F464571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 259 | 1134 | 288 |
Family's Representative Sequence
| Representative Sequence | 3300053156|Ga0500622_0000921|Ga0500622_0000921_3178_4143 |
| Length | 321 |
| Sequence | MNQATNQTMTIGNAERYASHEGHESRALADDVLASPPVRASGLRVDFKGQPGVLAGLDWTLAPGQVVGLLGRNGAGKTTLLETLLGLREPQGGEVLLFGQPALTPDDALRARLGYVPQQAALFEDFLAGDLLRYFRSFYARWNDAKVDGLMSRWEIPRDRRVGQLSQGQQQRLSIIRALAHEPDLLVLDEPVASLDPVGRRDFLRELVDQVLDRGTTVVFSTHILSDLERVAFNIAFLSRGRIALQAPQDVLAEEIRLLAGPVGRLQAAVDAHGGQVLSRRDLGERPRWLVRFADGNIPQSDAVLRCEPLSLEDLFLELTQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 5 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 8 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 9 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 12 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 17 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 18 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 19 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 21 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 28 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 34 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 35 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 37 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 38 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 39 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 40 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 41 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 42 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 43 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 44 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300012475 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 | Metagenome | Rhizosphere |
| 46 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 47 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 48 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 49 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 50 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 51 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 53 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 54 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 60 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 61 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 62 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 63 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 64 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 66 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 68 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 69 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 70 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 71 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 93 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 94 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 95 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 97 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 98 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 99 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 100 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 101 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 102 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 104 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 105 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 106 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 107 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 108 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 109 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 110 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 111 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 112 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 113 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 114 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 115 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 116 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 117 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 118 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 119 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 120 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 121 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 122 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 123 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 124 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 125 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 126 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 127 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 128 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 129 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 130 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 131 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 132 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 133 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 134 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 135 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 136 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 137 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 138 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 139 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 140 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 141 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 142 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 143 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 144 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 145 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 146 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 147 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 148 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 225 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 226 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 227 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 228 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 229 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 234 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300049658 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought | Metagenome | Rhizosphere |
| 237 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 239 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 240 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 241 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 242 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 244 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 245 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 246 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 247 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 248 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 249 | 2643221544 | Pelomonas sp. Root1444 | Isolate | Unclassified |
| 250 | 2643221585 | Pelomonas sp. Root662 | Isolate | Unclassified |
| 251 | 2643221639 | Pelomonas sp. Root1217 | Isolate | Unclassified |
| 252 | 2643221646 | Pelomonas sp. Root1237 | Isolate | Unclassified |
| 253 | 2643221656 | Pelomonas sp. Root405 | Isolate | Unclassified |
| 254 | 2738541337 | Pelomonas sp. BT06 | Isolate | Unclassified |
| 255 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 256 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 257 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 258 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 259 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.06 |
| Metatranscriptomes | 0 |
