F464707
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 569 | 277 | 569 | 175 |
Family's Representative Sequence
| Representative Sequence | 3300005564|Ga0070664_100423694|Ga0070664_1004236943 |
| Length | 176 |
| Sequence | MTQMDFNLDDGIAVLERTPSTLSAMLSALPNDWIDGDEGPDTWSPYVIIGHLNHGERTDWIPRAQIILAQDGRRFTPFDRFAQFEESKGKSLADLLTEFAQLRAENLSTLRGWRLTNAQLALEGEHPELGTVTLSQLLATWVGHDLGHIAQTSRVMAKQYRDAVGPWRAYLPVMDR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 3 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 6 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 12 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 31 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 38 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 48 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 54 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 55 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 56 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 65 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 69 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 95 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 153 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 154 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 155 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 156 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 157 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 158 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 159 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 160 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 161 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 162 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 163 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 164 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 165 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 166 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 170 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 172 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 173 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 175 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 176 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 177 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 180 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 181 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 182 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 186 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 187 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 188 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 189 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 190 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 191 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 192 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 193 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 194 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 195 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 196 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 235 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 236 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 237 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 238 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 240 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 241 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 242 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 243 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 244 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 245 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 246 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 251 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 252 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 253 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 254 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 255 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 256 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 258 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 259 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 260 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 261 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 262 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 263 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 264 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 265 | 3300049772 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_B_4_control | Metagenome | Rhizosphere |
| 266 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 267 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 268 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 269 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 270 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 271 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 272 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 273 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 4.04 |
| Rhizosphere | 95.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.35 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10119219 | 3300005289 | Unclassified | 1803 |
| 2 | Ga0065704_10534838 | 3300005289 | Unclassified | 645 |
| 3 | Ga0065712_10091475 | 3300005290 | Bacteria | 2371 |
| 4 | Ga0070676_10079568 | 3300005328 | Bacteria | 1985 |
| 5 | Ga0070676_10667308 | 3300005328 | Unclassified | 756 |
| 6 | Ga0070683_100002164 | 3300005329 | Bacteria | 15542 |
| 7 | Ga0070683_100027824 | 3300005329 | Bacteria | 5103 |
| 8 | Ga0070683_100105865 | 3300005329 | Bacteria | 2651 |
| 9 | Ga0070683_100439715 | 3300005329 | Unclassified | 1244 |
| 10 | Ga0070683_100838355 | 3300005329 | Unclassified | 882 |
| 11 | Ga0070683_101016963 | 3300005329 | Unclassified | 796 |
| 12 | Ga0070683_101118170 | 3300005329 | Bacteria | 757 |
| 13 | Ga0070690_100027814 | 3300005330 | Bacteria | 3498 |
| 14 | Ga0070690_100055552 | 3300005330 | Bacteria | 2536 |
| 15 | Ga0070670_100002170 | 3300005331 | Bacteria | 16123 |
| 16 | Ga0070670_100272963 | 3300005331 | Bacteria | 1476 |
| 17 | Ga0070670_100293206 | 3300005331 | Bacteria | 1422 |
| 18 | Ga0070677_10038677 | 3300005333 | Bacteria | 1868 |
| 19 | Ga0068869_100111168 | 3300005334 | Bacteria | 2085 |
| 20 | Ga0070666_10007174 | 3300005335 | Bacteria | 6871 |
| 21 | Ga0070682_100141832 | 3300005337 | Bacteria | 1639 |
| 22 | Ga0068868_100022945 | 3300005338 | Bacteria | 4718 |
| 23 | Ga0068868_100095274 | 3300005338 | Bacteria | 2402 |
| 24 | Ga0068868_100457530 | 3300005338 | Bacteria | 1111 |
| 25 | Ga0070660_100141365 | 3300005339 | Bacteria | 1931 |
| 26 | Ga0070660_100159886 | 3300005339 | Bacteria | 1815 |
| 27 | Ga0070689_100056494 | 3300005340 | Bacteria | 3043 |
| 28 | Ga0070689_100210830 | 3300005340 | Bacteria | 1590 |
| 29 | Ga0070691_10000560 | 3300005341 | Bacteria | 14136 |
| 30 | Ga0070661_100007680 | 3300005344 | Bacteria | 7447 |
| 31 | Ga0070661_100125390 | 3300005344 | Unclassified | 1926 |
| 32 | Ga0070661_100233187 | 3300005344 | Bacteria | 1415 |
| 33 | Ga0070661_100380967 | 3300005344 | Bacteria | 1112 |
| 34 | Ga0070668_100006667 | 3300005347 | Bacteria | 8556 |
| 35 | Ga0070668_100224390 | 3300005347 | Bacteria | 1551 |
| 36 | Ga0070669_100581819 | 3300005353 | Bacteria | 936 |
| 37 | Ga0070669_100742526 | 3300005353 | Unclassified | 831 |
| 38 | Ga0070675_100077954 | 3300005354 | Bacteria | 2759 |
| 39 | Ga0070675_100300877 | 3300005354 | Bacteria | 1413 |
| 40 | Ga0070675_100483528 | 3300005354 | Bacteria | 1114 |
| 41 | Ga0070671_100009661 | 3300005355 | Bacteria | 7749 |
| 42 | Ga0070671_100033598 | 3300005355 | Bacteria | 4244 |
| 43 | Ga0070674_100354333 | 3300005356 | Unclassified | 1186 |
| 44 | Ga0070674_100569014 | 3300005356 | Bacteria | 953 |
| 45 | Ga0070673_100038323 | 3300005364 | Bacteria | 3660 |
| 46 | Ga0070673_100142643 | 3300005364 | Bacteria | 2022 |
| 47 | Ga0070659_100004103 | 3300005366 | Bacteria | 10380 |
| 48 | Ga0070667_100022071 | 3300005367 | Bacteria | 5281 |
| 49 | Ga0070667_100186221 | 3300005367 | Bacteria | 1837 |
| 50 | Ga0070667_100744847 | 3300005367 | Unclassified | 908 |
| 51 | Ga0070714_101445944 | 3300005435 | Bacteria | 671 |
| 52 | Ga0070708_100181564 | 3300005445 | Bacteria | 1967 |
| 53 | Ga0070663_100017194 | 3300005455 | Bacteria | 4714 |
| 54 | Ga0070678_100258228 | 3300005456 | Bacteria | 1464 |
| 55 | Ga0070662_100002461 | 3300005457 | Bacteria | 11407 |
| 56 | Ga0070662_100298909 | 3300005457 | Bacteria | 1307 |
| 57 | Ga0070662_100899317 | 3300005457 | Bacteria | 755 |
| 58 | Ga0070681_10557053 | 3300005458 | Unclassified | 1060 |
| 59 | Ga0068867_100105023 | 3300005459 | Bacteria | 2163 |
| 60 | Ga0068867_101087453 | 3300005459 | Unclassified | 729 |
| 61 | Ga0070685_10078664 | 3300005466 | Bacteria | 1972 |
| 62 | Ga0070707_100749020 | 3300005468 | Bacteria | 940 |
| 63 | Ga0070698_100128563 | 3300005471 | Bacteria | 2489 |
| 64 | Ga0070699_100242117 | 3300005518 | Bacteria | 1610 |
| 65 | Ga0070699_100427382 | 3300005518 | Unclassified | 1199 |
| 66 | Ga0070679_100049825 | 3300005530 | Bacteria | 4172 |
| 67 | Ga0070679_100267571 | 3300005530 | Unclassified | 1664 |
| 68 | Ga0070679_100393518 | 3300005530 | Bacteria | 1332 |
| 69 | Ga0070679_100779695 | 3300005530 | Unclassified | 899 |
| 70 | Ga0070684_100005156 | 3300005535 | Bacteria | 9989 |
| 71 | Ga0070684_100005806 | 3300005535 | Bacteria | 9492 |
| 72 | Ga0070684_100019205 | 3300005535 | Bacteria | 5651 |
| 73 | Ga0070684_100020454 | 3300005535 | Bacteria | 5491 |
| 74 | Ga0070684_100049809 | 3300005535 | Bacteria | 3637 |
| 75 | Ga0070684_100261698 | 3300005535 | Bacteria | 1583 |
| 76 | Ga0070684_100662339 | 3300005535 | Bacteria | 972 |
| 77 | Ga0070684_101129317 | 3300005535 | Unclassified | 737 |
| 78 | Ga0068853_100877614 | 3300005539 | Bacteria | 861 |
| 79 | Ga0070672_100211026 | 3300005543 | Bacteria | 1626 |
| 80 | Ga0070672_100323481 | 3300005543 | Bacteria | 1311 |
| 81 | Ga0070672_100453468 | 3300005543 | Bacteria | 1105 |
| 82 | Ga0070686_100086618 | 3300005544 | Bacteria | 2086 |
| 83 | Ga0070693_100520887 | 3300005547 | Unclassified | 846 |
| 84 | Ga0070665_100104416 | 3300005548 | Bacteria | 2836 |
| 85 | Ga0070704_100109581 | 3300005549 | Bacteria | 2098 |
