365_0917686_150_674 174
427 3300041512 Ga0451853_2262551 Ga0451853_2262551_34_558 174
428 3300042461 Ga0439460_0009970 Ga0439460_0009970_976_1500 174
429 3300042461 Ga0439460_0078994 Ga0439460_0078994_62_586 174
430 3300044684 Ga0466966_0085464 Ga0466966_0085464_474_1061 174
431 3300044693 Ga0466961_0215188 Ga0466961_0215188_215_754 174
432 3300044694 Ga0466963_0137878 Ga0466963_0137878_601_1131 174
433 3300044842 Ga0466957_0164824 Ga0466957_0164824_891_1418 174
434 3300045049 Ga0466959_0265591 Ga0466959_0265591_147_671 174
435 3300045049 Ga0466959_0306565 Ga0466959_0306565_338_865 174
436 3300045051 Ga0451576_0039022 Ga0451576_0039022_2797_3321 174
437 3300045051 Ga0451576_1191295 Ga0451576_1191295_46_576 174
438 3300045836 Ga0466958_0361278 Ga0466958_0361278_239_766 174
439 3300045976 Ga0466967_1527341 Ga0466967_1527341_38_589 174
440 3300046455 Ga0495603_0423085 Ga0495603_0423085_130_654 174
441 3300046459 Ga0495629_0066561 Ga0495629_0066561_1559_2083 174
442 3300046462 Ga0495651_0014779 Ga0495651_0014779_870_1394 174
443 3300046472 Ga0495580_0008420 Ga0495580_0008420_5951_6475 174
444 3300046473 Ga0495582_0014739 Ga0495582_0014739_1089_1613 174
445 3300046473 Ga0495582_0291760 Ga0495582_0291760_91_615 174
446 3300046477 Ga0495664_0041346 Ga0495664_0041346_698_1222 174
447 3300046477 Ga0495664_0055043 Ga0495664_0055043_618_1142 174
448 3300046499 Ga0495594_0002629 Ga0495594_0002629_5891_6415 174
449 3300046499 Ga0495594_0006066 Ga0495594_0006066_3217_3741 174
450 3300046499 Ga0495594_0088633 Ga0495594_0088633_250_774 174
451 3300046511 Ga0495608_0197555 Ga0495608_0197555_321_845 174
452 3300046516 Ga0495628_0272718 Ga0495628_0272718_194_718 174
453 3300046517 Ga0495630_0019101 Ga0495630_0019101_451_975 174
454 3300046517 Ga0495630_0135727 Ga0495630_0135727_322_846 174
455 3300046517 Ga0495630_0280285 Ga0495630_0280285_40_564 174
456 3300046517 Ga0495630_0349480 Ga0495630_0349480_28_552 174
457 3300046528 Ga0495642_0172147 Ga0495642_0172147_90_629 174
458 3300046529 Ga0495652_0120770 Ga0495652_0120770_737_1261 174
459 3300046529 Ga0495652_0308398 Ga0495652_0308398_607_1131 174
460 3300046531 Ga0495665_0015138 Ga0495665_0015138_363_887 174
461 3300046531 Ga0495665_0074893 Ga0495665_0074893_575_1111 174
462 3300046533 Ga0495640_0058754 Ga0495640_0058754_944_1468 174
463 3300046533 Ga0495640_0079215 Ga0495640_0079215_362_886 174
464 3300046533 Ga0495640_0793542 Ga0495640_0793542_15_539 174
465 3300046536 Ga0495587_0001345 Ga0495587_0001345_12055_12579 174
466 3300046536 Ga0495587_0206200 Ga0495587_0206200_567_1091 174
467 3300046543 Ga0495645_0000591 Ga0495645_0000591_10641_11165 174
468 3300046543 Ga0495645_0046224 Ga0495645_0046224_1066_1590 174
469 3300046543 Ga0495645_0144752 Ga0495645_0144752_332_856 174
470 3300046559 Ga0495667_0046495 Ga0495667_0046495_2036_2560 174
471 3300046559 Ga0495667_0088654 Ga0495667_0088654_864_1388 174
472 3300046559 Ga0495667_0122993 Ga0495667_0122993_535_1059 174
473 3300046642 Ga0495634_0028366 Ga0495634_0028366_1625_2149 174
474 3300046642 Ga0495634_0167570 Ga0495634_0167570_32_556 174
475 3300046663 Ga0495635_0094498 Ga0495635_0094498_1272_1796 174
476 3300046674 Ga0495588_0145822 Ga0495588_0145822_484_1008 174
477 3300046678 Ga0495599_0003629 Ga0495599_0003629_2429_2953 174
478 3300046679 Ga0495623_0002264 Ga0495623_0002264_7893_8417 174
479 3300046680 Ga0495646_0044425 Ga0495646_0044425_85_609 174
480 3300046680 Ga0495646_0092411 Ga0495646_0092411_924_1448 174
481 3300046683 Ga0495658_0028304 Ga0495658_0028304_1326_1850 174
482 3300046683 Ga0495658_0392431 Ga0495658_0392431_97_633 174