| Isolates | 1.94 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.64 |
| Nodule | 1.06 |
| Rhizoplane | 1.94 |
| Rhizosphere | 74.96 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500622_0000921 | 3300053156 | Bacteria | 24968 |
| 2 | JGI25156J39149_1000218 | 3300002705 | Bacteria | 39862 |
| 3 | JGI25154J39366_1000340 | 3300002738 | Bacteria | 26958 |
| 4 | JGI25154J39366_1003707 | 3300002738 | Bacteria | 3060 |
| 5 | JGI25157J39369_1000018 | 3300002741 | Bacteria | 177410 |
| 6 | JGI25150J39212_1006993 | 3300002774 | Bacteria | 2293 |
| 7 | JGI25153J46596_10026164 | 3300003215 | Bacteria | 2071 |
| 8 | rootH1_10007910 | 3300003316 | Bacteria | 10718 |
| 9 | rootH1_10014334 | 3300003316 | Bacteria | 20021 |
| 10 | rootH1_10015244 | 3300003316 | Bacteria | 4624 |
| 11 | rootH1_10043190 | 3300003316 | Bacteria | 3275 |
| 12 | rootH2_10041163 | 3300003320 | Bacteria | 7241 |
| 13 | rootL2_10000355 | 3300003322 | Bacteria | 68136 |
| 14 | rootL2_10003893 | 3300003322 | Bacteria | 19760 |
| 15 | rootL2_10004528 | 3300003322 | Bacteria | 29873 |
| 16 | rootL2_10026363 | 3300003322 | Bacteria | 11237 |
| 17 | rootL2_10058409 | 3300003322 | Bacteria | 7163 |
| 18 | rootL2_10058410 | 3300003322 | Bacteria | 3704 |
| 19 | rootL2_10066771 | 3300003322 | Bacteria | 4740 |
| 20 | rootH1_10001551 | 3300003323 | Bacteria | 9463 |
| 21 | rootH1_10007488 | 3300003323 | Bacteria | 17583 |
| 22 | rootH1_10056027 | 3300003323 | Bacteria | 6752 |
| 23 | rootH1_10066620 | 3300003323 | Bacteria | 3700 |
| 24 | rootH1_10084380 | 3300003323 | Bacteria | 1123 |
| 25 | rootH1_10092016 | 3300003323 | Bacteria | 3971 |
| 26 | Ga0055539_1000240 | 3300003752 | Bacteria | 36494 |
| 27 | Ga0055539_1000791 | 3300003752 | Bacteria | 7539 |
| 28 | Ga0055533_1000103 | 3300003756 | Bacteria | 107860 |
| 29 | Ga0055525_1000013 | 3300003759 | Bacteria | 440870 |
| 30 | Ga0055535_1000087 | 3300003761 | Bacteria | 102655 |
| 31 | Ga0055529_1000032 | 3300003763 | Bacteria | 255895 |
| 32 | Ga0055529_1000139 | 3300003763 | Bacteria | 102943 |
| 33 | Ga0055526_1000320 | 3300003771 | Bacteria | 39805 |
| 34 | Ga0055526_1000430 | 3300003771 | Bacteria | 33723 |
| 35 | Ga0055526_1005697 | 3300003771 | Bacteria | 7062 |
| 36 | Ga0055524_1000003 | 3300003775 | Bacteria | 399748 |
| 37 | Ga0055524_1000479 | 3300003775 | Bacteria | 31779 |
| 38 | Ga0055524_1000490 | 3300003775 | Bacteria | 31117 |
| 39 | Ga0055524_1008098 | 3300003775 | Bacteria | 4393 |
| 40 | Ga0055531_10000022 | 3300003794 | Bacteria | 166362 |
| 41 | Ga0055531_10001050 | 3300003794 | Bacteria | 21793 |
| 42 | Ga0055543_1002108 | 3300004625 | Bacteria | 6905 |
| 43 | Ga0065165_1000079 | 3300005262 | Bacteria | 162095 |
| 44 | Ga0070658_10159080 | 3300005327 | Bacteria | 1894 |
| 45 | Ga0070658_10395357 | 3300005327 | Bacteria | 1187 |
| 46 | Ga0070658_10535885 | 3300005327 | Bacteria | 1013 |
| 47 | Ga0070690_100093821 | 3300005330 | Bacteria | 1980 |
| 48 | Ga0068869_100130835 | 3300005334 | Bacteria | 1929 |
| 49 | Ga0070682_100023330 | 3300005337 | Bacteria | 3672 |
| 50 | Ga0070682_100141983 | 3300005337 | Bacteria | 1638 |
| 51 | Ga0070660_100136499 | 3300005339 | Bacteria | 1965 |
| 52 | Ga0070673_100291513 | 3300005364 | Bacteria | 1434 |
| 53 | Ga0068867_100117105 | 3300005459 | Bacteria | 2054 |
| 54 | Ga0070684_100063392 | 3300005535 | Bacteria | 3240 |
| 55 | Ga0068855_100002529 | 3300005563 | Bacteria | 22530 |
| 56 | Ga0068855_100101470 | 3300005563 | Bacteria | 3313 |
| 57 | Ga0068855_100471430 | 3300005563 | Bacteria | 1367 |
| 58 | Ga0068857_100001688 | 3300005577 | Bacteria | 17742 |
| 59 | Ga0068856_100145377 | 3300005614 | Bacteria | 2379 |
| 60 | Ga0068852_100127424 | 3300005616 | Bacteria | 2340 |
| 61 | Ga0068861_100026072 | 3300005719 | Bacteria | 4246 |
| 62 | Ga0068860_100011524 | 3300005843 | Bacteria | 8716 |
| 63 | Ga0070717_10112959 | 3300006028 | Bacteria | 2319 |
| 64 | Ga0075366_10003557 | 3300006195 | Bacteria | 8241 |
| 65 | Ga0075366_10276070 | 3300006195 | Bacteria | 1027 |
| 66 | Ga0075370_10016522 | 3300006353 | Bacteria | 3971 |
| 67 | Ga0075370_10027510 | 3300006353 | Bacteria | 3156 |
| 68 | Ga0099823_1000002 | 3300006944 | Bacteria | 212272 |
| 69 | Ga0099826_10000002 | 3300006948 | Bacteria | 1125830 |
| 70 | Ga0105240_10041904 | 3300009093 | Bacteria | 5838 |
| 71 | Ga0105240_10108853 | 3300009093 | Bacteria | 3356 |
| 72 | Ga0105243_10022566 | 3300009148 | Bacteria | 4785 |
| 73 | Ga0105242_10195460 | 3300009176 | Bacteria | 1793 |
| 74 | Ga0105242_10203544 | 3300009176 | Bacteria | 1760 |
| 75 | Ga0105238_10120500 | 3300009551 | Bacteria | 2603 |
| 76 | Ga0105239_10079521 | 3300010375 | Bacteria | 3607 |
| 77 | Ga0157317_1003366 | 3300012475 | Bacteria | 993 |
| 78 | Ga0157319_1000007 | 3300012497 | Bacteria | 318528 |
| 79 | Ga0157371_10000077 | 3300013102 | Bacteria | 157429 |
| 80 | Ga0157369_10034309 | 3300013105 | Bacteria | 5570 |
| 81 | Ga0157372_10097273 | 3300013307 | Bacteria | 3356 |
| 82 | Ga0157372_10354207 | 3300013307 | Bacteria | 1710 |
| 83 | Ga0163163_10369838 | 3300014325 | Bacteria | 1490 |
| 84 | Ga0157379_10015004 | 3300014968 | Bacteria | 6796 |
| 85 | Ga0182005_1000037 | 3300015265 | Bacteria | 166102 |
| 86 | Ga0213872_10000008 | 3300021361 | Bacteria | 226283 |
| 87 | Ga0213872_10000127 | 3300021361 | Bacteria | 69204 |
| 88 | Ga0213872_10000683 | 3300021361 | Bacteria | 25720 |
| 89 | Ga0213872_10011112 | 3300021361 | Bacteria | 4266 |
| 90 | Ga0213872_10014422 | 3300021361 | Bacteria | 3687 |
| 91 | Ga0209674_100003 | 3300025226 | Bacteria | 2196646 |
| 92 | Ga0209672_103728 | 3300025228 | Bacteria | 3042 |
| 93 | Ga0209563_100025 | 3300025230 | Bacteria | 596456 |
| 94 | Ga0209563_100141 | 3300025230 | Bacteria | 79513 |
| 95 | Ga0207427_102220 | 3300025231 | Bacteria | 5490 |
| 96 | Ga0209258_100044 | 3300025242 | Bacteria | 376336 |
| 97 | Ga0209258_100531 | 3300025242 | Bacteria | 36288 |
| 98 | Ga0209258_105996 | 3300025242 | Bacteria | 1961 |
| 99 | Ga0207425_1000245 | 3300025245 | Bacteria | 41275 |
| 100 | Ga0209646_1000051 | 3300025246 | Bacteria | 296525 |
| 101 | Ga0209646_1000067 | 3300025246 | Bacteria | 241595 |
| 102 | Ga0209026_1000033 | 3300025250 | Bacteria | 318512 |
| 103 | Ga0209677_100293 | 3300025253 | Bacteria | 32941 |
| 104 | Ga0209677_100339 | 3300025253 | Bacteria | 29853 |
| 105 | Ga0209677_104350 | 3300025253 | Bacteria | 4128 |
| 106 | Ga0209759_1000024 | 3300025256 | Bacteria | 318512 |
| 107 | Ga0209759_1006309 | 3300025256 | Bacteria | 4004 |
| 108 | Ga0209759_1015591 | 3300025256 | Bacteria | 1954 |
| 109 | Ga0209455_1000043 | 3300025272 | Bacteria | 413928 |
| 110 | Ga0209455_1000048 | 3300025272 | Bacteria | 376260 |
| 111 | Ga0209673_1014611 | 3300025273 | Bacteria | 3030 |
| 112 | Ga0209673_1019225 | 3300025273 | Bacteria | 2459 |
| 113 | Ga0209025_1010537 | 3300025294 | Bacteria | 6252 |
| 114 | Ga0209564_1000011 | 3300025295 | Bacteria | 822327 |
| 115 | Ga0209564_1000030 | 3300025295 | Bacteria | 503296 |
| 116 | Ga0209564_1000089 | 3300025295 | Bacteria | 249694 |
| 117 | Ga0209758_1004343 | 3300025297 | Bacteria | 11876 |
| 118 | Ga0209050_1002079 | 3300025298 | Bacteria | 18358 |
| 119 | Ga0209050_1006524 | 3300025298 | Bacteria | 6875 |
| 120 | Ga0209256_1000007 | 3300025299 | Bacteria | 1136599 |
| 121 | Ga0209256_1000154 | 3300025299 | Bacteria | 144509 |
| 122 | Ga0209256_1000659 | 3300025299 | Bacteria | 46883 |
| 123 | Ga0209256_1025868 | 3300025299 | Bacteria | 1702 |
| 124 | Ga0209051_1002564 | 3300025303 | Bacteria | 12827 |
| 125 | Ga0209051_1002662 | 3300025303 | Bacteria | 12493 |
| 126 | Ga0209257_1000061 | 3300025304 | Bacteria | 367698 |
| 127 | Ga0209257_1001047 | 3300025304 | Bacteria | 36766 |