| 86 | Ga0068855_100375026 | 3300005563 | Bacteria | 1563 |
| 87 | Ga0070664_100027111 | 3300005564 | Bacteria | 4760 |
| 88 | Ga0070664_100039316 | 3300005564 | Bacteria | 3986 |
| 89 | Ga0070664_100070093 | 3300005564 | Bacteria | 3002 |
| 90 | Ga0070664_100079878 | 3300005564 | Bacteria | 2816 |
| 91 | Ga0070664_100115841 | 3300005564 | Unclassified | 2343 |
| 92 | Ga0070664_100217138 | 3300005564 | Bacteria | 1710 |
| 93 | Ga0070664_100370151 | 3300005564 | Bacteria | 1306 |
| 94 | Ga0070664_100423694 | 3300005564 | Bacteria | 1219 |
| 95 | Ga0068857_100003022 | 3300005577 | Bacteria | 13897 |
| 96 | Ga0068857_100232058 | 3300005577 | Bacteria | 1688 |
| 97 | Ga0068854_100703664 | 3300005578 | Unclassified | 872 |
| 98 | Ga0068856_100278411 | 3300005614 | Bacteria | 1690 |
| 99 | Ga0068856_100535653 | 3300005614 | Bacteria | 1192 |
| 100 | Ga0068856_101369250 | 3300005614 | Unclassified | 722 |
| 101 | Ga0068856_101721755 | 3300005614 | Bacteria | 639 |
| 102 | Ga0070702_100005647 | 3300005615 | Bacteria | 5853 |
| 103 | Ga0070702_100736183 | 3300005615 | Bacteria | 755 |
| 104 | Ga0068852_100141538 | 3300005616 | Bacteria | 2227 |
| 105 | Ga0068852_100164659 | 3300005616 | Bacteria | 2074 |
| 106 | Ga0068859_100098340 | 3300005617 | Bacteria | 2980 |
| 107 | Ga0068859_100181302 | 3300005617 | Bacteria | 2189 |
| 108 | Ga0068859_100204627 | 3300005617 | Bacteria | 2059 |
| 109 | Ga0068864_100016185 | 3300005618 | Bacteria | 6207 |
| 110 | Ga0068864_100047560 | 3300005618 | Unclassified | 3685 |
| 111 | Ga0068864_100089087 | 3300005618 | Bacteria | 2719 |
| 112 | Ga0068864_100257410 | 3300005618 | Bacteria | 1622 |
| 113 | Ga0068864_100397769 | 3300005618 | Bacteria | 1309 |
| 114 | Ga0068864_100963564 | 3300005618 | Bacteria | 845 |
| 115 | Ga0068864_101406130 | 3300005618 | Unclassified | 699 |
| 116 | Ga0068861_100068587 | 3300005719 | Bacteria | 2741 |
| 117 | Ga0068861_100129627 | 3300005719 | Bacteria | 2046 |
| 118 | Ga0068851_10118174 | 3300005834 | Bacteria | 1422 |
| 119 | Ga0068870_10028020 | 3300005840 | Bacteria | 2824 |
| 120 | Ga0068870_10494073 | 3300005840 | Unclassified | 814 |
| 121 | Ga0068863_100103551 | 3300005841 | Bacteria | 2707 |
| 122 | Ga0068863_100184668 | 3300005841 | Unclassified | 2002 |
| 123 | Ga0068863_100257536 | 3300005841 | Bacteria | 1686 |
| 124 | Ga0068858_100120296 | 3300005842 | Bacteria | 2455 |
| 125 | Ga0068860_100007345 | 3300005843 | Bacteria | 11015 |
| 126 | Ga0068860_100139902 | 3300005843 | Bacteria | 2326 |
| 127 | Ga0068860_100463658 | 3300005843 | Bacteria | 1261 |
| 128 | Ga0068862_100485535 | 3300005844 | Bacteria | 1170 |
| 129 | Ga0081539_10001600 | 3300005985 | Bacteria | 37341 |
| 130 | Ga0070715_10269110 | 3300006163 | Unclassified | 898 |
| 131 | Ga0097621_100020459 | 3300006237 | Bacteria | 5099 |
| 132 | Ga0097621_100033298 | 3300006237 | Unclassified | 4102 |
| 133 | Ga0068871_100079922 | 3300006358 | Bacteria | 2706 |
| 134 | Ga0075428_100009929 | 3300006844 | Bacteria | 10573 |
| 135 | Ga0075428_100119062 | 3300006844 | Bacteria | 2875 |
| 136 | Ga0075433_10480487 | 3300006852 | Bacteria | 1095 |
| 137 | Ga0075429_100373546 | 3300006880 | Unclassified | 1248 |
| 138 | Ga0068865_100014306 | 3300006881 | Bacteria | 5039 |
| 139 | Ga0068865_100090455 | 3300006881 | Bacteria | 2219 |
| 140 | Ga0097620_100098349 | 3300006931 | Bacteria | 2980 |
| 141 | Ga0097620_100181301 | 3300006931 | Bacteria | 2189 |
| 142 | Ga0097620_100204640 | 3300006931 | Bacteria | 2059 |
| 143 | Ga0099794_10224271 | 3300007265 | Bacteria | 966 |
| 144 | Ga0111539_10001049 | 3300009094 | Bacteria | 36370 |
| 145 | Ga0111539_10013647 | 3300009094 | Bacteria | 10147 |
| 146 | Ga0111539_10090086 | 3300009094 | Unclassified | 3605 |
| 147 | Ga0111539_10149946 | 3300009094 | Bacteria | 2730 |
| 148 | Ga0111539_11389540 | 3300009094 | Bacteria | 814 |
| 149 | Ga0105245_10022952 | 3300009098 | Bacteria | 5475 |
| 150 | Ga0105245_10356606 | 3300009098 | Bacteria | 1450 |
| 151 | Ga0105245_11400666 | 3300009098 | Bacteria | 749 |
| 152 | Ga0105247_10153104 | 3300009101 | Unclassified | 1521 |
| 153 | Ga0114129_10134377 | 3300009147 | Bacteria | 3395 |
| 154 | Ga0114129_10338452 | 3300009147 | Unclassified | 1996 |
| 155 | Ga0114129_11798353 | 3300009147 | Unclassified | 745 |
| 156 | Ga0105243_10488330 | 3300009148 | Unclassified | 1164 |
| 157 | Ga0105243_10756556 | 3300009148 | Bacteria | 953 |
| 158 | Ga0105241_10061296 | 3300009174 | Bacteria | 2896 |
| 159 | Ga0105241_10430820 | 3300009174 | Bacteria | 1163 |
| 160 | Ga0105241_10472488 | 3300009174 | Unclassified | 1113 |
| 161 | Ga0105242_10018377 | 3300009176 | Bacteria | 5464 |
| 162 | Ga0105242_10021360 | 3300009176 | Bacteria | 5080 |
| 163 | Ga0105242_10067419 | 3300009176 | Bacteria | 2959 |
| 164 | Ga0105242_10649427 | 3300009176 | Unclassified | 1026 |
| 165 | Ga0105248_10059481 | 3300009177 | Unclassified | 4292 |
| 166 | Ga0105248_10220738 | 3300009177 | Bacteria | 2134 |
| 167 | Ga0105248_10299129 | 3300009177 | Bacteria | 1812 |
| 168 | Ga0105248_10312061 | 3300009177 | Unclassified | 1771 |
| 169 | Ga0105248_10502327 | 3300009177 | Unclassified | 1367 |
| 170 | Ga0105248_10834999 | 3300009177 | Unclassified | 1040 |
| 171 | Ga0105248_11229560 | 3300009177 | Unclassified | 847 |
| 172 | Ga0105248_11674710 | 3300009177 | Unclassified | 721 |
| 173 | Ga0105238_10000225 | 3300009551 | Bacteria | 62813 |
| 174 | Ga0105238_10009656 | 3300009551 | Bacteria | 9658 |
| 175 | Ga0105238_10024744 | 3300009551 | Bacteria | 6120 |
| 176 | Ga0105239_10064670 | 3300010375 | Bacteria | 4015 |
| 177 | Ga0105246_10143008 | 3300011119 | Bacteria | 1801 |
| 178 | Ga0105246_11237146 | 3300011119 | Bacteria | 689 |
| 179 | Ga0157373_10152250 | 3300013100 | Bacteria | 1627 |
| 180 | Ga0157371_10006495 | 3300013102 | Bacteria | 9628 |
| 181 | Ga0157370_10290574 | 3300013104 | Bacteria | 1510 |
| 182 | Ga0157370_10926687 | 3300013104 | Unclassified | 790 |
| 183 | Ga0157369_10178607 | 3300013105 | Unclassified | 2234 |
| 184 | Ga0157369_10511127 | 3300013105 | Bacteria | 1243 |
| 185 | Ga0157369_10748441 | 3300013105 | Bacteria | 1005 |
| 186 | Ga0157369_10956273 | 3300013105 | Unclassified | 878 |
| 187 | Ga0157369_11323052 | 3300013105 | Unclassified | 734 |
| 188 | Ga0157374_10009184 | 3300013296 | Bacteria | 8476 |
| 189 | Ga0157374_10099399 | 3300013296 | Unclassified | 2787 |
| 190 | Ga0157374_10142928 | 3300013296 | Bacteria | 2323 |
| 191 | Ga0157378_10231349 | 3300013297 | Bacteria | 1762 |
| 192 | Ga0157378_10248288 | 3300013297 | Unclassified | 1703 |
| 193 | Ga0157378_10591813 | 3300013297 | Bacteria | 1119 |
| 194 | Ga0163162_10087820 | 3300013306 | Unclassified | 3189 |
| 195 | Ga0163162_10192326 | 3300013306 | Unclassified | 2168 |
| 196 | Ga0163162_11036873 | 3300013306 | Bacteria | 928 |
| 197 | Ga0163162_11090697 | 3300013306 | Unclassified | 904 |
| 198 | Ga0157372_10000695 | 3300013307 | Bacteria | 36964 |
| 199 | Ga0157372_10014061 | 3300013307 | Bacteria | 8548 |
| 200 | Ga0157372_10053394 | 3300013307 | Unclassified | 4504 |
| 201 | Ga0157372_10157673 | 3300013307 | Bacteria | 2622 |
| 202 | Ga0157372_10202493 | 3300013307 | Bacteria | 2300 |
| 203 | Ga0157372_10413778 | 3300013307 | Bacteria | 1571 |
| 204 | Ga0157372_10769265 | 3300013307 | Bacteria | 1119 |
| 205 | Ga0157372_10968926 | 3300013307 | Unclassified | 986 |
| 206 | Ga0157375_10095014 | 3300013308 | Unclassified | 3051 |
| 207 | Ga0157375_10134168 | 3300013308 | Bacteria | 2598 |
| 208 | Ga0157375_10796320 | 3300013308 | Unclassified | 1094 |
| 209 | Ga0157375_10914018 | 3300013308 | Bacteria | 1021 |
| 210 | Ga0157375_11454701 | 3300013308 | Unclassified | 808 |
| 211 | Ga0157375_11730116 | 3300013308 | Bacteria | 741 |
| 212 | Ga0163163_10177062 | 3300014325 | Bacteria | 2180 |
| 213 | Ga0163163_10318560 | 3300014325 | Bacteria | 1609 |
| 214 | Ga0163163_10538062 | 3300014325 | Bacteria | 1231 |
| 215 | Ga0157380_10027225 | 3300014326 | Bacteria | 4347 |
| 216 | Ga0157377_10061572 | 3300014745 | Bacteria | 2145 |
| 217 | Ga0157379_10760321 | 3300014968 | Bacteria | 913 |
| 218 | Ga0157379_11060168 | 3300014968 | Bacteria | 775 |
| 219 | Ga0157376_10181388 | 3300014969 | Unclassified | 1925 |
| 220 | Ga0182007_10014049 | 3300015262 | Bacteria | 3033 |
| 221 | Ga0163161_10001671 | 3300017792 | Bacteria | 16268 |
| 222 | Ga0163161_10059121 | 3300017792 | Bacteria | 2787 |
| 223 | Ga0207713_1193309 | 3300025735 | Bacteria | 628 |
| 224 | Ga0207682_10014497 | 3300025893 | Unclassified | 3072 |
| 225 | Ga0207710_10069350 | 3300025900 | Bacteria | 1614 |
| 226 | Ga0207680_10015800 | 3300025903 | Bacteria | 3948 |
| 227 | Ga0207647_10152364 | 3300025904 | Bacteria | 1351 |
| 228 | Ga0207645_10065419 | 3300025907 | Bacteria | 2324 |
| 229 | Ga0207645_10070511 | 3300025907 | Bacteria | 2235 |
| 230 | Ga0207645_10091116 | 3300025907 | Bacteria | 1961 |
| 231 | Ga0207645_10391265 | 3300025907 | Unclassified | 934 |
| 232 | Ga0207643_10296650 | 3300025908 | Unclassified | 1005 |
| 233 | Ga0207705_10045525 | 3300025909 | Bacteria | 3153 |
| 234 | Ga0207705_10119112 | 3300025909 | Unclassified | 1957 |
| 235 | Ga0207654_10280338 | 3300025911 | Bacteria | 1127 |
| 236 | Ga0207654_10430038 | 3300025911 | Bacteria | 923 |
| 237 | Ga0207707_10044048 | 3300025912 | Bacteria | 3891 |
| 238 | Ga0207707_10340842 | 3300025912 | Unclassified | 1292 |
| 239 | Ga0207707_10845772 | 3300025912 | Unclassified | 760 |
| 240 | Ga0207695_10003493 | 3300025913 | Bacteria | 22094 |
| 241 | Ga0207695_10221269 | 3300025913 | Bacteria | 1800 |
| 242 | Ga0207662_10389046 | 3300025918 | Bacteria | 943 |
| 243 | Ga0207657_10036831 | 3300025919 | Bacteria | 4376 |
| 244 | Ga0207649_10012635 | 3300025920 | Bacteria | 4690 |
| 245 | Ga0207649_10052574 | 3300025920 | Bacteria | 2528 |
| 246 | Ga0207649_10129597 | 3300025920 | Unclassified | 1711 |
| 247 | Ga0207652_10184775 | 3300025921 | Unclassified | 1874 |
| 248 | Ga0207652_10191968 | 3300025921 | Unclassified | 1837 |
| 249 | Ga0207652_10196263 | 3300025921 | Unclassified | 1816 |
| 250 | Ga0207652_10237392 | 3300025921 | Bacteria | 1643 |
| 251 | Ga0207646_10551757 | 3300025922 | Bacteria | 1036 |
| 252 | Ga0207681_10197745 | 3300025923 | Bacteria | 1542 |
| 253 | Ga0207681_10545242 | 3300025923 | Bacteria | 954 |
| 254 | Ga0207694_10000013 | 3300025924 | Bacteria | 384823 |