483 3300046689 Ga0495613_0394629 Ga0495613_0394629_329_853 174
484 3300046689 Ga0495613_0432359 Ga0495613_0432359_218_742 174
485 3300046809 Ga0495600_0040605 Ga0495600_0040605_1141_1665 174
486 3300047315 Ga0495581_0006434 Ga0495581_0006434_1485_2009 174
487 3300047315 Ga0495581_0014508 Ga0495581_0014508_3219_3755 174
488 3300047315 Ga0495581_0069314 Ga0495581_0069314_796_1332 174
489 3300047315 Ga0495581_0190631 Ga0495581_0190631_33_557 174
490 3300047317 Ga0495604_0023776 Ga0495604_0023776_4237_4761 174
491 3300047319 Ga0495674_0106773 Ga0495674_0106773_1543_2067 174
492 3300047319 Ga0495674_0126375 Ga0495674_0126375_1154_1678 174
493 3300047319 Ga0495674_0211420 Ga0495674_0211420_1054_1578 174
494 3300047320 Ga0495672_0007338 Ga0495672_0007338_1560_2084 174
495 3300047322 Ga0495680_0639940 Ga0495680_0639940_21_545 174
496 3300047444 Ga0495675_0005472 Ga0495675_0005472_2487_3011 174
497 3300047444 Ga0495675_0022368 Ga0495675_0022368_3246_3770 174
498 3300047444 Ga0495675_0067056 Ga0495675_0067056_1649_2173 174
499 3300047471 Ga0495684_0003259 Ga0495684_0003259_6976_7500 174
500 3300047471 Ga0495684_0005039 Ga0495684_0005039_5004_5528 174
501 3300047471 Ga0495684_0025296 Ga0495684_0025296_1221_1757 174
502 3300047471 Ga0495684_0041202 Ga0495684_0041202_1593_2117 174
503 3300047673 Ga0495593_0480032 Ga0495593_0480032_42_566 174
504 3300048088 Ga0495602_0003596 Ga0495602_0003596_9272_9796 174
505 3300048088 Ga0495602_0303178 Ga0495602_0303178_539_1063 174
506 3300048089 Ga0495614_0152567 Ga0495614_0152567_354_890 174
507 3300048904 Ga0496101_0662068 Ga0496101_0662068_187_711 174
508 3300048904 Ga0496101_0709850 Ga0496101_0709850_34_642 174
509 3300048907 Ga0496104_0024693 Ga0496104_0024693_291_815 174
510 3300048907 Ga0496104_0339650 Ga0496104_0339650_296_820 174
511 3300048908 Ga0496105_0308189 Ga0496105_0308189_610_1134 174
512 3300048908 Ga0496105_0406542 Ga0496105_0406542_218_742 174
513 3300048909 Ga0496106_0041635 Ga0496106_0041635_106_657 174
514 3300048911 Ga0496108_0012356 Ga0496108_0012356_625_1149 174
515 3300048911 Ga0496108_0323414 Ga0496108_0323414_722_1246 174
516 3300048912 Ga0496109_0001037 Ga0496109_0001037_21824_22348 174
517 3300048912 Ga0496109_0144307 Ga0496109_0144307_954_1478 174
518 3300048913 Ga0496110_0176244 Ga0496110_0176244_607_1131 174
519 3300048913 Ga0496110_0594054 Ga0496110_0594054_455_979 174
520 3300048913 Ga0496110_0954960 Ga0496110_0954960_147_671 174
521 3300048914 Ga0496111_0212075 Ga0496111_0212075_868_1392 174
522 3300048915 Ga0496112_0000129 Ga0496112_0000129_18419_18943 174
523 3300048915 Ga0496112_0050080 Ga0496112_0050080_1261_1785 174
524 3300048915 Ga0496112_0134629 Ga0496112_0134629_180_704 174
525 3300048915 Ga0496112_0146155 Ga0496112_0146155_497_1048 174
526 3300048915 Ga0496112_0600100 Ga0496112_0600100_451_975 174
527 3300048916 Ga0496113_0000062 Ga0496113_0000062_18075_18599 174
528 3300048916 Ga0496113_0282212 Ga0496113_0282212_128_652 174
529 3300048917 Ga0496114_1071186 Ga0496114_1071186_122_646 174
530 3300049517 Ga0501294_013978 Ga0501294_013978_259_783 174
531 3300049521 Ga0501298_004883 Ga0501298_004883_1281_1805 174
532 3300049583 Ga0501067_0151259 Ga0501067_0151259_583_1110 174
533 3300049585 Ga0501069_0314241 Ga0501069_0314241_72_599 174
534 3300049593 Ga0501077_0610395 Ga0501077_0610395_136_678 174
535 3300049660 Ga0501216_000925 Ga0501216_000925_3066_3590 174
536 3300049661 Ga0501217_002548 Ga0501217_002548_1640_2164 174
537 3300049667 Ga0501230_000515 Ga0501230_000515_1352_1876 174
538 3300049669 Ga0501235_000383 Ga0501235_000383_4766_5290 174