| 128 | Ga0207655_1017254 | 3300025728 | Bacteria | 3901 |
| 129 | Ga0207705_10072458 | 3300025909 | Bacteria | 2499 |
| 130 | Ga0207705_10110400 | 3300025909 | Bacteria | 2032 |
| 131 | Ga0207695_10022513 | 3300025913 | Bacteria | 7150 |
| 132 | Ga0207695_10037598 | 3300025913 | Bacteria | 5222 |
| 133 | Ga0207695_10246802 | 3300025913 | Bacteria | 1685 |
| 134 | Ga0207671_10482032 | 3300025914 | Bacteria | 988 |
| 135 | Ga0207657_10007109 | 3300025919 | Bacteria | 11497 |
| 136 | Ga0207694_10024369 | 3300025924 | Bacteria | 4595 |
| 137 | Ga0207686_10049096 | 3300025934 | Bacteria | 2618 |
| 138 | Ga0207686_10114828 | 3300025934 | Bacteria | 1823 |
| 139 | Ga0207709_10020352 | 3300025935 | Bacteria | 3742 |
| 140 | Ga0207709_10068913 | 3300025935 | Bacteria | 2237 |
| 141 | Ga0207709_10300816 | 3300025935 | Bacteria | 1193 |
| 142 | Ga0207704_10259028 | 3300025938 | Bacteria | 1310 |
| 143 | Ga0207689_10129109 | 3300025942 | Bacteria | 2080 |
| 144 | Ga0207667_10021616 | 3300025949 | Bacteria | 7127 |
| 145 | Ga0207667_10109599 | 3300025949 | Bacteria | 2847 |
| 146 | Ga0207667_10302821 | 3300025949 | Bacteria | 1633 |
| 147 | Ga0207667_10346337 | 3300025949 | Bacteria | 1516 |
| 148 | Ga0207651_10016670 | 3300025960 | Bacteria | 4313 |
| 149 | Ga0207640_10001453 | 3300025981 | Bacteria | 12813 |
| 150 | Ga0207639_10314482 | 3300026041 | Bacteria | 1388 |
| 151 | Ga0207678_10258077 | 3300026067 | Bacteria | 1493 |
| 152 | Ga0207702_10040381 | 3300026078 | Bacteria | 3912 |
| 153 | Ga0207702_10082723 | 3300026078 | Bacteria | 2792 |
| 154 | Ga0207648_10155551 | 3300026089 | Bacteria | 2018 |
| 155 | Ga0207674_10013645 | 3300026116 | Bacteria | 8998 |
| 156 | Ga0207674_10077253 | 3300026116 | Bacteria | 3336 |
| 157 | Ga0207674_10538835 | 3300026116 | Bacteria | 1128 |
| 158 | Ga0207675_100170901 | 3300026118 | Bacteria | 2077 |
| 159 | Ga0209281_1011276 | 3300027111 | Bacteria | 2007 |
| 160 | Ga0209389_1000340 | 3300027296 | Bacteria | 28501 |
| 161 | Ga0209282_1000001 | 3300027666 | Bacteria | 2450367 |
| 162 | Ga0268264_10078009 | 3300028381 | Bacteria | 2823 |
| 163 | Ga0265336_10000053 | 3300028666 | Bacteria | 113034 |
| 164 | Ga0307515_10042541 | 3300028794 | Bacteria | 7101 |
| 165 | Ga0307515_10099223 | 3300028794 | Bacteria | 3538 |
| 166 | Ga0307515_10198674 | 3300028794 | Bacteria | 1889 |
| 167 | Ga0265324_10000132 | 3300029957 | Bacteria | 58866 |
| 168 | Ga0307512_10013050 | 3300030522 | Bacteria | 7806 |
| 169 | Ga0316177_1113771 | 3300030731 | Bacteria | 2358 |
| 170 | Ga0316180_1171083 | 3300030736 | Bacteria | 1342 |
| 171 | Ga0265328_10007408 | 3300031239 | Bacteria | 4574 |
| 172 | Ga0265331_10002254 | 3300031250 | Bacteria | 13195 |
| 173 | Ga0265327_10000309 | 3300031251 | Bacteria | 94387 |
| 174 | Ga0307509_10000135 | 3300031507 | Bacteria | 109066 |
| 175 | Ga0307509_10042110 | 3300031507 | Bacteria | 4951 |
| 176 | Ga0307509_10044925 | 3300031507 | Bacteria | 4769 |
| 177 | Ga0307408_100000006 | 3300031548 | Bacteria | 472824 |
| 178 | Ga0307408_100000010 | 3300031548 | Bacteria | 420048 |
| 179 | Ga0307408_100006745 | 3300031548 | Bacteria | 7609 |
| 180 | Ga0307508_10032855 | 3300031616 | Bacteria | 4685 |
| 181 | Ga0307514_10122887 | 3300031649 | Bacteria | 1806 |
| 182 | Ga0307516_10021704 | 3300031730 | Bacteria | 6601 |
| 183 | Ga0307411_10000146 | 3300032005 | Bacteria | 22416 |
| 184 | Ga0307507_10039139 | 3300033179 | Bacteria | 4791 |
| 185 | Ga0307510_10003036 | 3300033180 | Bacteria | 19364 |
| 186 | Ga0307510_10010819 | 3300033180 | Bacteria | 10846 |
| 187 | Ga0373950_0003785 | 3300034818 | Bacteria | 2188 |
| 188 | Ga0373934_0051111 | 3300035086 | Bacteria | 1638 |
| 189 | Ga0373940_0010265 | 3300035088 | Bacteria | 2197 |
| 190 | Ga0373939_0000157 | 3300035114 | Bacteria | 18940 |
| 191 | Ga0373960_0000353 | 3300035121 | Bacteria | 8883 |
| 192 | Ga0373961_0022987 | 3300035241 | Bacteria | 1673 |
| 193 | Ga0373931_0043937 | 3300035691 | Bacteria | 2355 |
| 194 | Ga0373931_0401244 | 3300035691 | Bacteria | 868 |
| 195 | Ga0395899_0023228 | 3300037312 | Bacteria | 4701 |
| 196 | Ga0395900_0000054 | 3300037418 | Bacteria | 220487 |
| 197 | Ga0395900_0026912 | 3300037418 | Bacteria | 5886 |
| 198 | Ga0395898_0001324 | 3300037466 | Bacteria | 35935 |
| 199 | Ga0395898_0008499 | 3300037466 | Bacteria | 10846 |
| 200 | Ga0395898_0056911 | 3300037466 | Bacteria | 3810 |
| 201 | Ga0395905_0002699 | 3300037471 | Bacteria | 19454 |
| 202 | Ga0395905_0051256 | 3300037471 | Bacteria | 3865 |
| 203 | Ga0395905_0074275 | 3300037471 | Bacteria | 3186 |
| 204 | Ga0395905_0147103 | 3300037471 | Bacteria | 2217 |
| 205 | Ga0395901_0004830 | 3300038443 | Bacteria | 13599 |
| 206 | Ga0395901_0147855 | 3300038443 | Bacteria | 2469 |
| 207 | Ga0436361_0126586 | 3300039447 | Bacteria | 4704 |
| 208 | Ga0436361_0144792 | 3300039447 | Bacteria | 34252 |
| 209 | Ga0436361_0148536 | 3300039447 | Bacteria | 3857 |
| 210 | Ga0436361_0356304 | 3300039447 | Bacteria | 5683 |
| 211 | Ga0436361_0362312 | 3300039447 | Bacteria | 55943 |
| 212 | Ga0439454_009076 | 3300042011 | Bacteria | 1285 |
| 213 | Ga0450888_000383 | 3300042126 | Bacteria | 4182 |
| 214 | Ga0450891_000565 | 3300042129 | Bacteria | 3848 |
| 215 | Ga0450892_000489 | 3300042130 | Bacteria | 4574 |
| 216 | Ga0450904_000159 | 3300042139 | Bacteria | 14788 |
| 217 | Ga0439459_0028409 | 3300042438 | Bacteria | 1122 |
| 218 | Ga0450916_012272 | 3300042530 | Bacteria | 1092 |
| 219 | Ga0451577_0003749 | 3300042876 | Bacteria | 16566 |
| 220 | Ga0451577_0003877 | 3300042876 | Bacteria | 16213 |
| 221 | Ga0466969_0000029 | 3300044656 | Bacteria | 92006 |
| 222 | Ga0466969_0038270 | 3300044656 | Bacteria | 2415 |
| 223 | Ga0466965_0002529 | 3300044683 | Bacteria | 7800 |
| 224 | Ga0466965_0005451 | 3300044683 | Bacteria | 5734 |
| 225 | Ga0466966_0026394 | 3300044684 | Bacteria | 3791 |
| 226 | Ga0466961_0109647 | 3300044693 | Bacteria | 1737 |
| 227 | Ga0466963_0027186 | 3300044694 | Bacteria | 3662 |
| 228 | Ga0466964_0013162 | 3300044706 | Bacteria | 3136 |
| 229 | Ga0453684_0297692 | 3300044712 | Bacteria | 1835 |
| 230 | Ga0453684_0428084 | 3300044712 | Bacteria | 1477 |
| 231 | Ga0466971_0008714 | 3300044719 | Bacteria | 4425 |
| 232 | Ga0466970_0009189 | 3300044765 | Bacteria | 4987 |
| 233 | Ga0466970_0047072 | 3300044765 | Bacteria | 2298 |
| 234 | Ga0466970_0102217 | 3300044765 | Bacteria | 1561 |
| 235 | Ga0466957_0013563 | 3300044842 | Bacteria | 4729 |
| 236 | Ga0466959_0002381 | 3300045049 | Bacteria | 11985 |
| 237 | Ga0466959_0202491 | 3300045049 | Bacteria | 1381 |
| 238 | Ga0451576_0069862 | 3300045051 | Bacteria | 3655 |
| 239 | Ga0451576_0163375 | 3300045051 | Bacteria | 2324 |
| 240 | Ga0466958_0242967 | 3300045836 | Bacteria | 1150 |
| 241 | Ga0466967_0031462 | 3300045976 | Bacteria | 4467 |
| 242 | Ga0466967_0053715 | 3300045976 | Bacteria | 3542 |
| 243 | Ga0466967_0054304 | 3300045976 | Bacteria | 3525 |
| 244 | Ga0466967_0170719 | 3300045976 | Bacteria | 2046 |
| 245 | Ga0495617_000108 | 3300046452 | Bacteria | 60724 |
| 246 | Ga0495627_000249 | 3300046453 | Bacteria | 55885 |
| 247 | Ga0495603_0033689 | 3300046455 | Bacteria | 3081 |
| 248 | Ga0495603_0073856 | 3300046455 | Bacteria | 2003 |
| 249 | Ga0495590_0000002 | 3300046457 | Bacteria | 485720 |
| 250 | Ga0495590_0000263 | 3300046457 | Bacteria | 28597 |
| 251 | Ga0495590_0046751 | 3300046457 | Bacteria | 1510 |
| 252 | Ga0495591_000132 | 3300046458 | Bacteria | 81947 |
| 253 | Ga0495629_0007599 | 3300046459 | Bacteria | 7987 |
| 254 | Ga0495638_0000367 | 3300046460 | Bacteria | 55964 |
| 255 | Ga0495638_0013166 | 3300046460 | Bacteria | 5643 |
| 256 | Ga0495653_0000023 | 3300046463 | Bacteria | 166207 |