| 255 | Ga0207694_10139648 | 3300025924 | Bacteria | 1948 |
| 256 | Ga0207650_10016951 | 3300025925 | Bacteria | 5096 |
| 257 | Ga0207650_10134000 | 3300025925 | Bacteria | 1941 |
| 258 | Ga0207650_10217429 | 3300025925 | Bacteria | 1537 |
| 259 | Ga0207659_10113034 | 3300025926 | Bacteria | 2067 |
| 260 | Ga0207659_10906919 | 3300025926 | Unclassified | 758 |
| 261 | Ga0207687_10095326 | 3300025927 | Unclassified | 2179 |
| 262 | Ga0207644_10063759 | 3300025931 | Bacteria | 2676 |
| 263 | Ga0207644_10129932 | 3300025931 | Bacteria | 1927 |
| 264 | Ga0207690_10033208 | 3300025932 | Bacteria | 3317 |
| 265 | Ga0207706_10000223 | 3300025933 | Bacteria | 62189 |
| 266 | Ga0207706_10030153 | 3300025933 | Bacteria | 4839 |
| 267 | Ga0207706_10579076 | 3300025933 | Unclassified | 965 |
| 268 | Ga0207686_10022283 | 3300025934 | Bacteria | 3647 |
| 269 | Ga0207686_10023738 | 3300025934 | Bacteria | 3544 |
| 270 | Ga0207686_10025077 | 3300025934 | Bacteria | 3464 |
| 271 | Ga0207686_10555328 | 3300025934 | Bacteria | 898 |
| 272 | Ga0207670_10025722 | 3300025936 | Bacteria | 3699 |
| 273 | Ga0207670_10213543 | 3300025936 | Bacteria | 1473 |
| 274 | Ga0207670_10229625 | 3300025936 | Bacteria | 1425 |
| 275 | Ga0207669_10245811 | 3300025937 | Bacteria | 1329 |
| 276 | Ga0207704_10014330 | 3300025938 | Bacteria | 4000 |
| 277 | Ga0207704_10973523 | 3300025938 | Unclassified | 716 |
| 278 | Ga0207691_10098564 | 3300025940 | Bacteria | 2610 |
| 279 | Ga0207691_10127741 | 3300025940 | Bacteria | 2248 |
| 280 | Ga0207691_10134566 | 3300025940 | Bacteria | 2181 |
| 281 | Ga0207711_10006772 | 3300025941 | Bacteria | 9633 |
| 282 | Ga0207711_10126884 | 3300025941 | Bacteria | 2283 |
| 283 | Ga0207711_10368378 | 3300025941 | Unclassified | 1332 |
| 284 | Ga0207711_10371449 | 3300025941 | Bacteria | 1326 |
| 285 | Ga0207711_10397968 | 3300025941 | Bacteria | 1279 |
| 286 | Ga0207711_10883484 | 3300025941 | Unclassified | 831 |
| 287 | Ga0207689_10324347 | 3300025942 | Unclassified | 1278 |
| 288 | Ga0207661_10000364 | 3300025944 | Bacteria | 29069 |
| 289 | Ga0207661_10005648 | 3300025944 | Bacteria | 8825 |
| 290 | Ga0207661_10024755 | 3300025944 | Bacteria | 4554 |
| 291 | Ga0207661_10099719 | 3300025944 | Bacteria | 2436 |
| 292 | Ga0207661_10138260 | 3300025944 | Bacteria | 2094 |
| 293 | Ga0207661_10218605 | 3300025944 | Bacteria | 1683 |
| 294 | Ga0207661_10559704 | 3300025944 | Unclassified | 1048 |
| 295 | Ga0207679_10300679 | 3300025945 | Bacteria | 1383 |
| 296 | Ga0207679_10814280 | 3300025945 | Unclassified | 852 |
| 297 | Ga0207679_11026988 | 3300025945 | Unclassified | 756 |
| 298 | Ga0207667_10033553 | 3300025949 | Bacteria | 5517 |
| 299 | Ga0207667_10198330 | 3300025949 | Bacteria | 2059 |
| 300 | Ga0207651_10876640 | 3300025960 | Bacteria | 798 |
| 301 | Ga0207712_10358563 | 3300025961 | Bacteria | 1214 |
| 302 | Ga0207668_10148917 | 3300025972 | Bacteria | 1809 |
| 303 | Ga0207668_10547989 | 3300025972 | Unclassified | 1001 |
| 304 | Ga0207640_10004904 | 3300025981 | Bacteria | 7271 |
| 305 | Ga0207658_10150105 | 3300025986 | Bacteria | 1897 |
| 306 | Ga0207658_10753142 | 3300025986 | Bacteria | 882 |
| 307 | Ga0207677_10015015 | 3300026023 | Bacteria | 4541 |
| 308 | Ga0207703_10025536 | 3300026035 | Bacteria | 4646 |
| 309 | Ga0207703_10207465 | 3300026035 | Bacteria | 1745 |
| 310 | Ga0207703_10836742 | 3300026035 | Bacteria | 880 |
| 311 | Ga0207639_10832553 | 3300026041 | Bacteria | 861 |
| 312 | Ga0207678_10000621 | 3300026067 | Bacteria | 32462 |
| 313 | Ga0207708_11596906 | 3300026075 | Bacteria | 573 |
| 314 | Ga0207702_10151806 | 3300026078 | Bacteria | 2108 |
| 315 | Ga0207702_11266356 | 3300026078 | Unclassified | 732 |
| 316 | Ga0207641_10007119 | 3300026088 | Bacteria | 9343 |
| 317 | Ga0207641_10233715 | 3300026088 | Bacteria | 1710 |
| 318 | Ga0207648_10008371 | 3300026089 | Bacteria | 10027 |
| 319 | Ga0207648_10176427 | 3300026089 | Bacteria | 1890 |
| 320 | Ga0207676_10001991 | 3300026095 | Bacteria | 14870 |
| 321 | Ga0207676_10144226 | 3300026095 | Bacteria | 2043 |
| 322 | Ga0207676_10163976 | 3300026095 | Bacteria | 1929 |
| 323 | Ga0207676_10215105 | 3300026095 | Bacteria | 1708 |
| 324 | Ga0207676_10304519 | 3300026095 | Bacteria | 1456 |
| 325 | Ga0207676_10381946 | 3300026095 | Bacteria | 1311 |
| 326 | Ga0207676_10906355 | 3300026095 | Bacteria | 865 |
| 327 | Ga0207674_10002317 | 3300026116 | Bacteria | 24108 |
| 328 | Ga0207674_10046996 | 3300026116 | Bacteria | 4428 |
| 329 | Ga0207674_10071495 | 3300026116 | Bacteria | 3486 |
| 330 | Ga0207675_100073068 | 3300026118 | Bacteria | 3208 |
| 331 | Ga0207683_11000012 | 3300026121 | Unclassified | 776 |
| 332 | Ga0207698_10128892 | 3300026142 | Bacteria | 2158 |
| 333 | Ga0207698_10467158 | 3300026142 | Unclassified | 1221 |
| 334 | Ga0209995_1019361 | 3300027471 | Bacteria | 1123 |
| 335 | Ga0209999_1002986 | 3300027543 | Bacteria | 3007 |
| 336 | Ga0268266_10149480 | 3300028379 | Bacteria | 2104 |
| 337 | Ga0268264_10010562 | 3300028381 | Bacteria | 7636 |
| 338 | Ga0316182_1262167 | 3300030745 | Bacteria | 1291 |
| 339 | Ga0265332_10053275 | 3300031238 | Bacteria | 1736 |
| 340 | Ga0265325_10393912 | 3300031241 | Bacteria | 607 |
| 341 | Ga0265327_10019927 | 3300031251 | Bacteria | 4106 |
| 342 | Ga0307408_100018775 | 3300031548 | Bacteria | 4647 |
| 343 | Ga0307408_100129201 | 3300031548 | Unclassified | 1969 |
| 344 | Ga0307408_100154980 | 3300031548 | Unclassified | 1813 |
| 345 | Ga0307408_100291302 | 3300031548 | Bacteria | 1363 |
| 346 | Ga0307408_100423994 | 3300031548 | Bacteria | 1148 |
| 347 | Ga0307408_100675926 | 3300031548 | Unclassified | 926 |
| 348 | Ga0307408_100817917 | 3300031548 | Bacteria | 847 |
| 349 | Ga0265314_10016381 | 3300031711 | Bacteria | 5855 |
| 350 | Ga0307405_10016104 | 3300031731 | Bacteria | 4068 |
| 351 | Ga0307405_10286968 | 3300031731 | Bacteria | 1242 |
| 352 | Ga0307405_11522146 | 3300031731 | Unclassified | 588 |
| 353 | Ga0307413_10010803 | 3300031824 | Bacteria | 4451 |
| 354 | Ga0307413_10034748 | 3300031824 | Bacteria | 2884 |
| 355 | Ga0307413_10098172 | 3300031824 | Bacteria | 1928 |
| 356 | Ga0307413_10936222 | 3300031824 | Bacteria | 738 |
| 357 | Ga0307410_10027268 | 3300031852 | Bacteria | 3608 |
| 358 | Ga0307410_10119582 | 3300031852 | Unclassified | 1919 |
| 359 | Ga0307410_11338445 | 3300031852 | Unclassified | 627 |
| 360 | Ga0307406_10013118 | 3300031901 | Bacteria | 4739 |
| 361 | Ga0307406_10051007 | 3300031901 | Bacteria | 2625 |
| 362 | Ga0307406_10308108 | 3300031901 | Bacteria | 1219 |
| 363 | Ga0307406_10464056 | 3300031901 | Unclassified | 1019 |
| 364 | Ga0307407_10002325 | 3300031903 | Bacteria | 7395 |
| 365 | Ga0307407_10003498 | 3300031903 | Bacteria | 6461 |
| 366 | Ga0307407_10017929 | 3300031903 | Bacteria | 3566 |
| 367 | Ga0307407_10155397 | 3300031903 | Bacteria | 1491 |
| 368 | Ga0307407_10494691 | 3300031903 | Unclassified | 895 |
| 369 | Ga0307407_10520521 | 3300031903 | Unclassified | 875 |
| 370 | Ga0307407_11171608 | 3300031903 | Unclassified | 599 |
| 371 | Ga0307412_10020524 | 3300031911 | Bacteria | 4022 |
| 372 | Ga0307412_10049644 | 3300031911 | Bacteria | 2765 |
| 373 | Ga0307412_10068467 | 3300031911 | Bacteria | 2414 |
| 374 | Ga0307412_10130958 | 3300031911 | Unclassified | 1821 |
| 375 | Ga0307409_100013660 | 3300031995 | Bacteria | 5241 |
| 376 | Ga0307409_100017769 | 3300031995 | Bacteria | 4753 |
| 377 | Ga0307409_100109565 | 3300031995 | Bacteria | 2312 |
| 378 | Ga0307409_100170214 | 3300031995 | Unclassified | 1916 |
| 379 | Ga0307409_100248698 | 3300031995 | Unclassified | 1624 |
| 380 | Ga0307409_100268240 | 3300031995 | Bacteria | 1570 |
| 381 | Ga0307409_100429244 | 3300031995 | Bacteria | 1270 |
| 382 | Ga0307409_100522784 | 3300031995 | Bacteria | 1159 |
| 383 | Ga0307409_101290497 | 3300031995 | Unclassified | 755 |
| 384 | Ga0307416_100003107 | 3300032002 | Bacteria | 9722 |
| 385 | Ga0307416_100005086 | 3300032002 | Bacteria | 8025 |
| 386 | Ga0307416_100328177 | 3300032002 | Bacteria | 1536 |
| 387 | Ga0307416_101127697 | 3300032002 | Unclassified | 889 |
| 388 | Ga0307416_101571810 | 3300032002 | Unclassified | 763 |
| 389 | Ga0307416_101577074 | 3300032002 | Bacteria | 762 |
| 390 | Ga0307416_102054559 | 3300032002 | Unclassified | 674 |
| 391 | Ga0307414_10040985 | 3300032004 | Bacteria | 3132 |
| 392 | Ga0307414_10053418 | 3300032004 | Bacteria | 2817 |
| 393 | Ga0307414_11158472 | 3300032004 | Bacteria | 715 |
| 394 | Ga0307411_10166042 | 3300032005 | Unclassified | 1659 |
| 395 | Ga0307411_10220696 | 3300032005 | Bacteria | 1470 |
| 396 | Ga0307411_10778956 | 3300032005 | Unclassified | 840 |
| 397 | Ga0307411_10845346 | 3300032005 | Bacteria | 809 |
| 398 | Ga0307411_10869913 | 3300032005 | Unclassified | 799 |
| 399 | Ga0307415_100005994 | 3300032126 | Bacteria | 6513 |
| 400 | Ga0307415_100086067 | 3300032126 | Unclassified | 2260 |
| 401 | Ga0307415_100283800 | 3300032126 | Unclassified | 1363 |
| 402 | Ga0307415_100398539 | 3300032126 | Unclassified | 1174 |
| 403 | Ga0307415_100634391 | 3300032126 | Bacteria | 955 |
| 404 | Ga0373934_0060679 | 3300035086 | Bacteria | 1506 |
| 405 | Ga0373940_0095668 | 3300035088 | Unclassified | 895 |
| 406 | Ga0373949_0071929 | 3300035090 | Bacteria | 907 |
| 407 | Ga0373923_0127279 | 3300035111 | Bacteria | 1142 |
| 408 | Ga0373936_0080587 | 3300035113 | Bacteria | 1355 |
| 409 | Ga0373953_0054815 | 3300035117 | Unclassified | 1618 |
| 410 | Ga0373957_0388455 | 3300035120 | Bacteria | 599 |
| 411 | Ga0373943_0014633 | 3300035170 | Unclassified | 3556 |
| 412 | Ga0373955_0040040 | 3300035172 | Unclassified | 2504 |
| 413 | Ga0373931_0070479 | 3300035691 | Unclassified | 1907 |
| 414 | Ga0373931_0104751 | 3300035691 | Bacteria | 1596 |
| 415 | Ga0373927_0050336 | 3300035695 | Bacteria | 2694 |
| 416 | Ga0373933_0274695 | 3300035724 | Bacteria | 1088 |
| 417 | Ga0373937_0007000 | 3300036401 | Bacteria | 9734 |
| 418 | Ga0373937_0132304 | 3300036401 | Bacteria | 2330 |
| 419 | Ga0373925_0073278 | 3300037068 | Bacteria | 2592 |
| 420 | Ga0395905_0613972 | 3300037471 | Unclassified | 989 |
| 421 | Ga0395901_0410147 | 3300038443 | Bacteria | 1391 |
| 422 | Ga0395901_0451330 | 3300038443 | Bacteria | 1315 |
| 423 | Ga0436365_0917686 | 3300039437 | Unclassified | 696 |