539 3300049672 Ga0501239_002706 Ga0501239_002706_596_1120 174
540 3300049674 Ga0501242_000318 Ga0501242_000318_1499_2023 174
541 3300049679 Ga0501249_011837 Ga0501249_011837_865_1389 174
542 3300049679 Ga0501249_029971 Ga0501249_029971_174_698 174
543 3300049681 Ga0501251_008581 Ga0501251_008581_21_545 174
544 3300049686 Ga0501257_007318 Ga0501257_007318_1297_1821 174
545 3300049687 Ga0501258_000403 Ga0501258_000403_1686_2210 174
546 3300049705 Ga0501225_0000567 Ga0501225_0000567_6040_6564 174
547 3300049707 Ga0501234_001484 Ga0501234_001484_1552_2076 174
548 3300049765 Ga0501268_000218 Ga0501268_000218_1638_2162 174
549 3300049766 Ga0501269_041133 Ga0501269_041133_36_560 174
550 3300049769 Ga0501272_000961 Ga0501272_000961_550_1074 174
551 3300049772 Ga0501275_009096 Ga0501275_009096_213_737 174
552 3300050507 nmdc:mga05p37_129673_c1 nmdc:mga05p37_129673_c1_1749_2282 174
553 3300050507 nmdc:mga05p37_1454562_c1 nmdc:mga05p37_1454562_c1_70_594 174
554 3300050507 nmdc:mga05p37_74710_c1 nmdc:mga05p37_74710_c1_669_1202 174
555 3300050508 nmdc:mga09592_43091_c1 nmdc:mga09592_43091_c1_98_631 174
556 3300050510 nmdc:mga06r32_354107_c1 nmdc:mga06r32_354107_c1_189_722 174
557 3300050511 nmdc:mga08y16_1154059_c1 nmdc:mga08y16_1154059_c1_95_619 174
558 3300050511 nmdc:mga08y16_188305_c1 nmdc:mga08y16_188305_c1_283_810 174
559 3300050511 nmdc:mga08y16_3729_c1 nmdc:mga08y16_3729_c1_523_1050 174
560 3300050511 nmdc:mga08y16_467602_c1 nmdc:mga08y16_467602_c1_654_1181 174
561 3300050512 nmdc:mga0n895_436296_c1 nmdc:mga0n895_436296_c1_144_668 174
562 3300050514 nmdc:mga08x19_5623_c1 nmdc:mga08x19_5623_c1_3096_3620 174
563 3300050515 nmdc:mga0a205_880773_c1 nmdc:mga0a205_880773_c1_157_681 174
564 3300053077 Ga0495601_0010964 Ga0495601_0010964_1404_1928 174
565 3300053077 Ga0495601_0085043 Ga0495601_0085043_246_770 174
566 3300053078 Ga0495612_0029121 Ga0495612_0029121_719_1243 174
567 3300053085 Ga0495619_0093698 Ga0495619_0093698_236_760 174
568 3300053085 Ga0495619_0099901 Ga0495619_0099901_1431_1955 174
569 3300061734 Ga0530510_0666377 Ga0530510_0666377_212_739 174

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12867

DinB_2

DinB superfamily

14

152

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.9339 1 174
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.9173 1 174
2rd9-assembly1.cif.gz_A crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.9124 1 174
2rd9-assembly3.cif.gz_B crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution 0.8976 1 174
1rxq-assembly1.cif.gz_B yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology 0.8459 2 157
ID Description Score Start End Superfamily
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.9419 1 170 1.20.120.450
2rd9B01 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8892 1 170 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.8104 2 157 1.20.120.450
1rxqD00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7575 2 157 1.20.120.450
2yqyB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain 0.7383 4 150 1.20.120.450
ID Description Score Start End GO Terms
AF-A0A2V7X7A1-F1-model_v4 DinB-like domain-containing protein 0.9989 23 172
AF-A0A2V7T694-F1-model_v4 DinB-like domain-containing protein 0.9955 23 173
AF-A0A2D6AME1-F1-model_v4 DinB-like domain-containing protein 0.9949 1 172
AF-A0A2V9UE62-F1-model_v4 DinB-like domain-containing protein 0.9949 1 142
AF-A0A2V5SA27-F1-model_v4 DinB-like domain-containing protein 0.9948 45 174

Feature Viewer

pLDDT pTM Quality
95.77 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map