| 257 | Ga0495653_0020939 | 3300046463 | Bacteria | 5298 |
| 258 | Ga0495653_0038430 | 3300046463 | Bacteria | 3757 |
| 259 | Ga0495653_0047587 | 3300046463 | Bacteria | 3316 |
| 260 | Ga0495650_0000001 | 3300046471 | Bacteria | 1085492 |
| 261 | Ga0495650_0000019 | 3300046471 | Bacteria | 533849 |
| 262 | Ga0495650_0000521 | 3300046471 | Bacteria | 56415 |
| 263 | Ga0495650_0000618 | 3300046471 | Bacteria | 48166 |
| 264 | Ga0495650_0000933 | 3300046471 | Bacteria | 33909 |
| 265 | Ga0495650_0003941 | 3300046471 | Bacteria | 10457 |
| 266 | Ga0495650_0008822 | 3300046471 | Bacteria | 5826 |
| 267 | Ga0495650_0009101 | 3300046471 | Bacteria | 5693 |
| 268 | Ga0495650_0009787 | 3300046471 | Bacteria | 5419 |
| 269 | Ga0495650_0014959 | 3300046471 | Bacteria | 4004 |
| 270 | Ga0495650_0026018 | 3300046471 | Bacteria | 2730 |
| 271 | Ga0495580_0022635 | 3300046472 | Bacteria | 4622 |
| 272 | Ga0495580_0110002 | 3300046472 | Bacteria | 1913 |
| 273 | Ga0495580_0150904 | 3300046472 | Bacteria | 1610 |
| 274 | Ga0495582_0038139 | 3300046473 | Bacteria | 2643 |
| 275 | Ga0495582_0118395 | 3300046473 | Bacteria | 1491 |
| 276 | Ga0495605_0000028 | 3300046474 | Bacteria | 218471 |
| 277 | Ga0495605_0000407 | 3300046474 | Bacteria | 39381 |
| 278 | Ga0495605_0010717 | 3300046474 | Bacteria | 5123 |
| 279 | Ga0495639_0007458 | 3300046475 | Bacteria | 4695 |
| 280 | Ga0495639_0093404 | 3300046475 | Bacteria | 1414 |
| 281 | Ga0495584_0000487 | 3300046491 | Bacteria | 27306 |
| 282 | Ga0495584_0036699 | 3300046491 | Bacteria | 2476 |
| 283 | Ga0495584_0118985 | 3300046491 | Bacteria | 1337 |
| 284 | Ga0495585_0003243 | 3300046492 | Bacteria | 11094 |
| 285 | Ga0495585_0009831 | 3300046492 | Bacteria | 5721 |
| 286 | Ga0495585_0018215 | 3300046492 | Bacteria | 4052 |
| 287 | Ga0495585_0027266 | 3300046492 | Bacteria | 3259 |
| 288 | Ga0495585_0028076 | 3300046492 | Bacteria | 3211 |
| 289 | Ga0495585_0033664 | 3300046492 | Bacteria | 2900 |
| 290 | Ga0495585_0202963 | 3300046492 | Bacteria | 1008 |
| 291 | Ga0495594_0069630 | 3300046499 | Bacteria | 1954 |
| 292 | Ga0495594_0079511 | 3300046499 | Bacteria | 1830 |
| 293 | Ga0495596_0002010 | 3300046500 | Bacteria | 11198 |
| 294 | Ga0495596_0003257 | 3300046500 | Bacteria | 8297 |
| 295 | Ga0495596_0005785 | 3300046500 | Bacteria | 5794 |
| 296 | Ga0495596_0006173 | 3300046500 | Bacteria | 5552 |
| 297 | Ga0495596_0008015 | 3300046500 | Bacteria | 4723 |
| 298 | Ga0495596_0055070 | 3300046500 | Bacteria | 1554 |
| 299 | Ga0495607_0001994 | 3300046501 | Bacteria | 17177 |
| 300 | Ga0495607_0004620 | 3300046501 | Bacteria | 10078 |
| 301 | Ga0495607_0006715 | 3300046501 | Bacteria | 8052 |
| 302 | Ga0495607_0007751 | 3300046501 | Bacteria | 7392 |
| 303 | Ga0495607_0114224 | 3300046501 | Bacteria | 1427 |
| 304 | Ga0495607_0175319 | 3300046501 | Bacteria | 1079 |
| 305 | Ga0495583_0000159 | 3300046506 | Bacteria | 113627 |
| 306 | Ga0495583_0000741 | 3300046506 | Bacteria | 41476 |
| 307 | Ga0495583_0000907 | 3300046506 | Bacteria | 35148 |
| 308 | Ga0495583_0001433 | 3300046506 | Bacteria | 24228 |
| 309 | Ga0495583_0003983 | 3300046506 | Bacteria | 10905 |
| 310 | Ga0495583_0014597 | 3300046506 | Bacteria | 4323 |
| 311 | Ga0495583_0061146 | 3300046506 | Bacteria | 1681 |
| 312 | Ga0495606_0000001 | 3300046507 | Bacteria | 592123 |
| 313 | Ga0495606_0000549 | 3300046507 | Bacteria | 60133 |
| 314 | Ga0495606_0000601 | 3300046507 | Bacteria | 57004 |
| 315 | Ga0495606_0001009 | 3300046507 | Bacteria | 40935 |
| 316 | Ga0495606_0003740 | 3300046507 | Bacteria | 15849 |
| 317 | Ga0495606_0003954 | 3300046507 | Bacteria | 15214 |
| 318 | Ga0495606_0005710 | 3300046507 | Bacteria | 11774 |
| 319 | Ga0495606_0010695 | 3300046507 | Bacteria | 7575 |
| 320 | Ga0495606_0017867 | 3300046507 | Bacteria | 5341 |
| 321 | Ga0495606_0090548 | 3300046507 | Bacteria | 1882 |
| 322 | Ga0495606_0220788 | 3300046507 | Bacteria | 1068 |
| 323 | Ga0495610_0000106 | 3300046512 | Bacteria | 97582 |
| 324 | Ga0495610_0001401 | 3300046512 | Bacteria | 21420 |
| 325 | Ga0495610_0002648 | 3300046512 | Bacteria | 14793 |
| 326 | Ga0495610_0003856 | 3300046512 | Bacteria | 11397 |
| 327 | Ga0495610_0004104 | 3300046512 | Bacteria | 10902 |
| 328 | Ga0495610_0012181 | 3300046512 | Bacteria | 5194 |
| 329 | Ga0495610_0019764 | 3300046512 | Bacteria | 3756 |
| 330 | Ga0495616_0000611 | 3300046513 | Bacteria | 26961 |
| 331 | Ga0495616_0004279 | 3300046513 | Bacteria | 9017 |
| 332 | Ga0495616_0007856 | 3300046513 | Bacteria | 6362 |
| 333 | Ga0495616_0041103 | 3300046513 | Bacteria | 2360 |
| 334 | Ga0495616_0140128 | 3300046513 | Bacteria | 1101 |
| 335 | Ga0495631_0004138 | 3300046518 | Bacteria | 7776 |
| 336 | Ga0495631_0006120 | 3300046518 | Bacteria | 6240 |
| 337 | Ga0495631_0008446 | 3300046518 | Bacteria | 5190 |
| 338 | Ga0495631_0009708 | 3300046518 | Bacteria | 4797 |
| 339 | Ga0495632_0000264 | 3300046519 | Bacteria | 52194 |
| 340 | Ga0495632_0000674 | 3300046519 | Bacteria | 31134 |
| 341 | Ga0495632_0002656 | 3300046519 | Bacteria | 13415 |
| 342 | Ga0495632_0009857 | 3300046519 | Bacteria | 5712 |
| 343 | Ga0495632_0013614 | 3300046519 | Bacteria | 4631 |
| 344 | Ga0495637_0000028 | 3300046520 | Bacteria | 144203 |
| 345 | Ga0495643_0000444 | 3300046522 | Bacteria | 53441 |
| 346 | Ga0495643_0000643 | 3300046522 | Bacteria | 41372 |
| 347 | Ga0495643_0015876 | 3300046522 | Bacteria | 4435 |
| 348 | Ga0495644_0003657 | 3300046523 | Bacteria | 6059 |
| 349 | Ga0495644_0003685 | 3300046523 | Bacteria | 6028 |
| 350 | Ga0495644_0013544 | 3300046523 | Bacteria | 3128 |
| 351 | Ga0495644_0037290 | 3300046523 | Bacteria | 1834 |
| 352 | Ga0495644_0052454 | 3300046523 | Bacteria | 1531 |
| 353 | Ga0495648_0000311 | 3300046524 | Bacteria | 53614 |
| 354 | Ga0495648_0000836 | 3300046524 | Bacteria | 32474 |
| 355 | Ga0495648_0002684 | 3300046524 | Bacteria | 16084 |
| 356 | Ga0495648_0010964 | 3300046524 | Bacteria | 6872 |
| 357 | Ga0495648_0032842 | 3300046524 | Bacteria | 3399 |
| 358 | Ga0495648_0038113 | 3300046524 | Bacteria | 3079 |
| 359 | Ga0495666_0000961 | 3300046526 | Bacteria | 13594 |
| 360 | Ga0495666_0003876 | 3300046526 | Bacteria | 7565 |
| 361 | Ga0495666_0004089 | 3300046526 | Bacteria | 7371 |
| 362 | Ga0495642_0000801 | 3300046528 | Bacteria | 15285 |
| 363 | Ga0495642_0002511 | 3300046528 | Bacteria | 7433 |
| 364 | Ga0495642_0003207 | 3300046528 | Bacteria | 6484 |
| 365 | Ga0495642_0007748 | 3300046528 | Bacteria | 4115 |
| 366 | Ga0495642_0020024 | 3300046528 | Bacteria | 2624 |
| 367 | Ga0495642_0028163 | 3300046528 | Bacteria | 2237 |
| 368 | Ga0495652_0017070 | 3300046529 | Bacteria | 6482 |
| 369 | Ga0495652_0033748 | 3300046529 | Bacteria | 4465 |
| 370 | Ga0495654_0000015 | 3300046530 | Bacteria | 307873 |
| 371 | Ga0495654_0001129 | 3300046530 | Bacteria | 19240 |
| 372 | Ga0495654_0009628 | 3300046530 | Bacteria | 5291 |
| 373 | Ga0495654_0012729 | 3300046530 | Bacteria | 4516 |
| 374 | Ga0495654_0068932 | 3300046530 | Bacteria | 1680 |
| 375 | Ga0495665_0009456 | 3300046531 | Bacteria | 5275 |
| 376 | Ga0495665_0020604 | 3300046531 | Bacteria | 3540 |
| 377 | Ga0495586_0021917 | 3300046535 | Bacteria | 3409 |
| 378 | Ga0495586_0046548 | 3300046535 | Bacteria | 2338 |
| 379 | Ga0495587_0044006 | 3300046536 | Bacteria | 2656 |
| 380 | Ga0495609_0001680 | 3300046538 | Bacteria | 14357 |
| 381 | Ga0495609_0002912 | 3300046538 | Bacteria | 10190 |
| 382 | Ga0495609_0015887 | 3300046538 | Bacteria | 3515 |
| 383 | Ga0495609_0098619 | 3300046538 | Bacteria | 1267 |
| 384 | Ga0495597_0000327 | 3300046542 | Bacteria | 43101 |
| 385 | Ga0495597_0001304 | 3300046542 | Bacteria | 18318 |