| 424 | Ga0451853_2262551 | 3300041512 | Bacteria | 848 |
| 425 | Ga0439460_0009970 | 3300042461 | Bacteria | 2423 |
| 426 | Ga0439460_0078994 | 3300042461 | Unclassified | 1030 |
| 427 | Ga0466966_0085464 | 3300044684 | Unclassified | 1961 |
| 428 | Ga0466961_0215188 | 3300044693 | Bacteria | 1185 |
| 429 | Ga0466963_0137878 | 3300044694 | Bacteria | 1689 |
| 430 | Ga0466957_0164824 | 3300044842 | Bacteria | 1441 |
| 431 | Ga0466959_0265591 | 3300045049 | Bacteria | 1181 |
| 432 | Ga0466959_0306565 | 3300045049 | Bacteria | 1087 |
| 433 | Ga0451576_0039022 | 3300045051 | Bacteria | 5026 |
| 434 | Ga0451576_1191295 | 3300045051 | Bacteria | 796 |
| 435 | Ga0466958_0361278 | 3300045836 | Bacteria | 935 |
| 436 | Ga0466967_1527341 | 3300045976 | Bacteria | 665 |
| 437 | Ga0495603_0423085 | 3300046455 | Unclassified | 763 |
| 438 | Ga0495629_0066561 | 3300046459 | Bacteria | 2515 |
| 439 | Ga0495651_0014779 | 3300046462 | Bacteria | 6036 |
| 440 | Ga0495580_0008420 | 3300046472 | Bacteria | 8205 |
| 441 | Ga0495582_0014739 | 3300046473 | Unclassified | 4296 |
| 442 | Ga0495582_0291760 | 3300046473 | Bacteria | 937 |
| 443 | Ga0495664_0041346 | 3300046477 | Bacteria | 2727 |
| 444 | Ga0495664_0055043 | 3300046477 | Bacteria | 2367 |
| 445 | Ga0495594_0002629 | 3300046499 | Bacteria | 9335 |
| 446 | Ga0495594_0006066 | 3300046499 | Bacteria | 6210 |
| 447 | Ga0495594_0088633 | 3300046499 | Bacteria | 1732 |
| 448 | Ga0495608_0197555 | 3300046511 | Bacteria | 1268 |
| 449 | Ga0495628_0272718 | 3300046516 | Bacteria | 1258 |
| 450 | Ga0495630_0019101 | 3300046517 | Bacteria | 5037 |
| 451 | Ga0495630_0135727 | 3300046517 | Bacteria | 1869 |
| 452 | Ga0495630_0280285 | 3300046517 | Bacteria | 1273 |
| 453 | Ga0495630_0349480 | 3300046517 | Bacteria | 1132 |
| 454 | Ga0495642_0172147 | 3300046528 | Unclassified | 941 |
| 455 | Ga0495652_0120770 | 3300046529 | Bacteria | 2090 |
| 456 | Ga0495652_0308398 | 3300046529 | Bacteria | 1148 |
| 457 | Ga0495665_0015138 | 3300046531 | Bacteria | 4156 |
| 458 | Ga0495665_0074893 | 3300046531 | Bacteria | 1782 |
| 459 | Ga0495640_0058754 | 3300046533 | Bacteria | 2622 |
| 460 | Ga0495640_0079215 | 3300046533 | Bacteria | 2188 |
| 461 | Ga0495640_0793542 | 3300046533 | Bacteria | 565 |
| 462 | Ga0495587_0001345 | 3300046536 | Bacteria | 16323 |
| 463 | Ga0495587_0206200 | 3300046536 | Bacteria | 1111 |
| 464 | Ga0495645_0000591 | 3300046543 | Bacteria | 24957 |
| 465 | Ga0495645_0046224 | 3300046543 | Bacteria | 3173 |
| 466 | Ga0495645_0144752 | 3300046543 | Bacteria | 1656 |
| 467 | Ga0495667_0046495 | 3300046559 | Bacteria | 2870 |
| 468 | Ga0495667_0088654 | 3300046559 | Bacteria | 2005 |
| 469 | Ga0495667_0122993 | 3300046559 | Bacteria | 1675 |
| 470 | Ga0495634_0028366 | 3300046642 | Bacteria | 3886 |
| 471 | Ga0495634_0167570 | 3300046642 | Bacteria | 1382 |
| 472 | Ga0495635_0094498 | 3300046663 | Bacteria | 2044 |
| 473 | Ga0495588_0145822 | 3300046674 | Bacteria | 1251 |
| 474 | Ga0495599_0003629 | 3300046678 | Bacteria | 9057 |
| 475 | Ga0495623_0002264 | 3300046679 | Bacteria | 12809 |
| 476 | Ga0495646_0044425 | 3300046680 | Bacteria | 2717 |
| 477 | Ga0495646_0092411 | 3300046680 | Bacteria | 1745 |
| 478 | Ga0495647_0058185 | 3300046681 | Unclassified | 1519 |
| 479 | Ga0495658_0028304 | 3300046683 | Bacteria | 3024 |
| 480 | Ga0495658_0392431 | 3300046683 | Unclassified | 884 |
| 481 | Ga0495613_0394629 | 3300046689 | Unclassified | 945 |
| 482 | Ga0495613_0432359 | 3300046689 | Bacteria | 894 |
| 483 | Ga0495600_0040605 | 3300046809 | Bacteria | 3031 |
| 484 | Ga0495581_0006434 | 3300047315 | Bacteria | 6817 |
| 485 | Ga0495581_0014508 | 3300047315 | Unclassified | 4570 |
| 486 | Ga0495581_0069314 | 3300047315 | Bacteria | 2039 |
| 487 | Ga0495581_0190631 | 3300047315 | Bacteria | 1199 |
| 488 | Ga0495604_0023776 | 3300047317 | Bacteria | 4890 |
| 489 | Ga0495674_0106773 | 3300047319 | Bacteria | 2377 |
| 490 | Ga0495674_0126375 | 3300047319 | Bacteria | 2157 |
| 491 | Ga0495674_0211420 | 3300047319 | Unclassified | 1606 |
| 492 | Ga0495672_0007338 | 3300047320 | Bacteria | 8312 |
| 493 | Ga0495680_0639940 | 3300047322 | Bacteria | 708 |
| 494 | Ga0495675_0005472 | 3300047444 | Bacteria | 7747 |
| 495 | Ga0495675_0022368 | 3300047444 | Bacteria | 4030 |
| 496 | Ga0495675_0067056 | 3300047444 | Bacteria | 2268 |
| 497 | Ga0495684_0003259 | 3300047471 | Bacteria | 12756 |
| 498 | Ga0495684_0005039 | 3300047471 | Bacteria | 10309 |
| 499 | Ga0495684_0025296 | 3300047471 | Unclassified | 4564 |
| 500 | Ga0495684_0041202 | 3300047471 | Bacteria | 3539 |
| 501 | Ga0495593_0480032 | 3300047673 | Unclassified | 623 |
| 502 | Ga0495602_0003596 | 3300048088 | Bacteria | 16052 |
| 503 | Ga0495602_0303178 | 3300048088 | Bacteria | 1168 |
| 504 | Ga0495614_0152567 | 3300048089 | Bacteria | 1031 |
| 505 | Ga0496101_0662068 | 3300048904 | Unclassified | 825 |
| 506 | Ga0496101_0709850 | 3300048904 | Unclassified | 794 |
| 507 | Ga0496104_0024693 | 3300048907 | Bacteria | 5532 |
| 508 | Ga0496104_0339650 | 3300048907 | Bacteria | 1415 |
| 509 | Ga0496105_0308189 | 3300048908 | Unclassified | 1272 |
| 510 | Ga0496105_0406542 | 3300048908 | Bacteria | 1080 |
| 511 | Ga0496106_0041635 | 3300048909 | Bacteria | 3443 |
| 512 | Ga0496108_0012356 | 3300048911 | Bacteria | 6948 |
| 513 | Ga0496108_0323414 | 3300048911 | Bacteria | 1345 |
| 514 | Ga0496109_0001037 | 3300048912 | Bacteria | 22996 |
| 515 | Ga0496109_0144307 | 3300048912 | Bacteria | 2227 |
| 516 | Ga0496110_0176244 | 3300048913 | Bacteria | 1940 |
| 517 | Ga0496110_0594054 | 3300048913 | Bacteria | 1005 |
| 518 | Ga0496110_0954960 | 3300048913 | Bacteria | 764 |
| 519 | Ga0496111_0212075 | 3300048914 | Unclassified | 1438 |
| 520 | Ga0496112_0000129 | 3300048915 | Bacteria | 47173 |
| 521 | Ga0496112_0050080 | 3300048915 | Bacteria | 4095 |
| 522 | Ga0496112_0134629 | 3300048915 | Bacteria | 2441 |
| 523 | Ga0496112_0146155 | 3300048915 | Bacteria | 2333 |
| 524 | Ga0496112_0600100 | 3300048915 | Bacteria | 1033 |
| 525 | Ga0496113_0000062 | 3300048916 | Bacteria | 46801 |
| 526 | Ga0496113_0282212 | 3300048916 | Bacteria | 1328 |
| 527 | Ga0496114_1071186 | 3300048917 | Bacteria | 690 |
| 528 | Ga0501294_013978 | 3300049517 | Unclassified | 818 |
| 529 | Ga0501298_004883 | 3300049521 | Bacteria | 2134 |
| 530 | Ga0501067_0151259 | 3300049583 | Bacteria | 1293 |
| 531 | Ga0501069_0314241 | 3300049585 | Bacteria | 920 |
| 532 | Ga0501073_0011175 | 3300049589 | Bacteria | 6565 |
| 533 | Ga0501077_0610395 | 3300049593 | Bacteria | 701 |
| 534 | Ga0501216_000925 | 3300049660 | Bacteria | 3727 |
| 535 | Ga0501217_002548 | 3300049661 | Bacteria | 3600 |
| 536 | Ga0501230_000515 | 3300049667 | Bacteria | 3919 |
| 537 | Ga0501235_000383 | 3300049669 | Bacteria | 8478 |
| 538 | Ga0501239_002706 | 3300049672 | Unclassified | 1630 |
| 539 | Ga0501242_000318 | 3300049674 | Bacteria | 3943 |
| 540 | Ga0501249_011837 | 3300049679 | Bacteria | 1837 |
| 541 | Ga0501249_029971 | 3300049679 | Bacteria | 1211 |
| 542 | Ga0501251_008581 | 3300049681 | Unclassified | 1161 |
| 543 | Ga0501257_007318 | 3300049686 | Bacteria | 2466 |
| 544 | Ga0501258_000403 | 3300049687 | Bacteria | 2859 |
| 545 | Ga0501225_0000567 | 3300049705 | Bacteria | 11585 |
| 546 | Ga0501234_001484 | 3300049707 | Bacteria | 3688 |
| 547 | Ga0501268_000218 | 3300049765 | Bacteria | 5662 |
| 548 | Ga0501269_041133 | 3300049766 | Unclassified | 616 |
| 549 | Ga0501272_000961 | 3300049769 | Bacteria | 2639 |
| 550 | Ga0501275_009096 | 3300049772 | Unclassified | 1035 |
| 551 | nmdc:mga05p37_129673_c1 | 3300050507 | Bacteria | 3094 |
| 552 | nmdc:mga05p37_1454562_c1 | 3300050507 | Unclassified | 686 |
| 553 | nmdc:mga05p37_74710_c1 | 3300050507 | Bacteria | 4171 |
| 554 | nmdc:mga09592_43091_c1 | 3300050508 | Bacteria | 3797 |
| 555 | nmdc:mga06r32_354107_c1 | 3300050510 | Bacteria | 1452 |
| 556 | nmdc:mga08y16_1154059_c1 | 3300050511 | Bacteria | 747 |
| 557 | nmdc:mga08y16_188305_c1 | 3300050511 | Bacteria | 2141 |
| 558 | nmdc:mga08y16_3729_c1 | 3300050511 | Bacteria | 15864 |
| 559 | nmdc:mga08y16_467602_c1 | 3300050511 | Unclassified | 1284 |
| 560 | nmdc:mga0n895_436296_c1 | 3300050512 | Bacteria | 1323 |
| 561 | nmdc:mga0rr50_580444_c1 | 3300050513 | Unclassified | 955 |
| 562 | nmdc:mga08x19_5623_c1 | 3300050514 | Bacteria | 7405 |
| 563 | nmdc:mga0a205_880773_c1 | 3300050515 | Bacteria | 742 |
| 564 | Ga0495601_0010964 | 3300053077 | Bacteria | 5412 |
| 565 | Ga0495601_0085043 | 3300053077 | Bacteria | 2032 |
| 566 | Ga0495612_0029121 | 3300053078 | Bacteria | 2223 |
| 567 | Ga0495619_0093698 | 3300053085 | Bacteria | 2036 |
| 568 | Ga0495619_0099901 | 3300053085 | Unclassified | 1974 |
| 569 | Ga0530510_0666377 | 3300061734 | Bacteria | 792 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046681 | Ga0495647_0058185 | Ga0495647_0058185_62_523 | 137 |
| 2 | 3300009177 | Ga0105248_10059481 | Ga0105248_100594813 | 158 |
| 3 | 3300013296 | Ga0157374_10142928 | Ga0157374_101429285 | 158 |
| 4 | 3300013306 | Ga0163162_11090697 | Ga0163162_110906971 | 158 |
| 5 | 3300013308 | Ga0157375_10796320 | Ga0157375_107963202 | 158 |
| 6 | 3300025941 | Ga0207711_10397968 | Ga0207711_103979682 | 158 |
| 7 | 3300005535 | Ga0070684_100019205 | Ga0070684_1000192055 | 168 |
| 8 | 3300005614 | Ga0068856_101369250 | Ga0068856_1013692501 | 168 |
| 9 | 3300013307 | Ga0157372_10000695 | Ga0157372_1000069534 | 168 |
| 10 | 3300005289 | Ga0065704_10534838 | Ga0065704_105348381 | 173 |
| 11 | 3300005290 | Ga0065712_10091475 | Ga0065712_100914753 | 173 |
| 12 | 3300005330 | Ga0070690_100055552 | Ga0070690_1000555522 | 173 |
| 13 | 3300005335 | Ga0070666_10007174 | Ga0070666_100071742 | 173 |
| 14 | 3300005338 | Ga0068868_100022945 | Ga0068868_1000229452 | 173 |
| 15 | 3300005340 | Ga0070689_100056494 | Ga0070689_1000564942 | 173 |
| 16 | 3300005355 | Ga0070671_100033598 | Ga0070671_1000335982 | 173 |
| 17 | 3300005364 | Ga0070673_100038323 | Ga0070673_1000383232 | 173 |
| 18 | 3300005367 | Ga0070667_100022071 | Ga0070667_1000220712 | 173 |
| 19 | 3300005457 | Ga0070662_100298909 | Ga0070662_1002989091 | 173 |
| 20 | 3300005466 | Ga0070685_10078664 | Ga0070685_100786642 | 173 |
| 21 | 3300005468 | Ga0070707_100749020 | Ga0070707_1007490201 | 173 |
| 22 | 3300005539 | Ga0068853_100877614 | Ga0068853_1008776142 | 173 |
| 23 | 3300005543 | Ga0070672_100211026 | Ga0070672_1002110262 | 173 |
| 24 | 3300005544 | Ga0070686_100086618 | Ga0070686_1000866182 | 173 |
| 25 | 3300005547 | Ga0070693_100520887 | Ga0070693_1005208872 | 173 |
| 26 | 3300005564 | Ga0070664_100079878 | Ga0070664_1000798782 | 173 |
| 27 | 3300005564 | Ga0070664_100217138 | Ga0070664_1002171382 | 173 |
| 28 | 3300005564 | Ga0070664_100423694 | Ga0070664_1004236943 | 173 |
| 29 | 3300005578 | Ga0068854_100703664 | Ga0068854_1007036642 | 173 |
| 30 | 3300005615 | Ga0070702_100005647 | Ga0070702_1000056473 | 173 |
| 31 | 3300005616 | Ga0068852_100141538 | Ga0068852_1001415382 | 173 |
| 32 | 3300005617 | Ga0068859_100098340 | Ga0068859_1000983402 | 173 |
| 33 | 3300005618 | Ga0068864_100257410 | Ga0068864_1002574102 | 173 |
| 34 | 3300005834 | Ga0068851_10118174 | Ga0068851_101181741 | 173 |
| 35 | 3300005841 | Ga0068863_100103551 | Ga0068863_1001035512 | 173 |
| 36 | 3300005842 | Ga0068858_100120296 | Ga0068858_1001202962 | 173 |
| 37 | 3300005843 | Ga0068860_100007345 | Ga0068860_1000073451 | 173 |
| 38 | 3300006237 | Ga0097621_100020459 | Ga0097621_1000204594 | 173 |
| 39 | 3300006358 | Ga0068871_100079922 | Ga0068871_1000799222 | 173 |
| 40 | 3300006844 | Ga0075428_100119062 | Ga0075428_1001190623 | 173 |
| 41 | 3300006880 | Ga0075429_100373546 | Ga0075429_1003735462 | 173 |
| 42 | 3300006881 | Ga0068865_100014306 | Ga0068865_1000143064 | 173 |
| 43 | 3300006931 | Ga0097620_100098349 | Ga0097620_1000983492 | 173 |
| 44 | 3300017792 | Ga0163161_10001671 | Ga0163161_100016713 | 173 |
| 45 | 3300025900 | Ga0207710_10069350 | Ga0207710_100693502 | 173 |
| 46 | 3300025903 | Ga0207680_10015800 | Ga0207680_100158003 | 173 |
| 47 | 3300025907 | Ga0207645_10391265 | Ga0207645_103912651 | 173 |
| 48 | 3300025922 | Ga0207646_10551757 | Ga0207646_105517571 | 173 |
| 49 | 3300025931 | Ga0207644_10063759 | Ga0207644_100637592 | 173 |
| 50 | 3300025933 | Ga0207706_10579076 | Ga0207706_105790762 | 173 |
| 51 | 3300025934 | Ga0207686_10022283 | Ga0207686_100222832 | 173 |
| 52 | 3300025936 | Ga0207670_10025722 | Ga0207670_100257222 | 173 |
| 53 | 3300025938 | Ga0207704_10014330 | Ga0207704_100143302 | 173 |
| 54 | 3300025940 | Ga0207691_10127741 | Ga0207691_101277412 | 173 |
| 55 | 3300025941 | Ga0207711_10006772 | Ga0207711_100067723 | 173 |
| 56 | 3300025945 | Ga0207679_10300679 | Ga0207679_103006792 | 173 |
| 57 | 3300025945 | Ga0207679_11026988 | Ga0207679_110269882 | 173 |
| 58 | 3300025960 | Ga0207651_10876640 | Ga0207651_108766401 | 173 |
| 59 | 3300025986 | Ga0207658_10150105 | Ga0207658_101501052 | 173 |
| 60 | 3300026023 | Ga0207677_10015015 | Ga0207677_100150152 | 173 |
| 61 | 3300026035 | Ga0207703_10025536 | Ga0207703_100255362 | 173 |
| 62 | 3300026041 | Ga0207639_10832553 | Ga0207639_108325532 | 173 |
| 63 | 3300026088 | Ga0207641_10007119 | Ga0207641_100071194 | 173 |
| 64 | 3300026095 | Ga0207676_10144226 | Ga0207676_101442262 | 173 |
| 65 | 3300026142 | Ga0207698_10467158 | Ga0207698_104671582 | 173 |
| 66 | 3300028381 | Ga0268264_10010562 | Ga0268264_100105626 | 173 |
| 67 | 3300031548 | Ga0307408_100675926 | Ga0307408_1006759262 | 173 |
| 68 | 3300031731 | Ga0307405_11522146 | Ga0307405_115221461 | 173 |
| 69 | 3300031824 | Ga0307413_10098172 | Ga0307413_100981723 | 173 |
| 70 | 3300031852 | Ga0307410_10119582 | Ga0307410_101195823 | 173 |
| 71 | 3300031852 | Ga0307410_11338445 | Ga0307410_113384451 | 173 |
| 72 | 3300031911 | Ga0307412_10068467 | Ga0307412_100684672 | 173 |
| 73 | 3300032002 | Ga0307416_102054559 | Ga0307416_1020545591 | 173 |
| 74 | 3300049589 | Ga0501073_0011175 | Ga0501073_0011175_5596_6117 | 173 |
| 75 | 3300050513 | nmdc:mga0rr50_580444_c1 | nmdc:mga0rr50_580444_c1_372_902 | 173 |
| 76 | 3300005289 | Ga0065704_10119219 | Ga0065704_101192193 | 174 |
| 77 | 3300005328 | Ga0070676_10079568 | Ga0070676_100795683 | 174 |
| 78 | 3300005328 | Ga0070676_10667308 | Ga0070676_106673082 | 174 |
| 79 | 3300005329 | Ga0070683_100002164 | Ga0070683_1000021644 | 174 |
| 80 | 3300005329 | Ga0070683_100027824 | Ga0070683_1000278242 | 174 |
| 81 | 3300005329 | Ga0070683_100105865 | Ga0070683_1001058654 | 174 |
| 82 | 3300005329 | Ga0070683_100439715 | Ga0070683_1004397152 | 174 |
| 83 | 3300005329 | Ga0070683_100838355 | Ga0070683_1008383551 | 174 |
| 84 | 3300005329 | Ga0070683_101016963 | Ga0070683_1010169632 | 174 |
| 85 | 3300005329 | Ga0070683_101118170 | Ga0070683_1011181701 | 174 |
| 86 | 3300005330 | Ga0070690_100027814 | Ga0070690_1000278145 | 174 |
| 87 | 3300005331 | Ga0070670_100002170 | Ga0070670_10000217012 | 174 |
| 88 | 3300005331 | Ga0070670_100272963 | Ga0070670_1002729631 | 174 |
| 89 | 3300005331 | Ga0070670_100293206 | Ga0070670_1002932062 | 174 |
| 90 | 3300005333 | Ga0070677_10038677 | Ga0070677_100386772 | 174 |
| 91 | 3300005334 | Ga0068869_100111168 | Ga0068869_1001111682 | 174 |
| 92 | 3300005337 | Ga0070682_100141832 | Ga0070682_1001418323 | 174 |
| 93 | 3300005338 | Ga0068868_100095274 | Ga0068868_1000952742 | 174 |
| 94 | 3300005338 | Ga0068868_100457530 | Ga0068868_1004575302 | 174 |
| 95 | 3300005339 | Ga0070660_100141365 | Ga0070660_1001413651 | 174 |
| 96 | 3300005339 | Ga0070660_100159886 | Ga0070660_1001598863 | 174 |
| 97 | 3300005340 | Ga0070689_100210830 | Ga0070689_1002108302 | 174 |
| 98 | 3300005341 | Ga0070691_10000560 | Ga0070691_100005607 | 174 |
| 99 | 3300005344 | Ga0070661_100007680 | Ga0070661_1000076807 | 174 |
| 100 | 3300005344 | Ga0070661_100125390 | Ga0070661_1001253903 | 174 |
| 101 | 3300005344 | Ga0070661_100233187 | Ga0070661_1002331871 | 174 |
| 102 | 3300005344 | Ga0070661_100380967 | Ga0070661_1003809672 | 174 |
| 103 | 3300005347 | Ga0070668_100006667 | Ga0070668_10000666712 | 174 |
| 104 | 3300005347 | Ga0070668_100224390 | Ga0070668_1002243902 | 174 |
| 105 | 3300005353 | Ga0070669_100581819 | Ga0070669_1005818192 | 174 |
| 106 | 3300005353 | Ga0070669_100742526 | Ga0070669_1007425261 | 174 |
| 107 | 3300005354 | Ga0070675_100077954 | Ga0070675_1000779542 | 174 |
| 108 | 3300005354 | Ga0070675_100300877 | Ga0070675_1003008773 | 174 |
| 109 | 3300005354 | Ga0070675_100483528 | Ga0070675_1004835282 | 174 |
| 110 | 3300005355 | Ga0070671_100009661 | Ga0070671_1000096613 | 174 |
| 111 | 3300005356 | Ga0070674_100354333 | Ga0070674_1003543332 | 174 |
| 112 | 3300005356 | Ga0070674_100569014 | Ga0070674_1005690142 | 174 |
| 113 | 3300005364 | Ga0070673_100142643 | Ga0070673_1001426432 | 174 |
| 114 | 3300005366 | Ga0070659_100004103 | Ga0070659_1000041034 | 174 |
| 115 | 3300005367 | Ga0070667_100186221 | Ga0070667_1001862213 | 174 |
| 116 | 3300005367 | Ga0070667_100744847 | Ga0070667_1007448471 | 174 |
| 117 | 3300005435 | Ga0070714_101445944 | Ga0070714_1014459441 | 174 |
| 118 | 3300005445 | Ga0070708_100181564 | Ga0070708_1001815641 | 174 |
| 119 | 3300005455 | Ga0070663_100017194 | Ga0070663_1000171941 | 174 |
| 120 | 3300005456 | Ga0070678_100258228 | Ga0070678_1002582282 | 174 |
| 121 | 3300005457 | Ga0070662_100002461 | Ga0070662_1000024617 | 174 |
| 122 | 3300005457 | Ga0070662_100899317 | Ga0070662_1008993171 | 174 |
| 123 | 3300005458 | Ga0070681_10557053 | Ga0070681_105570532 | 174 |
| 124 | 3300005459 | Ga0068867_100105023 | Ga0068867_1001050232 | 174 |
| 125 | 3300005459 | Ga0068867_101087453 | Ga0068867_1010874531 | 174 |
| 126 | 3300005471 | Ga0070698_100128563 | Ga0070698_1001285634 | 174 |
| 127 | 3300005518 | Ga0070699_100242117 | Ga0070699_1002421172 | 174 |
| 128 | 3300005518 | Ga0070699_100427382 | Ga0070699_1004273821 | 174 |
| 129 | 3300005530 | Ga0070679_100049825 | Ga0070679_1000498253 | 174 |
| 130 | 3300005530 | Ga0070679_100267571 | Ga0070679_1002675712 | 174 |
| 131 | 3300005530 | Ga0070679_100393518 | Ga0070679_1003935181 | 174 |
| 132 | 3300005530 | Ga0070679_100779695 | Ga0070679_1007796951 | 174 |
| 133 | 3300005535 | Ga0070684_100005156 | Ga0070684_10000515611 | 174 |
| 134 | 3300005535 | Ga0070684_100005806 | Ga0070684_1000058066 | 174 |
| 135 | 3300005535 | Ga0070684_100020454 | Ga0070684_1000204545 | 174 |
| 136 | 3300005535 | Ga0070684_100049809 | Ga0070684_1000498094 | 174 |
| 137 | 3300005535 | Ga0070684_100261698 | Ga0070684_1002616982 | 174 |
| 138 | 3300005535 | Ga0070684_100662339 | Ga0070684_1006623392 | 174 |
| 139 | 3300005535 | Ga0070684_101129317 | Ga0070684_1011293171 | 174 |
| 140 | 3300005543 | Ga0070672_100323481 | Ga0070672_1003234812 | 174 |
| 141 | 3300005543 | Ga0070672_100453468 | Ga0070672_1004534682 | 174 |
| 142 | 3300005548 | Ga0070665_100104416 | Ga0070665_1001044163 | 174 |
| 143 | 3300005549 | Ga0070704_100109581 | Ga0070704_1001095814 | 174 |
| 144 | 3300005563 | Ga0068855_100375026 | Ga0068855_1003750261 | 174 |
| 145 | 3300005564 | Ga0070664_100027111 | Ga0070664_1000271112 | 174 |
| 146 | 3300005564 | Ga0070664_100039316 | Ga0070664_1000393163 | 174 |
| 147 | 3300005564 | Ga0070664_100070093 | Ga0070664_1000700932 | 174 |
| 148 | 3300005564 | Ga0070664_100115841 | Ga0070664_1001158413 | 174 |
| 149 | 3300005564 | Ga0070664_100370151 | Ga0070664_1003701512 | 174 |
| 150 | 3300005577 | Ga0068857_100003022 | Ga0068857_10000302218 | 174 |
| 151 | 3300005577 | Ga0068857_100232058 | Ga0068857_1002320582 | 174 |
| 152 | 3300005614 | Ga0068856_100278411 | Ga0068856_1002784112 | 174 |
| 153 | 3300005614 | Ga0068856_100535653 | Ga0068856_1005356532 | 174 |
| 154 | 3300005614 | Ga0068856_101721755 | Ga0068856_1017217552 | 174 |
| 155 | 3300005615 | Ga0070702_100736183 | Ga0070702_1007361832 | 174 |
| 156 | 3300005616 | Ga0068852_100164659 | Ga0068852_1001646592 | 174 |
| 157 | 3300005617 | Ga0068859_100181302 | Ga0068859_1001813023 | 174 |
| 158 | 3300005617 | Ga0068859_100204627 | Ga0068859_1002046272 | 174 |
| 159 | 3300005618 | Ga0068864_100016185 | Ga0068864_1000161855 | 174 |
| 160 | 3300005618 | Ga0068864_100047560 | Ga0068864_1000475603 | 174 |
| 161 | 3300005618 | Ga0068864_100089087 | Ga0068864_1000890873 | 174 |
| 162 | 3300005618 | Ga0068864_100397769 | Ga0068864_1003977692 | 174 |
| 163 | 3300005618 | Ga0068864_100963564 | Ga0068864_1009635642 | 174 |
| 164 | 3300005618 | Ga0068864_101406130 | Ga0068864_1014061301 | 174 |
| 165 | 3300005719 | Ga0068861_100068587 | Ga0068861_1000685873 | 174 |
| 166 | 3300005719 | Ga0068861_100129627 | Ga0068861_1001296272 | 174 |
| 167 | 3300005840 | Ga0068870_10028020 | Ga0068870_100280204 | 174 |