| 386 | Ga0495597_0002613 | 3300046542 | Bacteria | 11206 |
| 387 | Ga0495597_0055278 | 3300046542 | Bacteria | 1741 |
| 388 | Ga0495645_0075302 | 3300046543 | Bacteria | 2429 |
| 389 | Ga0495622_0000375 | 3300046557 | Bacteria | 30870 |
| 390 | Ga0495622_0000567 | 3300046557 | Bacteria | 22203 |
| 391 | Ga0495622_0101053 | 3300046557 | Bacteria | 1322 |
| 392 | Ga0495633_0000244 | 3300046558 | Bacteria | 65398 |
| 393 | Ga0495633_0004279 | 3300046558 | Bacteria | 9123 |
| 394 | Ga0495633_0004813 | 3300046558 | Bacteria | 8466 |
| 395 | Ga0495633_0006081 | 3300046558 | Bacteria | 7233 |
| 396 | Ga0495633_0012680 | 3300046558 | Bacteria | 4472 |
| 397 | Ga0495633_0023115 | 3300046558 | Bacteria | 3081 |
| 398 | Ga0495633_0028237 | 3300046558 | Bacteria | 2737 |
| 399 | Ga0495633_0049658 | 3300046558 | Bacteria | 1979 |
| 400 | Ga0495667_0155983 | 3300046559 | Bacteria | 1469 |
| 401 | Ga0495656_0001178 | 3300046615 | Bacteria | 8511 |
| 402 | Ga0495668_0000241 | 3300046616 | Bacteria | 78040 |
| 403 | Ga0495668_0000972 | 3300046616 | Bacteria | 31521 |
| 404 | Ga0495668_0001358 | 3300046616 | Bacteria | 24017 |
| 405 | Ga0495668_0001812 | 3300046616 | Bacteria | 19426 |
| 406 | Ga0495668_0006872 | 3300046616 | Bacteria | 7376 |
| 407 | Ga0495668_0038718 | 3300046616 | Bacteria | 2663 |
| 408 | Ga0495668_0060072 | 3300046616 | Bacteria | 2097 |
| 409 | Ga0495668_0114494 | 3300046616 | Bacteria | 1475 |
| 410 | Ga0495634_0056764 | 3300046642 | Bacteria | 2615 |
| 411 | Ga0495611_0000260 | 3300046648 | Bacteria | 36404 |
| 412 | Ga0495611_0064376 | 3300046648 | Bacteria | 1669 |
| 413 | Ga0495625_0001278 | 3300046660 | Bacteria | 31574 |
| 414 | Ga0495625_0009607 | 3300046660 | Bacteria | 8071 |
| 415 | Ga0495625_0015118 | 3300046660 | Bacteria | 6126 |
| 416 | Ga0495625_0029273 | 3300046660 | Bacteria | 4122 |
| 417 | Ga0495661_0013033 | 3300046665 | Bacteria | 5599 |
| 418 | Ga0495661_0021688 | 3300046665 | Bacteria | 4183 |
| 419 | Ga0495661_0030096 | 3300046665 | Bacteria | 3459 |
| 420 | Ga0495661_0031595 | 3300046665 | Bacteria | 3357 |
| 421 | Ga0495661_0069616 | 3300046665 | Bacteria | 2061 |
| 422 | Ga0495661_0105680 | 3300046665 | Bacteria | 1576 |
| 423 | Ga0495588_0003963 | 3300046674 | Bacteria | 6499 |
| 424 | Ga0495588_0009565 | 3300046674 | Bacteria | 4485 |
| 425 | Ga0495588_0096004 | 3300046674 | Bacteria | 1554 |
| 426 | Ga0495623_0003760 | 3300046679 | Bacteria | 10004 |
| 427 | Ga0495623_0012559 | 3300046679 | Bacteria | 5481 |
| 428 | Ga0495623_0082547 | 3300046679 | Bacteria | 1986 |
| 429 | Ga0495658_0120897 | 3300046683 | Bacteria | 1584 |
| 430 | Ga0495669_0001080 | 3300046684 | Bacteria | 11310 |
| 431 | Ga0495669_0003933 | 3300046684 | Bacteria | 6120 |
| 432 | Ga0495669_0005276 | 3300046684 | Bacteria | 5382 |
| 433 | Ga0495669_0025446 | 3300046684 | Bacteria | 2581 |
| 434 | Ga0495669_0097043 | 3300046684 | Bacteria | 1366 |
| 435 | Ga0495613_0083263 | 3300046689 | Bacteria | 2323 |
| 436 | Ga0495624_0001233 | 3300046690 | Bacteria | 20184 |
| 437 | Ga0495624_0066081 | 3300046690 | Bacteria | 2258 |
| 438 | Ga0495670_0010685 | 3300046691 | Bacteria | 4513 |
| 439 | Ga0495670_0027381 | 3300046691 | Bacteria | 2823 |
| 440 | Ga0495670_0211314 | 3300046691 | Bacteria | 1029 |
| 441 | Ga0495671_0000006 | 3300046692 | Bacteria | 500471 |
| 442 | Ga0495671_0001032 | 3300046692 | Bacteria | 19378 |
| 443 | Ga0495671_0002705 | 3300046692 | Bacteria | 11103 |
| 444 | Ga0495671_0005308 | 3300046692 | Bacteria | 7561 |
| 445 | Ga0495671_0038930 | 3300046692 | Bacteria | 2402 |
| 446 | Ga0495671_0159254 | 3300046692 | Bacteria | 1098 |
| 447 | Ga0495649_0000185 | 3300046694 | Bacteria | 54619 |
| 448 | Ga0495649_0003174 | 3300046694 | Bacteria | 11239 |
| 449 | Ga0495649_0005881 | 3300046694 | Bacteria | 7705 |
| 450 | Ga0495649_0015307 | 3300046694 | Bacteria | 4367 |
| 451 | Ga0495649_0024060 | 3300046694 | Bacteria | 3400 |
| 452 | Ga0495649_0037120 | 3300046694 | Bacteria | 2675 |
| 453 | Ga0495649_0165019 | 3300046694 | Bacteria | 1161 |
| 454 | Ga0495649_0305677 | 3300046694 | Bacteria | 809 |
| 455 | Ga0495589_0000705 | 3300046794 | Bacteria | 21771 |
| 456 | Ga0495589_0028693 | 3300046794 | Bacteria | 2807 |
| 457 | Ga0495589_0039914 | 3300046794 | Bacteria | 2344 |
| 458 | Ga0495600_0053182 | 3300046809 | Bacteria | 2644 |
| 459 | Ga0495600_0147855 | 3300046809 | Bacteria | 1522 |
| 460 | Ga0495660_0006530 | 3300046810 | Bacteria | 6890 |
| 461 | Ga0495660_0009426 | 3300046810 | Bacteria | 5694 |
| 462 | Ga0495660_0013392 | 3300046810 | Bacteria | 4754 |
| 463 | Ga0495581_0005630 | 3300047315 | Bacteria | 7262 |
| 464 | Ga0495604_0026315 | 3300047317 | Bacteria | 4632 |
| 465 | Ga0495604_0164503 | 3300047317 | Bacteria | 1565 |
| 466 | Ga0495672_0000305 | 3300047320 | Bacteria | 66204 |
| 467 | Ga0495672_0000753 | 3300047320 | Bacteria | 35468 |
| 468 | Ga0495672_0000765 | 3300047320 | Bacteria | 34954 |
| 469 | Ga0495672_0066960 | 3300047320 | Bacteria | 2047 |
| 470 | Ga0495676_0268964 | 3300047321 | Bacteria | 1157 |
| 471 | Ga0495680_0067165 | 3300047322 | Bacteria | 2742 |
| 472 | Ga0495683_0001053 | 3300047323 | Bacteria | 19170 |
| 473 | Ga0495683_0007403 | 3300047323 | Bacteria | 5944 |
| 474 | Ga0495683_0011684 | 3300047323 | Bacteria | 4619 |
| 475 | Ga0495683_0042278 | 3300047323 | Bacteria | 2298 |
| 476 | Ga0495683_0051506 | 3300047323 | Bacteria | 2057 |
| 477 | Ga0495683_0065786 | 3300047323 | Bacteria | 1787 |
| 478 | Ga0495687_005888 | 3300047443 | Bacteria | 7670 |
| 479 | Ga0495687_005940 | 3300047443 | Bacteria | 7625 |
| 480 | Ga0495675_0008345 | 3300047444 | Bacteria | 6413 |
| 481 | Ga0495677_0000193 | 3300047445 | Bacteria | 28150 |
| 482 | Ga0495677_0000799 | 3300047445 | Bacteria | 12713 |
| 483 | Ga0495677_0005280 | 3300047445 | Bacteria | 4905 |
| 484 | Ga0495677_0025216 | 3300047445 | Bacteria | 2157 |
| 485 | Ga0495679_006578 | 3300047446 | Bacteria | 4975 |
| 486 | Ga0495679_016128 | 3300047446 | Bacteria | 2710 |
| 487 | Ga0495679_016359 | 3300047446 | Bacteria | 2685 |
| 488 | Ga0495685_055237 | 3300047447 | Bacteria | 1343 |
| 489 | Ga0495673_0000003 | 3300047469 | Bacteria | 1491337 |
| 490 | Ga0495673_0000061 | 3300047469 | Bacteria | 230647 |
| 491 | Ga0495673_0000351 | 3300047469 | Bacteria | 57305 |
| 492 | Ga0495681_0000317 | 3300047470 | Bacteria | 38608 |
| 493 | Ga0495681_0035659 | 3300047470 | Bacteria | 2468 |
| 494 | Ga0495681_0059974 | 3300047470 | Bacteria | 1757 |
| 495 | Ga0495686_0000735 | 3300047472 | Bacteria | 43727 |
| 496 | Ga0495686_0001857 | 3300047472 | Bacteria | 21192 |
| 497 | Ga0495686_0005890 | 3300047472 | Bacteria | 9552 |
| 498 | Ga0495686_0072476 | 3300047472 | Bacteria | 2117 |
| 499 | Ga0495686_0091568 | 3300047472 | Bacteria | 1845 |
| 500 | Ga0495593_0022436 | 3300047673 | Bacteria | 3517 |
| 501 | Ga0495593_0093625 | 3300047673 | Bacteria | 1546 |
| 502 | Ga0495593_0102611 | 3300047673 | Bacteria | 1466 |
| 503 | Ga0495602_0001033 | 3300048088 | Bacteria | 27111 |
| 504 | Ga0495602_0112876 | 3300048088 | Bacteria | 2204 |
| 505 | Ga0495626_0007035 | 3300048091 | Bacteria | 6318 |
| 506 | Ga0495626_0012659 | 3300048091 | Bacteria | 4412 |
| 507 | Ga0495626_0021189 | 3300048091 | Bacteria | 3228 |
| 508 | Ga0495626_0025958 | 3300048091 | Bacteria | 2859 |
| 509 | Ga0495626_0027138 | 3300048091 | Bacteria | 2785 |
| 510 | Ga0495626_0165214 | 3300048091 | Bacteria | 925 |
| 511 | Ga0496100_0087665 | 3300048903 | Bacteria | 2116 |
| 512 | Ga0496102_0005900 | 3300048905 | Bacteria | 10428 |
| 513 | Ga0496102_0043006 | 3300048905 | Bacteria | 4095 |
| 514 | Ga0496102_0186743 | 3300048905 | Bacteria | 1953 |
| 515 | Ga0496102_0724437 | 3300048905 | Bacteria | 917 |