| 168 | 3300005840 | Ga0068870_10494073 | Ga0068870_104940731 | 174 |
| 169 | 3300005841 | Ga0068863_100184668 | Ga0068863_1001846683 | 174 |
| 170 | 3300005841 | Ga0068863_100257536 | Ga0068863_1002575362 | 174 |
| 171 | 3300005843 | Ga0068860_100139902 | Ga0068860_1001399022 | 174 |
| 172 | 3300005843 | Ga0068860_100463658 | Ga0068860_1004636581 | 174 |
| 173 | 3300005844 | Ga0068862_100485535 | Ga0068862_1004855352 | 174 |
| 174 | 3300005985 | Ga0081539_10001600 | Ga0081539_1000160013 | 174 |
| 175 | 3300006163 | Ga0070715_10269110 | Ga0070715_102691102 | 174 |
| 176 | 3300006237 | Ga0097621_100033298 | Ga0097621_1000332982 | 174 |
| 177 | 3300006844 | Ga0075428_100009929 | Ga0075428_1000099295 | 174 |
| 178 | 3300006852 | Ga0075433_10480487 | Ga0075433_104804871 | 174 |
| 179 | 3300006881 | Ga0068865_100090455 | Ga0068865_1000904553 | 174 |
| 180 | 3300006931 | Ga0097620_100181301 | Ga0097620_1001813013 | 174 |
| 181 | 3300006931 | Ga0097620_100204640 | Ga0097620_1002046402 | 174 |
| 182 | 3300007265 | Ga0099794_10224271 | Ga0099794_102242711 | 174 |
| 183 | 3300009094 | Ga0111539_10001049 | Ga0111539_1000104945 | 174 |
| 184 | 3300009094 | Ga0111539_10013647 | Ga0111539_100136472 | 174 |
| 185 | 3300009094 | Ga0111539_10090086 | Ga0111539_100900862 | 174 |
| 186 | 3300009094 | Ga0111539_10149946 | Ga0111539_101499463 | 174 |
| 187 | 3300009094 | Ga0111539_11389540 | Ga0111539_113895402 | 174 |
| 188 | 3300009098 | Ga0105245_10022952 | Ga0105245_100229524 | 174 |
| 189 | 3300009098 | Ga0105245_10356606 | Ga0105245_103566063 | 174 |
| 190 | 3300009098 | Ga0105245_11400666 | Ga0105245_114006661 | 174 |
| 191 | 3300009101 | Ga0105247_10153104 | Ga0105247_101531042 | 174 |
| 192 | 3300009147 | Ga0114129_10134377 | Ga0114129_101343772 | 174 |
| 193 | 3300009147 | Ga0114129_10338452 | Ga0114129_103384522 | 174 |
| 194 | 3300009147 | Ga0114129_11798353 | Ga0114129_117983532 | 174 |
| 195 | 3300009148 | Ga0105243_10488330 | Ga0105243_104883301 | 174 |
| 196 | 3300009148 | Ga0105243_10756556 | Ga0105243_107565562 | 174 |
| 197 | 3300009174 | Ga0105241_10061296 | Ga0105241_100612965 | 174 |
| 198 | 3300009174 | Ga0105241_10430820 | Ga0105241_104308202 | 174 |
| 199 | 3300009174 | Ga0105241_10472488 | Ga0105241_104724882 | 174 |
| 200 | 3300009176 | Ga0105242_10018377 | Ga0105242_100183772 | 174 |
| 201 | 3300009176 | Ga0105242_10021360 | Ga0105242_100213605 | 174 |
| 202 | 3300009176 | Ga0105242_10067419 | Ga0105242_100674192 | 174 |
| 203 | 3300009176 | Ga0105242_10649427 | Ga0105242_106494271 | 174 |
| 204 | 3300009177 | Ga0105248_10220738 | Ga0105248_102207382 | 174 |
| 205 | 3300009177 | Ga0105248_10299129 | Ga0105248_102991293 | 174 |
| 206 | 3300009177 | Ga0105248_10312061 | Ga0105248_103120611 | 174 |
| 207 | 3300009177 | Ga0105248_10502327 | Ga0105248_105023272 | 174 |
| 208 | 3300009177 | Ga0105248_10834999 | Ga0105248_108349992 | 174 |
| 209 | 3300009177 | Ga0105248_11229560 | Ga0105248_112295601 | 174 |
| 210 | 3300009177 | Ga0105248_11674710 | Ga0105248_116747102 | 174 |
| 211 | 3300009551 | Ga0105238_10000225 | Ga0105238_1000022542 | 174 |
| 212 | 3300009551 | Ga0105238_10009656 | Ga0105238_100096565 | 174 |
| 213 | 3300009551 | Ga0105238_10024744 | Ga0105238_100247445 | 174 |
| 214 | 3300010375 | Ga0105239_10064670 | Ga0105239_100646704 | 174 |
| 215 | 3300011119 | Ga0105246_10143008 | Ga0105246_101430082 | 174 |
| 216 | 3300011119 | Ga0105246_11237146 | Ga0105246_112371461 | 174 |
| 217 | 3300013100 | Ga0157373_10152250 | Ga0157373_101522502 | 174 |
| 218 | 3300013102 | Ga0157371_10006495 | Ga0157371_100064956 | 174 |
| 219 | 3300013104 | Ga0157370_10290574 | Ga0157370_102905742 | 174 |
| 220 | 3300013104 | Ga0157370_10926687 | Ga0157370_109266872 | 174 |
| 221 | 3300013105 | Ga0157369_10178607 | Ga0157369_101786073 | 174 |
| 222 | 3300013105 | Ga0157369_10511127 | Ga0157369_105111272 | 174 |
| 223 | 3300013105 | Ga0157369_10748441 | Ga0157369_107484411 | 174 |
| 224 | 3300013105 | Ga0157369_10956273 | Ga0157369_109562731 | 174 |
| 225 | 3300013105 | Ga0157369_11323052 | Ga0157369_113230521 | 174 |
| 226 | 3300013296 | Ga0157374_10009184 | Ga0157374_100091842 | 174 |
| 227 | 3300013296 | Ga0157374_10099399 | Ga0157374_100993991 | 174 |
| 228 | 3300013297 | Ga0157378_10231349 | Ga0157378_102313492 | 174 |
| 229 | 3300013297 | Ga0157378_10248288 | Ga0157378_102482881 | 174 |
| 230 | 3300013297 | Ga0157378_10591813 | Ga0157378_105918131 | 174 |
| 231 | 3300013306 | Ga0163162_10087820 | Ga0163162_100878202 | 174 |
| 232 | 3300013306 | Ga0163162_10192326 | Ga0163162_101923263 | 174 |
| 233 | 3300013306 | Ga0163162_11036873 | Ga0163162_110368732 | 174 |
| 234 | 3300013307 | Ga0157372_10014061 | Ga0157372_100140614 | 174 |
| 235 | 3300013307 | Ga0157372_10053394 | Ga0157372_100533942 | 174 |
| 236 | 3300013307 | Ga0157372_10157673 | Ga0157372_101576734 | 174 |
| 237 | 3300013307 | Ga0157372_10202493 | Ga0157372_102024932 | 174 |
| 238 | 3300013307 | Ga0157372_10413778 | Ga0157372_104137782 | 174 |
| 239 | 3300013307 | Ga0157372_10769265 | Ga0157372_107692652 | 174 |
| 240 | 3300013307 | Ga0157372_10968926 | Ga0157372_109689261 | 174 |
| 241 | 3300013308 | Ga0157375_10095014 | Ga0157375_100950143 | 174 |
| 242 | 3300013308 | Ga0157375_10134168 | Ga0157375_101341682 | 174 |
| 243 | 3300013308 | Ga0157375_10914018 | Ga0157375_109140182 | 174 |
| 244 | 3300013308 | Ga0157375_11454701 | Ga0157375_114547011 | 174 |
| 245 | 3300013308 | Ga0157375_11730116 | Ga0157375_117301162 | 174 |
| 246 | 3300014325 | Ga0163163_10177062 | Ga0163163_101770622 | 174 |
| 247 | 3300014325 | Ga0163163_10318560 | Ga0163163_103185602 | 174 |
| 248 | 3300014325 | Ga0163163_10538062 | Ga0163163_105380622 | 174 |
| 249 | 3300014326 | Ga0157380_10027225 | Ga0157380_100272254 | 174 |
| 250 | 3300014745 | Ga0157377_10061572 | Ga0157377_100615723 | 174 |
| 251 | 3300014968 | Ga0157379_10760321 | Ga0157379_107603212 | 174 |
| 252 | 3300014968 | Ga0157379_11060168 | Ga0157379_110601682 | 174 |
| 253 | 3300014969 | Ga0157376_10181388 | Ga0157376_101813882 | 174 |
| 254 | 3300015262 | Ga0182007_10014049 | Ga0182007_100140492 | 174 |
| 255 | 3300017792 | Ga0163161_10059121 | Ga0163161_100591213 | 174 |
| 256 | 3300025735 | Ga0207713_1193309 | Ga0207713_11933091 | 174 |
| 257 | 3300025893 | Ga0207682_10014497 | Ga0207682_100144972 | 174 |
| 258 | 3300025904 | Ga0207647_10152364 | Ga0207647_101523642 | 174 |
| 259 | 3300025907 | Ga0207645_10065419 | Ga0207645_100654192 | 174 |
| 260 | 3300025907 | Ga0207645_10070511 | Ga0207645_100705113 | 174 |
| 261 | 3300025907 | Ga0207645_10091116 | Ga0207645_100911163 | 174 |
| 262 | 3300025908 | Ga0207643_10296650 | Ga0207643_102966502 | 174 |
| 263 | 3300025909 | Ga0207705_10045525 | Ga0207705_100455254 | 174 |
| 264 | 3300025909 | Ga0207705_10119112 | Ga0207705_101191122 | 174 |
| 265 | 3300025911 | Ga0207654_10280338 | Ga0207654_102803382 | 174 |
| 266 | 3300025911 | Ga0207654_10430038 | Ga0207654_104300381 | 174 |
| 267 | 3300025912 | Ga0207707_10044048 | Ga0207707_100440484 | 174 |
| 268 | 3300025912 | Ga0207707_10340842 | Ga0207707_103408422 | 174 |
| 269 | 3300025912 | Ga0207707_10845772 | Ga0207707_108457721 | 174 |
| 270 | 3300025913 | Ga0207695_10003493 | Ga0207695_100034937 | 174 |
| 271 | 3300025913 | Ga0207695_10221269 | Ga0207695_102212691 | 174 |
| 272 | 3300025918 | Ga0207662_10389046 | Ga0207662_103890461 | 174 |
| 273 | 3300025919 | Ga0207657_10036831 | Ga0207657_100368313 | 174 |
| 274 | 3300025920 | Ga0207649_10012635 | Ga0207649_100126354 | 174 |
| 275 | 3300025920 | Ga0207649_10052574 | Ga0207649_100525744 | 174 |
| 276 | 3300025920 | Ga0207649_10129597 | Ga0207649_101295973 | 174 |
| 277 | 3300025921 | Ga0207652_10184775 | Ga0207652_101847753 | 174 |
| 278 | 3300025921 | Ga0207652_10191968 | Ga0207652_101919682 | 174 |
| 279 | 3300025921 | Ga0207652_10196263 | Ga0207652_101962632 | 174 |
| 280 | 3300025921 | Ga0207652_10237392 | Ga0207652_102373923 | 174 |
| 281 | 3300025923 | Ga0207681_10197745 | Ga0207681_101977452 | 174 |
| 282 | 3300025923 | Ga0207681_10545242 | Ga0207681_105452422 | 174 |
| 283 | 3300025924 | Ga0207694_10000013 | Ga0207694_10000013268 | 174 |
| 284 | 3300025924 | Ga0207694_10139648 | Ga0207694_101396482 | 174 |
| 285 | 3300025925 | Ga0207650_10016951 | Ga0207650_100169514 | 174 |
| 286 | 3300025925 | Ga0207650_10134000 | Ga0207650_101340002 | 174 |
| 287 | 3300025925 | Ga0207650_10217429 | Ga0207650_102174292 | 174 |
| 288 | 3300025926 | Ga0207659_10113034 | Ga0207659_101130343 | 174 |
| 289 | 3300025926 | Ga0207659_10906919 | Ga0207659_109069192 | 174 |
| 290 | 3300025927 | Ga0207687_10095326 | Ga0207687_100953262 | 174 |
| 291 | 3300025931 | Ga0207644_10129932 | Ga0207644_101299322 | 174 |
| 292 | 3300025932 | Ga0207690_10033208 | Ga0207690_100332081 | 174 |
| 293 | 3300025933 | Ga0207706_10000223 | Ga0207706_1000022370 | 174 |
| 294 | 3300025933 | Ga0207706_10030153 | Ga0207706_100301534 | 174 |
| 295 | 3300025934 | Ga0207686_10023738 | Ga0207686_100237383 | 174 |
| 296 | 3300025934 | Ga0207686_10025077 | Ga0207686_100250773 | 174 |
| 297 | 3300025934 | Ga0207686_10555328 | Ga0207686_105553281 | 174 |
| 298 | 3300025936 | Ga0207670_10213543 | Ga0207670_102135432 | 174 |
| 299 | 3300025936 | Ga0207670_10229625 | Ga0207670_102296252 | 174 |
| 300 | 3300025937 | Ga0207669_10245811 | Ga0207669_102458112 | 174 |
| 301 | 3300025938 | Ga0207704_10973523 | Ga0207704_109735231 | 174 |
| 302 | 3300025940 | Ga0207691_10098564 | Ga0207691_100985642 | 174 |
| 303 | 3300025940 | Ga0207691_10134566 | Ga0207691_101345662 | 174 |
| 304 | 3300025941 | Ga0207711_10126884 | Ga0207711_101268842 | 174 |
| 305 | 3300025941 | Ga0207711_10368378 | Ga0207711_103683782 | 174 |
| 306 | 3300025941 | Ga0207711_10371449 | Ga0207711_103714491 | 174 |
| 307 | 3300025941 | Ga0207711_10883484 | Ga0207711_108834841 | 174 |
| 308 | 3300025942 | Ga0207689_10324347 | Ga0207689_103243472 | 174 |
| 309 | 3300025944 | Ga0207661_10000364 | Ga0207661_100003648 | 174 |
| 310 | 3300025944 | Ga0207661_10005648 | Ga0207661_100056486 | 174 |
| 311 | 3300025944 | Ga0207661_10024755 | Ga0207661_100247553 | 174 |
| 312 | 3300025944 | Ga0207661_10099719 | Ga0207661_100997194 | 174 |
| 313 | 3300025944 | Ga0207661_10138260 | Ga0207661_101382602 | 174 |
| 314 | 3300025944 | Ga0207661_10218605 | Ga0207661_102186051 | 174 |
| 315 | 3300025944 | Ga0207661_10559704 | Ga0207661_105597042 | 174 |
| 316 | 3300025945 | Ga0207679_10814280 | Ga0207679_108142802 | 174 |
| 317 | 3300025949 | Ga0207667_10033553 | Ga0207667_100335532 | 174 |
| 318 | 3300025949 | Ga0207667_10198330 | Ga0207667_101983302 | 174 |
| 319 | 3300025961 | Ga0207712_10358563 | Ga0207712_103585632 | 174 |
| 320 | 3300025972 | Ga0207668_10148917 | Ga0207668_101489172 | 174 |
| 321 | 3300025972 | Ga0207668_10547989 | Ga0207668_105479892 | 174 |
| 322 | 3300025981 | Ga0207640_10004904 | Ga0207640_100049046 | 174 |
| 323 | 3300025986 | Ga0207658_10753142 | Ga0207658_107531422 | 174 |
| 324 | 3300026035 | Ga0207703_10207465 | Ga0207703_102074652 | 174 |
| 325 | 3300026035 | Ga0207703_10836742 | Ga0207703_108367421 | 174 |
| 326 | 3300026067 | Ga0207678_10000621 | Ga0207678_1000062126 | 174 |
| 327 | 3300026075 | Ga0207708_11596906 | Ga0207708_115969061 | 174 |
| 328 | 3300026078 | Ga0207702_10151806 | Ga0207702_101518062 | 174 |
| 329 | 3300026078 | Ga0207702_11266356 | Ga0207702_112663561 | 174 |
| 330 | 3300026088 | Ga0207641_10233715 | Ga0207641_102337151 | 174 |
| 331 | 3300026089 | Ga0207648_10008371 | Ga0207648_100083716 | 174 |
| 332 | 3300026089 | Ga0207648_10176427 | Ga0207648_101764272 | 174 |
| 333 | 3300026095 | Ga0207676_10001991 | Ga0207676_1000199113 | 174 |
| 334 | 3300026095 | Ga0207676_10163976 | Ga0207676_101639762 | 174 |
| 335 | 3300026095 | Ga0207676_10215105 | Ga0207676_102151052 | 174 |
| 336 | 3300026095 | Ga0207676_10304519 | Ga0207676_103045192 | 174 |
| 337 | 3300026095 | Ga0207676_10381946 | Ga0207676_103819462 | 174 |
| 338 | 3300026095 | Ga0207676_10906355 | Ga0207676_109063552 | 174 |
| 339 | 3300026116 | Ga0207674_10002317 | Ga0207674_1000231711 | 174 |
| 340 | 3300026116 | Ga0207674_10046996 | Ga0207674_100469964 | 174 |
| 341 | 3300026116 | Ga0207674_10071495 | Ga0207674_100714953 | 174 |
| 342 | 3300026118 | Ga0207675_100073068 | Ga0207675_1000730686 | 174 |
| 343 | 3300026121 | Ga0207683_11000012 | Ga0207683_110000121 | 174 |
| 344 | 3300026142 | Ga0207698_10128892 | Ga0207698_101288922 | 174 |
| 345 | 3300027471 | Ga0209995_1019361 | Ga0209995_10193611 | 174 |
| 346 | 3300027543 | Ga0209999_1002986 | Ga0209999_10029862 | 174 |
| 347 | 3300028379 | Ga0268266_10149480 | Ga0268266_101494802 | 174 |
| 348 | 3300030745 | Ga0316182_1262167 | Ga0316182_12621672 | 174 |
| 349 | 3300031238 | Ga0265332_10053275 | Ga0265332_100532752 | 174 |
| 350 | 3300031241 | Ga0265325_10393912 | Ga0265325_103939121 | 174 |
| 351 | 3300031251 | Ga0265327_10019927 | Ga0265327_100199274 | 174 |
| 352 | 3300031548 | Ga0307408_100018775 | Ga0307408_1000187753 | 174 |
| 353 | 3300031548 | Ga0307408_100129201 | Ga0307408_1001292012 | 174 |
| 354 | 3300031548 | Ga0307408_100154980 | Ga0307408_1001549802 | 174 |
| 355 | 3300031548 | Ga0307408_100291302 | Ga0307408_1002913023 | 174 |
| 356 | 3300031548 | Ga0307408_100423994 | Ga0307408_1004239942 | 174 |
| 357 | 3300031548 | Ga0307408_100817917 | Ga0307408_1008179171 | 174 |
| 358 | 3300031711 | Ga0265314_10016381 | Ga0265314_1001638110 | 174 |
| 359 | 3300031731 | Ga0307405_10016104 | Ga0307405_100161043 | 174 |
| 360 | 3300031731 | Ga0307405_10286968 | Ga0307405_102869681 | 174 |
| 361 | 3300031824 | Ga0307413_10010803 | Ga0307413_100108036 | 174 |
| 362 | 3300031824 | Ga0307413_10034748 | Ga0307413_100347483 | 174 |
| 363 | 3300031824 | Ga0307413_10936222 | Ga0307413_109362222 | 174 |
| 364 | 3300031852 | Ga0307410_10027268 | Ga0307410_100272685 | 174 |
| 365 | 3300031901 | Ga0307406_10013118 | Ga0307406_100131186 | 174 |
| 366 | 3300031901 | Ga0307406_10051007 | Ga0307406_100510073 | 174 |
| 367 | 3300031901 | Ga0307406_10308108 | Ga0307406_103081082 | 174 |
| 368 | 3300031901 | Ga0307406_10464056 | Ga0307406_104640562 | 174 |
| 369 | 3300031903 | Ga0307407_10002325 | Ga0307407_100023251 | 174 |
| 370 | 3300031903 | Ga0307407_10003498 | Ga0307407_100034986 | 174 |
| 371 | 3300031903 | Ga0307407_10017929 | Ga0307407_100179293 | 174 |
| 372 | 3300031903 | Ga0307407_10155397 | Ga0307407_101553971 | 174 |
| 373 | 3300031903 | Ga0307407_10494691 | Ga0307407_104946912 | 174 |
| 374 | 3300031903 | Ga0307407_10520521 | Ga0307407_105205211 | 174 |
| 375 | 3300031903 | Ga0307407_11171608 | Ga0307407_111716081 | 174 |
| 376 | 3300031911 | Ga0307412_10020524 | Ga0307412_100205246 | 174 |
| 377 | 3300031911 | Ga0307412_10049644 | Ga0307412_100496443 | 174 |
| 378 | 3300031911 | Ga0307412_10130958 | Ga0307412_101309582 | 174 |
| 379 | 3300031995 | Ga0307409_100013660 | Ga0307409_1000136605 | 174 |
| 380 | 3300031995 | Ga0307409_100017769 | Ga0307409_1000177696 | 174 |
| 381 | 3300031995 | Ga0307409_100109565 | Ga0307409_1001095653 | 174 |
| 382 | 3300031995 | Ga0307409_100170214 | Ga0307409_1001702141 | 174 |
| 383 | 3300031995 | Ga0307409_100248698 | Ga0307409_1002486981 | 174 |
| 384 | 3300031995 | Ga0307409_100268240 | Ga0307409_1002682402 | 174 |
| 385 | 3300031995 | Ga0307409_100429244 | Ga0307409_1004292442 | 174 |
| 386 | 3300031995 | Ga0307409_100522784 | Ga0307409_1005227842 | 174 |
| 387 | 3300031995 | Ga0307409_101290497 | Ga0307409_1012904972 | 174 |
| 388 | 3300032002 | Ga0307416_100003107 | Ga0307416_1000031078 | 174 |
| 389 | 3300032002 | Ga0307416_100005086 | Ga0307416_1000050867 | 174 |
| 390 | 3300032002 | Ga0307416_100328177 | Ga0307416_1003281773 | 174 |
| 391 | 3300032002 | Ga0307416_101127697 | Ga0307416_1011276972 | 174 |
| 392 | 3300032002 | Ga0307416_101571810 | Ga0307416_1015718102 | 174 |
| 393 | 3300032002 | Ga0307416_101577074 | Ga0307416_1015770741 | 174 |
| 394 | 3300032004 | Ga0307414_10040985 | Ga0307414_100409852 | 174 |
| 395 | 3300032004 | Ga0307414_10053418 | Ga0307414_100534183 | 174 |
| 396 | 3300032004 | Ga0307414_11158472 | Ga0307414_111584721 | 174 |
| 397 | 3300032005 | Ga0307411_10166042 | Ga0307411_101660421 | 174 |
| 398 | 3300032005 | Ga0307411_10220696 | Ga0307411_102206963 | 174 |
| 399 | 3300032005 | Ga0307411_10778956 | Ga0307411_107789562 | 174 |
| 400 | 3300032005 | Ga0307411_10845346 | Ga0307411_108453462 | 174 |
| 401 | 3300032005 | Ga0307411_10869913 | Ga0307411_108699132 | 174 |
| 402 | 3300032126 | Ga0307415_100005994 | Ga0307415_1000059946 | 174 |
| 403 | 3300032126 | Ga0307415_100086067 | Ga0307415_1000860673 | 174 |
| 404 | 3300032126 | Ga0307415_100283800 | Ga0307415_1002838002 | 174 |
| 405 | 3300032126 | Ga0307415_100398539 | Ga0307415_1003985392 | 174 |
| 406 | 3300032126 | Ga0307415_100634391 | Ga0307415_1006343911 | 174 |
| 407 | 3300035086 | Ga0373934_0060679 | Ga0373934_0060679_209_733 | 174 |
| 408 | 3300035088 | Ga0373940_0095668 | Ga0373940_0095668_131_655 | 174 |
| 409 | 3300035090 | Ga0373949_0071929 | Ga0373949_0071929_10_630 | 174 |
| 410 | 3300035111 | Ga0373923_0127279 | Ga0373923_0127279_377_901 | 174 |
| 411 | 3300035113 | Ga0373936_0080587 | Ga0373936_0080587_119_643 | 174 |
| 412 | 3300035117 | Ga0373953_0054815 | Ga0373953_0054815_284_808 | 174 |
| 413 | 3300035120 | Ga0373957_0388455 | Ga0373957_0388455_13_537 | 174 |
| 414 | 3300035170 | Ga0373943_0014633 | Ga0373943_0014633_2309_2845 | 174 |
| 415 | 3300035172 | Ga0373955_0040040 | Ga0373955_0040040_1970_2494 | 174 |
| 416 | 3300035691 | Ga0373931_0070479 | Ga0373931_0070479_1019_1543 | 174 |
| 417 | 3300035691 | Ga0373931_0104751 | Ga0373931_0104751_575_1099 | 174 |
| 418 | 3300035695 | Ga0373927_0050336 | Ga0373927_0050336_823_1347 | 174 |
| 419 | 3300035724 | Ga0373933_0274695 | Ga0373933_0274695_502_1026 | 174 |
| 420 | 3300036401 | Ga0373937_0007000 | Ga0373937_0007000_7327_7851 | 174 |
| 421 | 3300036401 | Ga0373937_0132304 | Ga0373937_0132304_122_646 | 174 |
| 422 | 3300037068 | Ga0373925_0073278 | Ga0373925_0073278_1826_2350 | 174 |
| 423 | 3300037471 | Ga0395905_0613972 | Ga0395905_0613972_134_658 | 174 |
| 424 | 3300038443 | Ga0395901_0410147 | Ga0395901_0410147_799_1341 | 174 |
| 425 | 3300038443 | Ga0395901_0451330 | Ga0395901_0451330_101_643 | 174 |
| 426 | 3300039437 | Ga0436365_0917686 | Ga0436365_0917686_150_674 | 174 |
| 427 | 3300041512 | Ga0451853_2262551 | Ga0451853_2262551_34_558 | 174 |
| 428 | 3300042461 | Ga0439460_0009970 | Ga0439460_0009970_976_1500 | 174 |
| 429 | 3300042461 | Ga0439460_0078994 | Ga0439460_0078994_62_586 | 174 |
| 430 | 3300044684 | Ga0466966_0085464 | Ga0466966_0085464_474_1061 | 174 |
| 431 | 3300044693 | Ga0466961_0215188 | Ga0466961_0215188_215_754 | 174 |
| 432 | 3300044694 | Ga0466963_0137878 | Ga0466963_0137878_601_1131 | 174 |
| 433 | 3300044842 | Ga0466957_0164824 | Ga0466957_0164824_891_1418 | 174 |
| 434 | 3300045049 | Ga0466959_0265591 | Ga0466959_0265591_147_671 | 174 |
| 435 | 3300045049 | Ga0466959_0306565 | Ga0466959_0306565_338_865 | 174 |
| 436 | 3300045051 | Ga0451576_0039022 | Ga0451576_0039022_2797_3321 | 174 |
| 437 | 3300045051 | Ga0451576_1191295 | Ga0451576_1191295_46_576 | 174 |
| 438 | 3300045836 | Ga0466958_0361278 | Ga0466958_0361278_239_766 | 174 |
| 439 | 3300045976 | Ga0466967_1527341 | Ga0466967_1527341_38_589 | 174 |
| 440 | 3300046455 | Ga0495603_0423085 | Ga0495603_0423085_130_654 | 174 |
| 441 | 3300046459 | Ga0495629_0066561 | Ga0495629_0066561_1559_2083 | 174 |
| 442 | 3300046462 | Ga0495651_0014779 | Ga0495651_0014779_870_1394 | 174 |
| 443 | 3300046472 | Ga0495580_0008420 | Ga0495580_0008420_5951_6475 | 174 |
| 444 | 3300046473 | Ga0495582_0014739 | Ga0495582_0014739_1089_1613 | 174 |
| 445 | 3300046473 | Ga0495582_0291760 | Ga0495582_0291760_91_615 | 174 |
| 446 | 3300046477 | Ga0495664_0041346 | Ga0495664_0041346_698_1222 | 174 |
| 447 | 3300046477 | Ga0495664_0055043 | Ga0495664_0055043_618_1142 | 174 |
| 448 | 3300046499 | Ga0495594_0002629 | Ga0495594_0002629_5891_6415 | 174 |
| 449 | 3300046499 | Ga0495594_0006066 | Ga0495594_0006066_3217_3741 | 174 |
| 450 | 3300046499 | Ga0495594_0088633 | Ga0495594_0088633_250_774 | 174 |
| 451 | 3300046511 | Ga0495608_0197555 | Ga0495608_0197555_321_845 | 174 |
| 452 | 3300046516 | Ga0495628_0272718 | Ga0495628_0272718_194_718 | 174 |
| 453 | 3300046517 | Ga0495630_0019101 | Ga0495630_0019101_451_975 | 174 |
| 454 | 3300046517 | Ga0495630_0135727 | Ga0495630_0135727_322_846 | 174 |
| 455 | 3300046517 | Ga0495630_0280285 | Ga0495630_0280285_40_564 | 174 |
| 456 | 3300046517 | Ga0495630_0349480 | Ga0495630_0349480_28_552 | 174 |
| 457 | 3300046528 | Ga0495642_0172147 | Ga0495642_0172147_90_629 | 174 |