| 516 | Ga0496103_0006928 | 3300048906 | Bacteria | 6767 |
| 517 | Ga0496103_0097291 | 3300048906 | Bacteria | 1860 |
| 518 | Ga0496105_0255795 | 3300048908 | Bacteria | 1418 |
| 519 | Ga0496106_0173740 | 3300048909 | Bacteria | 1709 |
| 520 | Ga0496115_0043245 | 3300048918 | Bacteria | 3592 |
| 521 | Ga0496115_0111169 | 3300048918 | Bacteria | 2251 |
| 522 | Ga0496122_0018898 | 3300048925 | Bacteria | 6330 |
| 523 | Ga0496122_0053829 | 3300048925 | Bacteria | 3029 |
| 524 | Ga0496123_0012508 | 3300048926 | Bacteria | 7230 |
| 525 | Ga0496124_0019804 | 3300048927 | Bacteria | 6244 |
| 526 | Ga0496124_0027331 | 3300048927 | Bacteria | 5123 |
| 527 | Ga0496124_0045340 | 3300048927 | Bacteria | 3769 |
| 528 | Ga0496124_0064950 | 3300048927 | Bacteria | 3045 |
| 529 | Ga0496124_0104049 | 3300048927 | Bacteria | 2296 |
| 530 | Ga0496126_0025849 | 3300048929 | Bacteria | 5640 |
| 531 | Ga0496126_0232672 | 3300048929 | Bacteria | 1543 |
| 532 | Ga0495678_000188 | 3300049459 | Bacteria | 72283 |
| 533 | Ga0495678_000264 | 3300049459 | Bacteria | 58107 |
| 534 | Ga0495678_000917 | 3300049459 | Bacteria | 25905 |
| 535 | Ga0495678_001434 | 3300049459 | Bacteria | 18756 |
| 536 | Ga0495678_010898 | 3300049459 | Bacteria | 4382 |
| 537 | Ga0495682_0004222 | 3300049460 | Bacteria | 6216 |
| 538 | Ga0495682_0004832 | 3300049460 | Bacteria | 5690 |
| 539 | Ga0501211_008053 | 3300049658 | Bacteria | 1030 |
| 540 | Ga0501249_001953 | 3300049679 | Bacteria | 4194 |
| 541 | Ga0501221_045392 | 3300049704 | Bacteria | 973 |
| 542 | Ga0501267_000045 | 3300049764 | Bacteria | 6853 |
| 543 | Ga0501269_000545 | 3300049766 | Bacteria | 7303 |
| 544 | Ga0501272_000469 | 3300049769 | Bacteria | 3552 |
| 545 | Ga0501035_0070534 | 3300049822 | Bacteria | 3095 |
| 546 | nmdc:mga0k408_220_c1 | 3300050493 | Bacteria | 24186 |
| 547 | nmdc:mga0k408_71619_c1 | 3300050493 | Bacteria | 2023 |
| 548 | nmdc:mga0k408_87236_c1 | 3300050493 | Bacteria | 1832 |
| 549 | nmdc:mga0k408_9548_c1 | 3300050493 | Bacteria | 5235 |
| 550 | nmdc:mga07m45_85950_c1 | 3300050496 | Bacteria | 1799 |
| 551 | nmdc:mga07m45_89868_c1 | 3300050496 | Bacteria | 1759 |
| 552 | Ga0500635_0001602 | 3300053080 | Bacteria | 5459 |
| 553 | Ga0500586_000241 | 3300053145 | Bacteria | 10810 |
| 554 | Ga0500586_001437 | 3300053145 | Bacteria | 5024 |
| 555 | Ga0500636_0038941 | 3300053177 | Bacteria | 2811 |
| 556 | Ga0466962_0003423 | 3300061719 | Bacteria | 7556 |
| 557 | 2643744379 | 2643221544 | Bacteria | 5886209 |
| 558 | 2643934334 | 2643221585 | Bacteria | 5812563 |
| 559 | 2644219445 | 2643221639 | Bacteria | 6649903 |
| 560 | 2644255881 | 2643221646 | Bacteria | 6433402 |
| 561 | 2644315821 | 2643221656 | Bacteria | 5809961 |
| 562 | 2739054339 | 2738541337 | Bacteria | 6183410 |
| 563 | 2809147265 | 2808606418 | Bacteria | 6724496 |
| 564 | 2831865334 | 2831864461 | Bacteria | 6502356 |
| 565 | 2842712681 | 2842711865 | Bacteria | 7155354 |
| 566 | 2857561063 | 2857558681 | Bacteria | 6617694 |
| 567 | 2904425485 | 2904424332 | Bacteria | 7633521 |
| 568 | Ga0500622_0000921 | |||
| 569 | JGI25156J39149_1000218 | |||
| 570 | JGI25154J39366_1000340 | |||
| 571 | JGI25154J39366_1003707 | |||
| 572 | JGI25157J39369_1000018 | |||
| 573 | JGI25150J39212_1006993 | |||
| 574 | JGI25153J46596_10026164 | |||
| 575 | rootH1_10007910 | |||
| 576 | rootH1_10014334 | |||
| 577 | rootH1_10015244 | |||
| 578 | rootH1_10043190 | |||
| 579 | rootH2_10041163 | |||
| 580 | rootL2_10000355 | |||
| 581 | rootL2_10003893 | |||
| 582 | rootL2_10004528 | |||
| 583 | rootL2_10026363 | |||
| 584 | rootL2_10058409 | |||
| 585 | rootL2_10058410 | |||
| 586 | rootL2_10066771 | |||
| 587 | rootH1_10001551 | |||
| 588 | rootH1_10007488 | |||
| 589 | rootH1_10056027 | |||
| 590 | rootH1_10066620 | |||
| 591 | rootH1_10084380 | |||
| 592 | rootH1_10092016 | |||
| 593 | Ga0055539_1000240 | |||
| 594 | Ga0055539_1000791 | |||
| 595 | Ga0055533_1000103 | |||
| 596 | Ga0055525_1000013 | |||
| 597 | Ga0055535_1000087 | |||
| 598 | Ga0055529_1000032 | |||
| 599 | Ga0055529_1000139 | |||
| 600 | Ga0055526_1000320 | |||
| 601 | Ga0055526_1000430 | |||
| 602 | Ga0055526_1005697 | |||
| 603 | Ga0055524_1000003 | |||
| 604 | Ga0055524_1000479 | |||
| 605 | Ga0055524_1000490 | |||
| 606 | Ga0055524_1008098 | |||
| 607 | Ga0055531_10000022 | |||
| 608 | Ga0055531_10001050 | |||
| 609 | Ga0055543_1002108 | |||
| 610 | Ga0065165_1000079 | |||
| 611 | Ga0070658_10159080 | |||
| 612 | Ga0070658_10395357 | |||
| 613 | Ga0070658_10535885 | |||
| 614 | Ga0070690_100093821 | |||
| 615 | Ga0068869_100130835 | |||
| 616 | Ga0070682_100023330 | |||
| 617 | Ga0070682_100141983 | |||
| 618 | Ga0070660_100136499 | |||
| 619 | Ga0070673_100291513 | |||
| 620 | Ga0068867_100117105 | |||
| 621 | Ga0070684_100063392 | |||
| 622 | Ga0068855_100002529 | |||
| 623 | Ga0068855_100101470 | |||
| 624 | Ga0068855_100471430 | |||
| 625 | Ga0068857_100001688 | |||
| 626 | Ga0068856_100145377 | |||
| 627 | Ga0068852_100127424 | |||
| 628 | Ga0068861_100026072 | |||
| 629 | Ga0068860_100011524 | |||
| 630 | Ga0070717_10112959 | |||
| 631 | Ga0075366_10003557 | |||
| 632 | Ga0075366_10276070 | |||
| 633 | Ga0075370_10016522 | |||
| 634 | Ga0075370_10027510 | |||
| 635 | Ga0099823_1000002 | |||
| 636 | Ga0099826_10000002 | |||
| 637 | Ga0105240_10041904 | |||
| 638 | Ga0105240_10108853 | |||
| 639 | Ga0105243_10022566 | |||
| 640 | Ga0105242_10195460 | |||
| 641 | Ga0105242_10203544 | |||
| 642 | Ga0105238_10120500 | |||
| 643 | Ga0105239_10079521 | |||
| 644 | Ga0157317_1003366 | |||
| 645 | Ga0157319_1000007 | |||
| 646 | Ga0157371_10000077 | |||
| 647 | Ga0157369_10034309 | |||
| 648 | Ga0157372_10097273 | |||
| 649 | Ga0157372_10354207 | |||
| 650 | Ga0163163_10369838 | |||
| 651 | Ga0157379_10015004 | |||
| 652 | Ga0182005_1000037 | |||
| 653 | Ga0213872_10000008 | |||
| 654 | Ga0213872_10000127 | |||
| 655 | Ga0213872_10000683 | |||
| 656 | Ga0213872_10011112 | |||
| 657 | Ga0213872_10014422 | |||
| 658 | Ga0209674_100003 | |||
| 659 | Ga0209672_103728 | |||
| 660 | Ga0209563_100025 | |||
| 661 | Ga0209563_100141 | |||
| 662 | Ga0207427_102220 | |||
| 663 | Ga0209258_100044 | |||
| 664 | Ga0209258_100531 | |||
| 665 | Ga0209258_105996 | |||
| 666 | Ga0207425_1000245 | |||
| 667 | Ga0209646_1000051 | |||
| 668 | Ga0209646_1000067 | |||
| 669 | Ga0209026_1000033 | |||
| 670 | Ga0209677_100293 | |||
| 671 | Ga0209677_100339 | |||
| 672 | Ga0209677_104350 | |||
| 673 | Ga0209759_1000024 | |||
| 674 | Ga0209759_1006309 | |||
| 675 | Ga0209759_1015591 | |||
| 676 | Ga0209455_1000043 | |||
| 677 | Ga0209455_1000048 | |||
| 678 | Ga0209673_1014611 | |||
| 679 | Ga0209673_1019225 | |||
| 680 | Ga0209025_1010537 | |||
| 681 | Ga0209564_1000011 | |||
| 682 | Ga0209564_1000030 | |||
| 683 | Ga0209564_1000089 | |||
| 684 | Ga0209758_1004343 | |||
| 685 | Ga0209050_1002079 | |||
| 686 | Ga0209050_1006524 | |||
| 687 | Ga0209256_1000007 | |||
| 688 | Ga0209256_1000154 | |||
| 689 | Ga0209256_1000659 | |||
| 690 | Ga0209256_1025868 | |||
| 691 | Ga0209051_1002564 | |||
| 692 | Ga0209051_1002662 | |||
| 693 | Ga0209257_1000061 | |||
| 694 | Ga0209257_1001047 | |||
| 695 | Ga0207655_1017254 | |||
| 696 | Ga0207705_10072458 | |||
| 697 | Ga0207705_10110400 | |||
| 698 | Ga0207695_10022513 | |||
| 699 | Ga0207695_10037598 | |||
| 700 | Ga0207695_10246802 | |||
| 701 | Ga0207671_10482032 | |||
| 702 | Ga0207657_10007109 | |||
| 703 | Ga0207694_10024369 | |||
| 704 | Ga0207686_10049096 | |||
| 705 | Ga0207686_10114828 | |||
| 706 | Ga0207709_10020352 | |||
| 707 | Ga0207709_10068913 | |||
| 708 | Ga0207709_10300816 | |||
| 709 | Ga0207704_10259028 | |||
| 710 | Ga0207689_10129109 | |||
| 711 | Ga0207667_10021616 | |||
| 712 | Ga0207667_10109599 | |||
| 713 | Ga0207667_10302821 | |||
| 714 | Ga0207667_10346337 | |||
| 715 | Ga0207651_10016670 | |||
| 716 | Ga0207640_10001453 | |||
| 717 | Ga0207639_10314482 | |||
| 718 | Ga0207678_10258077 | |||
| 719 | Ga0207702_10040381 | |||
| 720 | Ga0207702_10082723 | |||
| 721 | Ga0207648_10155551 | |||
| 722 | Ga0207674_10013645 | |||
| 723 | Ga0207674_10077253 | |||
| 724 | Ga0207674_10538835 | |||
| 725 | Ga0207675_100170901 | |||
| 726 | Ga0209281_1011276 | |||
| 727 | Ga0209389_1000340 | |||
| 728 | Ga0209282_1000001 | |||
| 729 | Ga0268264_10078009 | |||
| 730 | Ga0265336_10000053 | |||
| 731 | Ga0307515_10042541 | |||
| 732 | Ga0307515_10099223 | |||
| 733 | Ga0307515_10198674 | |||
| 734 | Ga0265324_10000132 | |||
| 735 | Ga0307512_10013050 | |||
| 736 | Ga0316177_1113771 | |||
| 737 | Ga0316180_1171083 | |||
| 738 | Ga0265328_10007408 | |||
| 739 | Ga0265331_10002254 | |||
| 740 | Ga0265327_10000309 | |||
| 741 | Ga0307509_10000135 | |||
| 742 | Ga0307509_10042110 | |||
| 743 | Ga0307509_10044925 | |||
| 744 | Ga0307408_100000006 | |||
| 745 | Ga0307408_100000010 | |||
| 746 | Ga0307408_100006745 | |||
| 747 | Ga0307508_10032855 | |||
| 748 | Ga0307514_10122887 | |||
| 749 | Ga0307516_10021704 | |||
| 750 | Ga0307411_10000146 | |||
| 751 | Ga0307507_10039139 | |||
| 752 | Ga0307510_10003036 | |||
| 753 | Ga0307510_10010819 | |||
| 754 | Ga0373950_0003785 | |||
| 755 | Ga0373934_0051111 | |||
| 756 | Ga0373940_0010265 | |||
| 757 | Ga0373939_0000157 | |||
| 758 | Ga0373960_0000353 | |||
| 759 | Ga0373961_0022987 | |||
| 760 | Ga0373931_0043937 | |||
| 761 | Ga0373931_0401244 | |||
| 762 | Ga0395899_0023228 | |||
| 763 | Ga0395900_0000054 | |||
| 764 | Ga0395900_0026912 | |||
| 765 | Ga0395898_0001324 | |||
| 766 | Ga0395898_0008499 | |||
| 767 | Ga0395898_0056911 | |||
| 768 | Ga0395905_0002699 | |||
| 769 | Ga0395905_0051256 | |||
| 770 | Ga0395905_0074275 | |||
| 771 | Ga0395905_0147103 | |||
| 772 | Ga0395901_0004830 | |||
| 773 | Ga0395901_0147855 | |||
| 774 | Ga0436361_0126586 | |||
| 775 | Ga0436361_0144792 | |||
| 776 | Ga0436361_0148536 | |||
| 777 | Ga0436361_0356304 | |||
| 778 | Ga0436361_0362312 | |||
| 779 | Ga0439454_009076 | |||
| 780 | Ga0450888_000383 | |||
| 781 | Ga0450891_000565 | |||
| 782 | Ga0450892_000489 | |||
| 783 | Ga0450904_000159 | |||
| 784 | Ga0439459_0028409 | |||
| 785 | Ga0450916_012272 | |||
| 786 | Ga0451577_0003749 | |||
| 787 | Ga0451577_0003877 | |||
| 788 | Ga0466969_0000029 | |||
| 789 | Ga0466969_0038270 | |||
| 790 | Ga0466965_0002529 | |||
| 791 | Ga0466965_0005451 | |||
| 792 | Ga0466966_0026394 | |||
| 793 | Ga0466961_0109647 | |||
| 794 | Ga0466963_0027186 | |||
| 795 | Ga0466964_0013162 | |||
| 796 | Ga0453684_0297692 | |||
| 797 | Ga0453684_0428084 | |||
| 798 | Ga0466971_0008714 | |||
| 799 | Ga0466970_0009189 | |||
| 800 | Ga0466970_0047072 | |||
| 801 | Ga0466970_0102217 | |||
| 802 | Ga0466957_0013563 | |||
| 803 | Ga0466959_0002381 | |||
| 804 | Ga0466959_0202491 | |||
| 805 | Ga0451576_0069862 | |||
| 806 | Ga0451576_0163375 | |||
| 807 | Ga0466958_0242967 | |||
| 808 | Ga0466967_0031462 | |||
| 809 | Ga0466967_0053715 | |||
| 810 | Ga0466967_0054304 | |||
| 811 | Ga0466967_0170719 | |||
| 812 | Ga0495617_000108 | |||
| 813 | Ga0495627_000249 | |||
| 814 | Ga0495603_0033689 | |||
| 815 | Ga0495603_0073856 | |||
| 816 | Ga0495590_0000002 | |||
| 817 | Ga0495590_0000263 | |||
| 818 | Ga0495590_0046751 | |||
| 819 | Ga0495591_000132 | |||
| 820 | Ga0495629_0007599 | |||
| 821 | Ga0495638_0000367 | |||
| 822 | Ga0495638_0013166 | |||
| 823 | Ga0495653_0000023 | |||
| 824 | Ga0495653_0020939 | |||
| 825 | Ga0495653_0038430 | |||
| 826 | Ga0495653_0047587 | |||
| 827 | Ga0495650_0000001 | |||
| 828 | Ga0495650_0000019 | |||
| 829 | Ga0495650_0000521 | |||
| 830 | Ga0495650_0000618 | |||
| 831 | Ga0495650_0000933 | |||
| 832 | Ga0495650_0003941 | |||
| 833 | Ga0495650_0008822 | |||
| 834 | Ga0495650_0009101 | |||
| 835 | Ga0495650_0009787 | |||
| 836 | Ga0495650_0014959 | |||
| 837 | Ga0495650_0026018 | |||
| 838 | Ga0495580_0022635 | |||
| 839 | Ga0495580_0110002 | |||
| 840 | Ga0495580_0150904 | |||
| 841 | Ga0495582_0038139 | |||
| 842 | Ga0495582_0118395 | |||
| 843 | Ga0495605_0000028 | |||
| 844 | Ga0495605_0000407 | |||
| 845 | Ga0495605_0010717 | |||
| 846 | Ga0495639_0007458 | |||
| 847 | Ga0495639_0093404 | |||
| 848 | Ga0495584_0000487 | |||
| 849 | Ga0495584_0036699 | |||
| 850 | Ga0495584_0118985 | |||
| 851 | Ga0495585_0003243 | |||
| 852 | Ga0495585_0009831 | |||
| 853 | Ga0495585_0018215 | |||
| 854 | Ga0495585_0027266 | |||
| 855 | Ga0495585_0028076 | |||
| 856 | Ga0495585_0033664 | |||
| 857 | Ga0495585_0202963 | |||
| 858 | Ga0495594_0069630 | |||
| 859 | Ga0495594_0079511 | |||
| 860 | Ga0495596_0002010 | |||
| 861 | Ga0495596_0003257 | |||
| 862 | Ga0495596_0005785 | |||
| 863 | Ga0495596_0006173 | |||
| 864 | Ga0495596_0008015 | |||
| 865 | Ga0495596_0055070 | |||
| 866 | Ga0495607_0001994 | |||
| 867 | Ga0495607_0004620 | |||
| 868 | Ga0495607_0006715 | |||
| 869 | Ga0495607_0007751 | |||
| 870 | Ga0495607_0114224 | |||
| 871 | Ga0495607_0175319 | |||
| 872 | Ga0495583_0000159 | |||
| 873 | Ga0495583_0000741 | |||
| 874 | Ga0495583_0000907 | |||
| 875 | Ga0495583_0001433 | |||
| 876 | Ga0495583_0003983 | |||
| 877 | Ga0495583_0014597 | |||
| 878 | Ga0495583_0061146 | |||
| 879 | Ga0495606_0000001 | |||
| 880 | Ga0495606_0000549 | |||
| 881 | Ga0495606_0000601 | |||
| 882 | Ga0495606_0001009 | |||
| 883 | Ga0495606_0003740 | |||
| 884 | Ga0495606_0003954 | |||
| 885 | Ga0495606_0005710 | |||
| 886 | Ga0495606_0010695 | |||
| 887 | Ga0495606_0017867 | |||
| 888 | Ga0495606_0090548 | |||
| 889 | Ga0495606_0220788 | |||
| 890 | Ga0495610_0000106 | |||
| 891 | Ga0495610_0001401 | |||
| 892 | Ga0495610_0002648 | |||
| 893 | Ga0495610_0003856 | |||
| 894 | Ga0495610_0004104 | |||
| 895 | Ga0495610_0012181 | |||
| 896 | Ga0495610_0019764 | |||
| 897 | Ga0495616_0000611 | |||
| 898 | Ga0495616_0004279 | |||
| 899 | Ga0495616_0007856 | |||
| 900 | Ga0495616_0041103 | |||
| 901 | Ga0495616_0140128 | |||
| 902 | Ga0495631_0004138 | |||
| 903 | Ga0495631_0006120 | |||
| 904 | Ga0495631_0008446 | |||
| 905 | Ga0495631_0009708 | |||
| 906 | Ga0495632_0000264 | |||
| 907 | Ga0495632_0000674 | |||
| 908 | Ga0495632_0002656 | |||
| 909 | Ga0495632_0009857 | |||
| 910 | Ga0495632_0013614 | |||
| 911 | Ga0495637_0000028 | |||
| 912 | Ga0495643_0000444 | |||
| 913 | Ga0495643_0000643 | |||
| 914 | Ga0495643_0015876 | |||
| 915 | Ga0495644_0003657 | |||
| 916 | Ga0495644_0003685 | |||
| 917 | Ga0495644_0013544 | |||
| 918 | Ga0495644_0037290 | |||
| 919 | Ga0495644_0052454 | |||
| 920 | Ga0495648_0000311 | |||
| 921 | Ga0495648_0000836 | |||
| 922 | Ga0495648_0002684 | |||
| 923 | Ga0495648_0010964 | |||
| 924 | Ga0495648_0032842 | |||
| 925 | Ga0495648_0038113 | |||
| 926 | Ga0495666_0000961 | |||
| 927 | Ga0495666_0003876 | |||
| 928 | Ga0495666_0004089 | |||
| 929 | Ga0495642_0000801 | |||
| 930 | Ga0495642_0002511 | |||
| 931 | Ga0495642_0003207 | |||
| 932 | Ga0495642_0007748 | |||
| 933 | Ga0495642_0020024 | |||
| 934 | Ga0495642_0028163 | |||
| 935 | Ga0495652_0017070 | |||
| 936 | Ga0495652_0033748 | |||
| 937 | Ga0495654_0000015 | |||
| 938 | Ga0495654_0001129 | |||
| 939 | Ga0495654_0009628 | |||
| 940 | Ga0495654_0012729 | |||
| 941 | Ga0495654_0068932 | |||
| 942 | Ga0495665_0009456 | |||
| 943 | Ga0495665_0020604 | |||
| 944 | Ga0495586_0021917 | |||
| 945 | Ga0495586_0046548 | |||
| 946 | Ga0495587_0044006 | |||
| 947 | Ga0495609_0001680 | |||
| 948 | Ga0495609_0002912 | |||
| 949 | Ga0495609_0015887 | |||
| 950 | Ga0495609_0098619 | |||
| 951 | Ga0495597_0000327 | |||
| 952 | Ga0495597_0001304 | |||
| 953 | Ga0495597_0002613 | |||
| 954 | Ga0495597_0055278 | |||
| 955 | Ga0495645_0075302 | |||
| 956 | Ga0495622_0000375 | |||
| 957 | Ga0495622_0000567 | |||
| 958 | Ga0495622_0101053 | |||
| 959 | Ga0495633_0000244 | |||
| 960 | Ga0495633_0004279 | |||
| 961 | Ga0495633_0004813 | |||
| 962 | Ga0495633_0006081 | |||
| 963 | Ga0495633_0012680 | |||
| 964 | Ga0495633_0023115 | |||
| 965 | Ga0495633_0028237 | |||
| 966 | Ga0495633_0049658 | |||
| 967 | Ga0495667_0155983 | |||
| 968 | Ga0495656_0001178 | |||
| 969 | Ga0495668_0000241 | |||
| 970 | Ga0495668_0000972 | |||
| 971 | Ga0495668_0001358 | |||
| 972 | Ga0495668_0001812 | |||
| 973 | Ga0495668_0006872 | |||
| 974 | Ga0495668_0038718 | |||
| 975 | Ga0495668_0060072 | |||
| 976 | Ga0495668_0114494 | |||
| 977 | Ga0495634_0056764 | |||
| 978 | Ga0495611_0000260 | |||
| 979 | Ga0495611_0064376 | |||
| 980 | Ga0495625_0001278 | |||
| 981 | Ga0495625_0009607 | |||
| 982 | Ga0495625_0015118 | |||
| 983 | Ga0495625_0029273 | |||
| 984 | Ga0495661_0013033 | |||
| 985 | Ga0495661_0021688 | |||
| 986 | Ga0495661_0030096 | |||
| 987 | Ga0495661_0031595 | |||
| 988 | Ga0495661_0069616 | |||
| 989 | Ga0495661_0105680 | |||
| 990 | Ga0495588_0003963 | |||
| 991 | Ga0495588_0009565 | |||
| 992 | Ga0495588_0096004 | |||
| 993 | Ga0495623_0003760 | |||
| 994 | Ga0495623_0012559 | |||
| 995 | Ga0495623_0082547 | |||
| 996 | Ga0495658_0120897 | |||
| 997 | Ga0495669_0001080 | |||
| 998 | Ga0495669_0003933 | |||
| 999 | Ga0495669_0005276 | |||
| 1000 | Ga0495669_0025446 | |||
| 1001 | Ga0495669_0097043 | |||
| 1002 | Ga0495613_0083263 | |||
| 1003 | Ga0495624_0001233 | |||
| 1004 | Ga0495624_0066081 | |||
| 1005 | Ga0495670_0010685 | |||
| 1006 | Ga0495670_0027381 | |||
| 1007 | Ga0495670_0211314 | |||
| 1008 | Ga0495671_0000006 | |||
| 1009 | Ga0495671_0001032 | |||
| 1010 | Ga0495671_0002705 | |||
| 1011 | Ga0495671_0005308 | |||
| 1012 | Ga0495671_0038930 | |||
| 1013 | Ga0495671_0159254 | |||
| 1014 | Ga0495649_0000185 | |||
| 1015 | Ga0495649_0003174 | |||
| 1016 | Ga0495649_0005881 | |||
| 1017 | Ga0495649_0015307 | |||
| 1018 | Ga0495649_0024060 | |||
| 1019 | Ga0495649_0037120 | |||
| 1020 | Ga0495649_0165019 | |||
| 1021 | Ga0495649_0305677 | |||
| 1022 | Ga0495589_0000705 | |||
| 1023 | Ga0495589_0028693 | |||
| 1024 | Ga0495589_0039914 | |||
| 1025 | Ga0495600_0053182 | |||
| 1026 | Ga0495600_0147855 | |||
| 1027 | Ga0495660_0006530 | |||
| 1028 | Ga0495660_0009426 | |||
| 1029 | Ga0495660_0013392 | |||
| 1030 | Ga0495581_0005630 | |||
| 1031 | Ga0495604_0026315 | |||
| 1032 | Ga0495604_0164503 | |||
| 1033 | Ga0495672_0000305 | |||
| 1034 | Ga0495672_0000753 | |||
| 1035 | Ga0495672_0000765 | |||
| 1036 | Ga0495672_0066960 | |||
| 1037 | Ga0495676_0268964 | |||
| 1038 | Ga0495680_0067165 | |||
| 1039 | Ga0495683_0001053 | |||
| 1040 | Ga0495683_0007403 | |||
| 1041 | Ga0495683_0011684 | |||
| 1042 | Ga0495683_0042278 | |||
| 1043 | Ga0495683_0051506 | |||
| 1044 | Ga0495683_0065786 | |||
| 1045 | Ga0495687_005888 | |||
| 1046 | Ga0495687_005940 | |||
| 1047 | Ga0495675_0008345 | |||
| 1048 | Ga0495677_0000193 | |||
| 1049 | Ga0495677_0000799 | |||
| 1050 | Ga0495677_0005280 | |||
| 1051 | Ga0495677_0025216 | |||
| 1052 | Ga0495679_006578 | |||
| 1053 | Ga0495679_016128 | |||
| 1054 | Ga0495679_016359 | |||
| 1055 | Ga0495685_055237 | |||
| 1056 | Ga0495673_0000003 | |||
| 1057 | Ga0495673_0000061 | |||
| 1058 | Ga0495673_0000351 | |||
| 1059 | Ga0495681_0000317 | |||
| 1060 | Ga0495681_0035659 | |||
| 1061 | Ga0495681_0059974 | |||
| 1062 | Ga0495686_0000735 | |||
| 1063 | Ga0495686_0001857 | |||
| 1064 | Ga0495686_0005890 | |||
| 1065 | Ga0495686_0072476 | |||
| 1066 | Ga0495686_0091568 | |||
| 1067 | Ga0495593_0022436 | |||
| 1068 | Ga0495593_0093625 | |||
| 1069 | Ga0495593_0102611 | |||
| 1070 | Ga0495602_0001033 | |||
| 1071 | Ga0495602_0112876 | |||
| 1072 | Ga0495626_0007035 | |||
| 1073 | Ga0495626_0012659 | |||
| 1074 | Ga0495626_0021189 | |||
| 1075 | Ga0495626_0025958 | |||
| 1076 | Ga0495626_0027138 | |||
| 1077 | Ga0495626_0165214 | |||
| 1078 | Ga0496100_0087665 | |||
| 1079 | Ga0496102_0005900 | |||
| 1080 | Ga0496102_0043006 | |||
| 1081 | Ga0496102_0186743 | |||
| 1082 | Ga0496102_0724437 | |||
| 1083 | Ga0496103_0006928 | |||
| 1084 | Ga0496103_0097291 | |||
| 1085 | Ga0496105_0255795 | |||
| 1086 | Ga0496106_0173740 | |||
| 1087 | Ga0496115_0043245 | |||
| 1088 | Ga0496115_0111169 | |||
| 1089 | Ga0496122_0018898 | |||
| 1090 | Ga0496122_0053829 | |||
| 1091 | Ga0496123_0012508 | |||
| 1092 | Ga0496124_0019804 | |||
| 1093 | Ga0496124_0027331 | |||
| 1094 | Ga0496124_0045340 | |||
| 1095 | Ga0496124_0064950 | |||
| 1096 | Ga0496124_0104049 | |||
| 1097 | Ga0496126_0025849 | |||
| 1098 | Ga0496126_0232672 | |||
| 1099 | Ga0495678_000188 | |||
| 1100 | Ga0495678_000264 | |||
| 1101 | Ga0495678_000917 | |||
| 1102 | Ga0495678_001434 | |||
| 1103 | Ga0495678_010898 | |||
| 1104 | Ga0495682_0004222 | |||
| 1105 | Ga0495682_0004832 | |||
| 1106 | Ga0501211_008053 | |||
| 1107 | Ga0501249_001953 | |||
| 1108 | Ga0501221_045392 | |||
| 1109 | Ga0501267_000045 | |||
| 1110 | Ga0501269_000545 | |||
| 1111 | Ga0501272_000469 | |||
| 1112 | Ga0501035_0070534 | |||
| 1113 | nmdc:mga0k408_220_c1 | |||
| 1114 | nmdc:mga0k408_71619_c1 | |||
| 1115 | nmdc:mga0k408_87236_c1 | |||
| 1116 | nmdc:mga0k408_9548_c1 | |||
| 1117 | nmdc:mga07m45_85950_c1 | |||
| 1118 | nmdc:mga07m45_89868_c1 | |||
| 1119 | Ga0500635_0001602 | |||
| 1120 | Ga0500586_000241 | |||
| 1121 | Ga0500586_001437 | |||
| 1122 | Ga0500636_0038941 | |||
| 1123 | Ga0466962_0003423 | |||
| 1124 | 2643744379 | |||
| 1125 | 2643934334 | |||
| 1126 | 2644219445 | |||
| 1127 | 2644255881 | |||
| 1128 | 2644315821 | |||
| 1129 | 2739054339 | |||
| 1130 | 2809147265 | |||
| 1131 | 2831865334 | |||
| 1132 | 2842712681 | |||
| 1133 | 2857561063 | |||
| 1134 | 2904425485 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7z16-assembly1.cif.gz_J | e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation | 0.9116 | 11 | 228 |
| 3rlf-assembly1.cif.gz_B | crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp | 0.9023 | 13 | 232 |
| 4rvc-assembly1.cif.gz_A | structure of atp binding subunit of abc transporter | 0.9015 | 12 | 224 |
| 3puy-assembly1.cif.gz_B | crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state | 0.8993 | 13 | 232 |
| 7tch-assembly1.cif.gz_C | bceab e169q variant atp-bound conformation | 0.899 | 12 | 222 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O86311_2_235_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9319 | 7 | 224 | 3.40.50.300 |
| af_Q2G1V4_2_236_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.929 | 11 | 224 | 3.40.50.300 |
| af_O53149_2_239_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9262 | 3 | 225 | 3.40.50.300 |
| af_Q2FWW7_2_234_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9256 | 12 | 224 | 3.40.50.300 |
| af_Q55EH8_3_247_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9238 | 10 | 227 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A496QEB7-F1-model_v4 | ABC transporter ATP-binding protein | 0.9601 | 9 | 225 |
GO:0005524
GO:0016887 |
| AF-A0A1G6INW8-F1-model_v4 | ABC-2 type transport system ATP-binding protein | 0.9489 | 13 | 228 |
GO:0005524
GO:0016887 |
| AF-A0A2G2M205-F1-model_v4 | Multidrug ABC transporter ATP-binding protein | 0.9404 | 10 | 224 |
GO:0005524
GO:0016887 |
| AF-A0A328VDH5-F1-model_v4 | ABC transporter domain-containing protein | 0.9383 | 11 | 222 |
GO:0005524
GO:0016887 |
| AF-A0A830FP66-F1-model_v4 | Copper ABC transporter ATP-binding protein | 0.9381 | 9 | 225 |
GO:0005524
GO:0016887 |