| 458 | 3300046529 | Ga0495652_0120770 | Ga0495652_0120770_737_1261 | 174 |
| 459 | 3300046529 | Ga0495652_0308398 | Ga0495652_0308398_607_1131 | 174 |
| 460 | 3300046531 | Ga0495665_0015138 | Ga0495665_0015138_363_887 | 174 |
| 461 | 3300046531 | Ga0495665_0074893 | Ga0495665_0074893_575_1111 | 174 |
| 462 | 3300046533 | Ga0495640_0058754 | Ga0495640_0058754_944_1468 | 174 |
| 463 | 3300046533 | Ga0495640_0079215 | Ga0495640_0079215_362_886 | 174 |
| 464 | 3300046533 | Ga0495640_0793542 | Ga0495640_0793542_15_539 | 174 |
| 465 | 3300046536 | Ga0495587_0001345 | Ga0495587_0001345_12055_12579 | 174 |
| 466 | 3300046536 | Ga0495587_0206200 | Ga0495587_0206200_567_1091 | 174 |
| 467 | 3300046543 | Ga0495645_0000591 | Ga0495645_0000591_10641_11165 | 174 |
| 468 | 3300046543 | Ga0495645_0046224 | Ga0495645_0046224_1066_1590 | 174 |
| 469 | 3300046543 | Ga0495645_0144752 | Ga0495645_0144752_332_856 | 174 |
| 470 | 3300046559 | Ga0495667_0046495 | Ga0495667_0046495_2036_2560 | 174 |
| 471 | 3300046559 | Ga0495667_0088654 | Ga0495667_0088654_864_1388 | 174 |
| 472 | 3300046559 | Ga0495667_0122993 | Ga0495667_0122993_535_1059 | 174 |
| 473 | 3300046642 | Ga0495634_0028366 | Ga0495634_0028366_1625_2149 | 174 |
| 474 | 3300046642 | Ga0495634_0167570 | Ga0495634_0167570_32_556 | 174 |
| 475 | 3300046663 | Ga0495635_0094498 | Ga0495635_0094498_1272_1796 | 174 |
| 476 | 3300046674 | Ga0495588_0145822 | Ga0495588_0145822_484_1008 | 174 |
| 477 | 3300046678 | Ga0495599_0003629 | Ga0495599_0003629_2429_2953 | 174 |
| 478 | 3300046679 | Ga0495623_0002264 | Ga0495623_0002264_7893_8417 | 174 |
| 479 | 3300046680 | Ga0495646_0044425 | Ga0495646_0044425_85_609 | 174 |
| 480 | 3300046680 | Ga0495646_0092411 | Ga0495646_0092411_924_1448 | 174 |
| 481 | 3300046683 | Ga0495658_0028304 | Ga0495658_0028304_1326_1850 | 174 |
| 482 | 3300046683 | Ga0495658_0392431 | Ga0495658_0392431_97_633 | 174 |
| 483 | 3300046689 | Ga0495613_0394629 | Ga0495613_0394629_329_853 | 174 |
| 484 | 3300046689 | Ga0495613_0432359 | Ga0495613_0432359_218_742 | 174 |
| 485 | 3300046809 | Ga0495600_0040605 | Ga0495600_0040605_1141_1665 | 174 |
| 486 | 3300047315 | Ga0495581_0006434 | Ga0495581_0006434_1485_2009 | 174 |
| 487 | 3300047315 | Ga0495581_0014508 | Ga0495581_0014508_3219_3755 | 174 |
| 488 | 3300047315 | Ga0495581_0069314 | Ga0495581_0069314_796_1332 | 174 |
| 489 | 3300047315 | Ga0495581_0190631 | Ga0495581_0190631_33_557 | 174 |
| 490 | 3300047317 | Ga0495604_0023776 | Ga0495604_0023776_4237_4761 | 174 |
| 491 | 3300047319 | Ga0495674_0106773 | Ga0495674_0106773_1543_2067 | 174 |
| 492 | 3300047319 | Ga0495674_0126375 | Ga0495674_0126375_1154_1678 | 174 |
| 493 | 3300047319 | Ga0495674_0211420 | Ga0495674_0211420_1054_1578 | 174 |
| 494 | 3300047320 | Ga0495672_0007338 | Ga0495672_0007338_1560_2084 | 174 |
| 495 | 3300047322 | Ga0495680_0639940 | Ga0495680_0639940_21_545 | 174 |
| 496 | 3300047444 | Ga0495675_0005472 | Ga0495675_0005472_2487_3011 | 174 |
| 497 | 3300047444 | Ga0495675_0022368 | Ga0495675_0022368_3246_3770 | 174 |
| 498 | 3300047444 | Ga0495675_0067056 | Ga0495675_0067056_1649_2173 | 174 |
| 499 | 3300047471 | Ga0495684_0003259 | Ga0495684_0003259_6976_7500 | 174 |
| 500 | 3300047471 | Ga0495684_0005039 | Ga0495684_0005039_5004_5528 | 174 |
| 501 | 3300047471 | Ga0495684_0025296 | Ga0495684_0025296_1221_1757 | 174 |
| 502 | 3300047471 | Ga0495684_0041202 | Ga0495684_0041202_1593_2117 | 174 |
| 503 | 3300047673 | Ga0495593_0480032 | Ga0495593_0480032_42_566 | 174 |
| 504 | 3300048088 | Ga0495602_0003596 | Ga0495602_0003596_9272_9796 | 174 |
| 505 | 3300048088 | Ga0495602_0303178 | Ga0495602_0303178_539_1063 | 174 |
| 506 | 3300048089 | Ga0495614_0152567 | Ga0495614_0152567_354_890 | 174 |
| 507 | 3300048904 | Ga0496101_0662068 | Ga0496101_0662068_187_711 | 174 |
| 508 | 3300048904 | Ga0496101_0709850 | Ga0496101_0709850_34_642 | 174 |
| 509 | 3300048907 | Ga0496104_0024693 | Ga0496104_0024693_291_815 | 174 |
| 510 | 3300048907 | Ga0496104_0339650 | Ga0496104_0339650_296_820 | 174 |
| 511 | 3300048908 | Ga0496105_0308189 | Ga0496105_0308189_610_1134 | 174 |
| 512 | 3300048908 | Ga0496105_0406542 | Ga0496105_0406542_218_742 | 174 |
| 513 | 3300048909 | Ga0496106_0041635 | Ga0496106_0041635_106_657 | 174 |
| 514 | 3300048911 | Ga0496108_0012356 | Ga0496108_0012356_625_1149 | 174 |
| 515 | 3300048911 | Ga0496108_0323414 | Ga0496108_0323414_722_1246 | 174 |
| 516 | 3300048912 | Ga0496109_0001037 | Ga0496109_0001037_21824_22348 | 174 |
| 517 | 3300048912 | Ga0496109_0144307 | Ga0496109_0144307_954_1478 | 174 |
| 518 | 3300048913 | Ga0496110_0176244 | Ga0496110_0176244_607_1131 | 174 |
| 519 | 3300048913 | Ga0496110_0594054 | Ga0496110_0594054_455_979 | 174 |
| 520 | 3300048913 | Ga0496110_0954960 | Ga0496110_0954960_147_671 | 174 |
| 521 | 3300048914 | Ga0496111_0212075 | Ga0496111_0212075_868_1392 | 174 |
| 522 | 3300048915 | Ga0496112_0000129 | Ga0496112_0000129_18419_18943 | 174 |
| 523 | 3300048915 | Ga0496112_0050080 | Ga0496112_0050080_1261_1785 | 174 |
| 524 | 3300048915 | Ga0496112_0134629 | Ga0496112_0134629_180_704 | 174 |
| 525 | 3300048915 | Ga0496112_0146155 | Ga0496112_0146155_497_1048 | 174 |
| 526 | 3300048915 | Ga0496112_0600100 | Ga0496112_0600100_451_975 | 174 |
| 527 | 3300048916 | Ga0496113_0000062 | Ga0496113_0000062_18075_18599 | 174 |
| 528 | 3300048916 | Ga0496113_0282212 | Ga0496113_0282212_128_652 | 174 |
| 529 | 3300048917 | Ga0496114_1071186 | Ga0496114_1071186_122_646 | 174 |
| 530 | 3300049517 | Ga0501294_013978 | Ga0501294_013978_259_783 | 174 |
| 531 | 3300049521 | Ga0501298_004883 | Ga0501298_004883_1281_1805 | 174 |
| 532 | 3300049583 | Ga0501067_0151259 | Ga0501067_0151259_583_1110 | 174 |
| 533 | 3300049585 | Ga0501069_0314241 | Ga0501069_0314241_72_599 | 174 |
| 534 | 3300049593 | Ga0501077_0610395 | Ga0501077_0610395_136_678 | 174 |
| 535 | 3300049660 | Ga0501216_000925 | Ga0501216_000925_3066_3590 | 174 |
| 536 | 3300049661 | Ga0501217_002548 | Ga0501217_002548_1640_2164 | 174 |
| 537 | 3300049667 | Ga0501230_000515 | Ga0501230_000515_1352_1876 | 174 |
| 538 | 3300049669 | Ga0501235_000383 | Ga0501235_000383_4766_5290 | 174 |
| 539 | 3300049672 | Ga0501239_002706 | Ga0501239_002706_596_1120 | 174 |
| 540 | 3300049674 | Ga0501242_000318 | Ga0501242_000318_1499_2023 | 174 |
| 541 | 3300049679 | Ga0501249_011837 | Ga0501249_011837_865_1389 | 174 |
| 542 | 3300049679 | Ga0501249_029971 | Ga0501249_029971_174_698 | 174 |
| 543 | 3300049681 | Ga0501251_008581 | Ga0501251_008581_21_545 | 174 |
| 544 | 3300049686 | Ga0501257_007318 | Ga0501257_007318_1297_1821 | 174 |
| 545 | 3300049687 | Ga0501258_000403 | Ga0501258_000403_1686_2210 | 174 |
| 546 | 3300049705 | Ga0501225_0000567 | Ga0501225_0000567_6040_6564 | 174 |
| 547 | 3300049707 | Ga0501234_001484 | Ga0501234_001484_1552_2076 | 174 |
| 548 | 3300049765 | Ga0501268_000218 | Ga0501268_000218_1638_2162 | 174 |
| 549 | 3300049766 | Ga0501269_041133 | Ga0501269_041133_36_560 | 174 |
| 550 | 3300049769 | Ga0501272_000961 | Ga0501272_000961_550_1074 | 174 |
| 551 | 3300049772 | Ga0501275_009096 | Ga0501275_009096_213_737 | 174 |
| 552 | 3300050507 | nmdc:mga05p37_129673_c1 | nmdc:mga05p37_129673_c1_1749_2282 | 174 |
| 553 | 3300050507 | nmdc:mga05p37_1454562_c1 | nmdc:mga05p37_1454562_c1_70_594 | 174 |
| 554 | 3300050507 | nmdc:mga05p37_74710_c1 | nmdc:mga05p37_74710_c1_669_1202 | 174 |
| 555 | 3300050508 | nmdc:mga09592_43091_c1 | nmdc:mga09592_43091_c1_98_631 | 174 |
| 556 | 3300050510 | nmdc:mga06r32_354107_c1 | nmdc:mga06r32_354107_c1_189_722 | 174 |
| 557 | 3300050511 | nmdc:mga08y16_1154059_c1 | nmdc:mga08y16_1154059_c1_95_619 | 174 |
| 558 | 3300050511 | nmdc:mga08y16_188305_c1 | nmdc:mga08y16_188305_c1_283_810 | 174 |
| 559 | 3300050511 | nmdc:mga08y16_3729_c1 | nmdc:mga08y16_3729_c1_523_1050 | 174 |
| 560 | 3300050511 | nmdc:mga08y16_467602_c1 | nmdc:mga08y16_467602_c1_654_1181 | 174 |
| 561 | 3300050512 | nmdc:mga0n895_436296_c1 | nmdc:mga0n895_436296_c1_144_668 | 174 |
| 562 | 3300050514 | nmdc:mga08x19_5623_c1 | nmdc:mga08x19_5623_c1_3096_3620 | 174 |
| 563 | 3300050515 | nmdc:mga0a205_880773_c1 | nmdc:mga0a205_880773_c1_157_681 | 174 |
| 564 | 3300053077 | Ga0495601_0010964 | Ga0495601_0010964_1404_1928 | 174 |
| 565 | 3300053077 | Ga0495601_0085043 | Ga0495601_0085043_246_770 | 174 |
| 566 | 3300053078 | Ga0495612_0029121 | Ga0495612_0029121_719_1243 | 174 |
| 567 | 3300053085 | Ga0495619_0093698 | Ga0495619_0093698_236_760 | 174 |
| 568 | 3300053085 | Ga0495619_0099901 | Ga0495619_0099901_1431_1955 | 174 |
| 569 | 3300061734 | Ga0530510_0666377 | Ga0530510_0666377_212_739 | 174 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rd9-assembly3.cif.gz_B | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.9339 | 1 | 174 |
| 2rd9-assembly1.cif.gz_A | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.9173 | 1 | 174 |
| 2rd9-assembly1.cif.gz_A | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.9124 | 1 | 174 |
| 2rd9-assembly3.cif.gz_B | crystal structure of a putative yfit-like metal-dependent hydrolase (bh0186) from bacillus halodurans c-125 at 2.30 a resolution | 0.8976 | 1 | 174 |
| 1rxq-assembly1.cif.gz_B | yfit from bacillus subtilis is a probable metal-dependent hydrolase with an unusual four-helix bundle topology | 0.8459 | 2 | 157 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rd9B01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.9419 | 1 | 170 | 1.20.120.450 |
| 2rd9B01 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8892 | 1 | 170 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.8104 | 2 | 157 | 1.20.120.450 |
| 1rxqD00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7575 | 2 | 157 | 1.20.120.450 |
| 2yqyB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);dinb family like domain | 0.7383 | 4 | 150 | 1.20.120.450 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V7X7A1-F1-model_v4 | DinB-like domain-containing protein | 0.9989 | 23 | 172 |
|
| AF-A0A2V7T694-F1-model_v4 | DinB-like domain-containing protein | 0.9955 | 23 | 173 |
|
| AF-A0A2D6AME1-F1-model_v4 | DinB-like domain-containing protein | 0.9949 | 1 | 172 |
|
| AF-A0A2V9UE62-F1-model_v4 | DinB-like domain-containing protein | 0.9949 | 1 | 142 |
|
| AF-A0A2V5SA27-F1-model_v4 | DinB-like domain-containing protein | 0.9948 | 45 | 174 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar