F464571

General Info

Members Datasets Scaffolds Average Seq Length
567 259 1134 288

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0000921|Ga0500622_0000921_3178_4143
Length 321
Sequence MNQATNQTMTIGNAERYASHEGHESRALADDVLASPPVRASGLRVDFKGQPGVLAGLDWTLAPGQVVGLLGRNGAGKTTLLETLLGLREPQGGEVLLFGQPALTPDDALRARLGYVPQQAALFEDFLAGDLLRYFRSFYARWNDAKVDGLMSRWEIPRDRRVGQLSQGQQQRLSIIRALAHEPDLLVLDEPVASLDPVGRRDFLRELVDQVLDRGTTVVFSTHILSDLERVAFNIAFLSRGRIALQAPQDVLAEEIRLLAGPVGRLQAAVDAHGGQVLSRRDLGERPRWLVRFADGNIPQSDAVLRCEPLSLEDLFLELTQ

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
8 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
9 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
12 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
13 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
14 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
15 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
16 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
17 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
18 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
19 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
20 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
21 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
34 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
37 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
38 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
39 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
42 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
43 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
44 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
45 3300012475 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.old.080610 Metagenome Rhizosphere
46 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
47 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
48 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
53 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
54 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
58 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
60 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
61 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
62 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
63 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
64 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
66 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
67 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
69 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
71 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
72 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
93 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
94 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
97 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
98 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
99 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
100 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
101 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
104 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
105 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
106 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
107 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
108 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
109 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
110 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
111 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
112 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
113 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
114 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
115 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
116 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
117 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
118 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
119 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
120 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
121 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
122 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
123 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
124 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
125 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
126 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
127 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
128 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
129 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
130 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
131 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
132 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
133 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
134 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
135 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
136 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
137 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
138 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
139 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
140 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
141 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
142 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
143 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
144 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
145 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
146 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
151 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
152 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
153 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
154 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
155 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
156 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
160 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
161 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
162 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
163 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
164 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
165 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
169 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
170 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
171 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
172 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
173 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
174 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
175 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
180 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
184 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
185 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
186 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
187 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
193 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
194 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
195 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
203 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
204 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
205 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
206 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
213 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
214 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
215 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
216 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
217 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
218 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
219 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
220 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
221 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
222 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
223 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
224 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
228 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
229 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
234 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
235 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
236 3300049658 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F3_B_0_drought Metagenome Rhizosphere
237 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
238 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
239 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
240 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
241 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
244 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
245 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
246 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
247 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
248 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
249 2643221544 Pelomonas sp. Root1444 Isolate Unclassified
250 2643221585 Pelomonas sp. Root662 Isolate Unclassified
251 2643221639 Pelomonas sp. Root1217 Isolate Unclassified
252 2643221646 Pelomonas sp. Root1237 Isolate Unclassified
253 2643221656 Pelomonas sp. Root405 Isolate Unclassified
254 2738541337 Pelomonas sp. BT06 Isolate Unclassified
255 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
256 2831864461 Roseateles noduli HZ7 Isolate Nodule
257 2842711865 Duganella sp. R-73148 Isolate Unclassified
258 2857558681 Duganella sp. R-74565 Isolate Unclassified
259 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.06
Metatranscriptomes 0
Isolates 1.94

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.64
Nodule 1.06
Rhizoplane 1.94
Rhizosphere 74.96
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0000921 3300053156 Bacteria 24968
2 JGI25156J39149_1000218 3300002705 Bacteria 39862
3 JGI25154J39366_1000340 3300002738 Bacteria 26958
4 JGI25154J39366_1003707 3300002738 Bacteria 3060
5 JGI25157J39369_1000018 3300002741 Bacteria 177410
6 JGI25150J39212_1006993 3300002774 Bacteria 2293
7 JGI25153J46596_10026164 3300003215 Bacteria 2071
8 rootH1_10007910 3300003316 Bacteria 10718
9 rootH1_10014334 3300003316 Bacteria 20021
10 rootH1_10015244 3300003316 Bacteria 4624
11 rootH1_10043190 3300003316 Bacteria 3275
12 rootH2_10041163 3300003320 Bacteria 7241
13 rootL2_10000355 3300003322 Bacteria 68136
14 rootL2_10003893 3300003322 Bacteria 19760
15 rootL2_10004528 3300003322 Bacteria 29873
16 rootL2_10026363 3300003322 Bacteria 11237
17 rootL2_10058409 3300003322 Bacteria 7163
18 rootL2_10058410 3300003322 Bacteria 3704
19 rootL2_10066771 3300003322 Bacteria 4740
20 rootH1_10001551 3300003323 Bacteria 9463
21 rootH1_10007488 3300003323 Bacteria 17583
22 rootH1_10056027 3300003323 Bacteria 6752
23 rootH1_10066620 3300003323 Bacteria 3700
24 rootH1_10084380 3300003323 Bacteria 1123
25 rootH1_10092016 3300003323 Bacteria 3971
26 Ga0055539_1000240 3300003752 Bacteria 36494
27 Ga0055539_1000791 3300003752 Bacteria 7539
28 Ga0055533_1000103 3300003756 Bacteria 107860
29 Ga0055525_1000013 3300003759 Bacteria 440870
30 Ga0055535_1000087 3300003761 Bacteria 102655
31 Ga0055529_1000032 3300003763 Bacteria 255895
32 Ga0055529_1000139 3300003763 Bacteria 102943
33 Ga0055526_1000320 3300003771 Bacteria 39805
34 Ga0055526_1000430 3300003771 Bacteria 33723
35 Ga0055526_1005697 3300003771 Bacteria 7062
36 Ga0055524_1000003 3300003775 Bacteria 399748
37 Ga0055524_1000479 3300003775 Bacteria 31779
38 Ga0055524_1000490 3300003775 Bacteria 31117
39 Ga0055524_1008098 3300003775 Bacteria 4393
40 Ga0055531_10000022 3300003794 Bacteria 166362
41 Ga0055531_10001050 3300003794 Bacteria 21793
42 Ga0055543_1002108 3300004625 Bacteria 6905
43 Ga0065165_1000079 3300005262 Bacteria 162095
44 Ga0070658_10159080 3300005327 Bacteria 1894
45 Ga0070658_10395357 3300005327 Bacteria 1187
46 Ga0070658_10535885 3300005327 Bacteria 1013
47 Ga0070690_100093821 3300005330 Bacteria 1980
48 Ga0068869_100130835 3300005334 Bacteria 1929
49 Ga0070682_100023330 3300005337 Bacteria 3672
50 Ga0070682_100141983 3300005337 Bacteria 1638
51 Ga0070660_100136499 3300005339 Bacteria 1965
52 Ga0070673_100291513 3300005364 Bacteria 1434
53 Ga0068867_100117105 3300005459 Bacteria 2054
54 Ga0070684_100063392 3300005535 Bacteria 3240
55 Ga0068855_100002529 3300005563 Bacteria 22530
56 Ga0068855_100101470 3300005563 Bacteria 3313
57 Ga0068855_100471430 3300005563 Bacteria 1367
58 Ga0068857_100001688 3300005577 Bacteria 17742
59 Ga0068856_100145377 3300005614 Bacteria 2379
60 Ga0068852_100127424 3300005616 Bacteria 2340
61 Ga0068861_100026072 3300005719 Bacteria 4246
62 Ga0068860_100011524 3300005843 Bacteria 8716
63 Ga0070717_10112959 3300006028 Bacteria 2319
64 Ga0075366_10003557 3300006195 Bacteria 8241
65 Ga0075366_10276070 3300006195 Bacteria 1027
66 Ga0075370_10016522 3300006353 Bacteria 3971
67 Ga0075370_10027510 3300006353 Bacteria 3156
68 Ga0099823_1000002 3300006944 Bacteria 212272
69 Ga0099826_10000002 3300006948 Bacteria 1125830
70 Ga0105240_10041904 3300009093 Bacteria 5838
71 Ga0105240_10108853 3300009093 Bacteria 3356
72 Ga0105243_10022566 3300009148 Bacteria 4785
73 Ga0105242_10195460 3300009176 Bacteria 1793
74 Ga0105242_10203544 3300009176 Bacteria 1760
75 Ga0105238_10120500 3300009551 Bacteria 2603
76 Ga0105239_10079521 3300010375 Bacteria 3607
77 Ga0157317_1003366 3300012475 Bacteria 993
78 Ga0157319_1000007 3300012497 Bacteria 318528
79 Ga0157371_10000077 3300013102 Bacteria 157429
80 Ga0157369_10034309 3300013105 Bacteria 5570
81 Ga0157372_10097273 3300013307 Bacteria 3356
82 Ga0157372_10354207 3300013307 Bacteria 1710
83 Ga0163163_10369838 3300014325 Bacteria 1490
84 Ga0157379_10015004 3300014968 Bacteria 6796
85 Ga0182005_1000037 3300015265 Bacteria 166102
86 Ga0213872_10000008 3300021361 Bacteria 226283
87 Ga0213872_10000127 3300021361 Bacteria 69204
88 Ga0213872_10000683 3300021361 Bacteria 25720
89 Ga0213872_10011112 3300021361 Bacteria 4266
90 Ga0213872_10014422 3300021361 Bacteria 3687
91 Ga0209674_100003 3300025226 Bacteria 2196646
92 Ga0209672_103728 3300025228 Bacteria 3042
93 Ga0209563_100025 3300025230 Bacteria 596456
94 Ga0209563_100141 3300025230 Bacteria 79513
95 Ga0207427_102220 3300025231 Bacteria 5490
96 Ga0209258_100044 3300025242 Bacteria 376336
97 Ga0209258_100531 3300025242 Bacteria 36288
98 Ga0209258_105996 3300025242 Bacteria 1961
99 Ga0207425_1000245 3300025245 Bacteria 41275
100 Ga0209646_1000051 3300025246 Bacteria 296525
101 Ga0209646_1000067 3300025246 Bacteria 241595
102 Ga0209026_1000033 3300025250 Bacteria 318512
103 Ga0209677_100293 3300025253 Bacteria 32941
104 Ga0209677_100339 3300025253 Bacteria 29853
105 Ga0209677_104350 3300025253 Bacteria 4128
106 Ga0209759_1000024 3300025256 Bacteria 318512
107 Ga0209759_1006309 3300025256 Bacteria 4004
108 Ga0209759_1015591 3300025256 Bacteria 1954
109 Ga0209455_1000043 3300025272 Bacteria 413928
110 Ga0209455_1000048 3300025272 Bacteria 376260
111 Ga0209673_1014611 3300025273 Bacteria 3030
112 Ga0209673_1019225 3300025273 Bacteria 2459
113 Ga0209025_1010537 3300025294 Bacteria 6252
114 Ga0209564_1000011 3300025295 Bacteria 822327
115 Ga0209564_1000030 3300025295 Bacteria 503296
116 Ga0209564_1000089 3300025295 Bacteria 249694
117 Ga0209758_1004343 3300025297 Bacteria 11876
118 Ga0209050_1002079 3300025298 Bacteria 18358
119 Ga0209050_1006524 3300025298 Bacteria 6875
120 Ga0209256_1000007 3300025299 Bacteria 1136599
121 Ga0209256_1000154 3300025299 Bacteria 144509
122 Ga0209256_1000659 3300025299 Bacteria 46883
123 Ga0209256_1025868 3300025299 Bacteria 1702
124 Ga0209051_1002564 3300025303 Bacteria 12827
125 Ga0209051_1002662 3300025303 Bacteria 12493
126 Ga0209257_1000061 3300025304 Bacteria 367698
127 Ga0209257_1001047 3300025304 Bacteria 36766
128 Ga0207655_1017254 3300025728 Bacteria 3901
129 Ga0207705_10072458 3300025909 Bacteria 2499
130 Ga0207705_10110400 3300025909 Bacteria 2032
131 Ga0207695_10022513 3300025913 Bacteria 7150
132 Ga0207695_10037598 3300025913 Bacteria 5222
133 Ga0207695_10246802 3300025913 Bacteria 1685
134 Ga0207671_10482032 3300025914 Bacteria 988
135 Ga0207657_10007109 3300025919 Bacteria 11497
136 Ga0207694_10024369 3300025924 Bacteria 4595
137 Ga0207686_10049096 3300025934 Bacteria 2618
138 Ga0207686_10114828 3300025934 Bacteria 1823
139 Ga0207709_10020352 3300025935 Bacteria 3742
140 Ga0207709_10068913 3300025935 Bacteria 2237
141 Ga0207709_10300816 3300025935 Bacteria 1193
142 Ga0207704_10259028 3300025938 Bacteria 1310
143 Ga0207689_10129109 3300025942 Bacteria 2080
144 Ga0207667_10021616 3300025949 Bacteria 7127
145 Ga0207667_10109599 3300025949 Bacteria 2847
146 Ga0207667_10302821 3300025949 Bacteria 1633
147 Ga0207667_10346337 3300025949 Bacteria 1516
148 Ga0207651_10016670 3300025960 Bacteria 4313
149 Ga0207640_10001453 3300025981 Bacteria 12813
150 Ga0207639_10314482 3300026041 Bacteria 1388
151 Ga0207678_10258077 3300026067 Bacteria 1493
152 Ga0207702_10040381 3300026078 Bacteria 3912
153 Ga0207702_10082723 3300026078 Bacteria 2792
154 Ga0207648_10155551 3300026089 Bacteria 2018
155 Ga0207674_10013645 3300026116 Bacteria 8998
156 Ga0207674_10077253 3300026116 Bacteria 3336
157 Ga0207674_10538835 3300026116 Bacteria 1128
158 Ga0207675_100170901 3300026118 Bacteria 2077
159 Ga0209281_1011276 3300027111 Bacteria 2007
160 Ga0209389_1000340 3300027296 Bacteria 28501
161 Ga0209282_1000001 3300027666 Bacteria 2450367
162 Ga0268264_10078009 3300028381 Bacteria 2823
163 Ga0265336_10000053 3300028666 Bacteria 113034
164 Ga0307515_10042541 3300028794 Bacteria 7101
165 Ga0307515_10099223 3300028794 Bacteria 3538
166 Ga0307515_10198674 3300028794 Bacteria 1889
167 Ga0265324_10000132 3300029957 Bacteria 58866
168 Ga0307512_10013050 3300030522 Bacteria 7806
169 Ga0316177_1113771 3300030731 Bacteria 2358
170 Ga0316180_1171083 3300030736 Bacteria 1342
171 Ga0265328_10007408 3300031239 Bacteria 4574
172 Ga0265331_10002254 3300031250 Bacteria 13195
173 Ga0265327_10000309 3300031251 Bacteria 94387
174 Ga0307509_10000135 3300031507 Bacteria 109066
175 Ga0307509_10042110 3300031507 Bacteria 4951
176 Ga0307509_10044925 3300031507 Bacteria 4769
177 Ga0307408_100000006 3300031548 Bacteria 472824
178 Ga0307408_100000010 3300031548 Bacteria 420048
179 Ga0307408_100006745 3300031548 Bacteria 7609
180 Ga0307508_10032855 3300031616 Bacteria 4685
181 Ga0307514_10122887 3300031649 Bacteria 1806
182 Ga0307516_10021704 3300031730 Bacteria 6601
183 Ga0307411_10000146 3300032005 Bacteria 22416
184 Ga0307507_10039139 3300033179 Bacteria 4791
185 Ga0307510_10003036 3300033180 Bacteria 19364
186 Ga0307510_10010819 3300033180 Bacteria 10846
187 Ga0373950_0003785 3300034818 Bacteria 2188
188 Ga0373934_0051111 3300035086 Bacteria 1638
189 Ga0373940_0010265 3300035088 Bacteria 2197
190 Ga0373939_0000157 3300035114 Bacteria 18940
191 Ga0373960_0000353 3300035121 Bacteria 8883
192 Ga0373961_0022987 3300035241 Bacteria 1673
193 Ga0373931_0043937 3300035691 Bacteria 2355
194 Ga0373931_0401244 3300035691 Bacteria 868
195 Ga0395899_0023228 3300037312 Bacteria 4701
196 Ga0395900_0000054 3300037418 Bacteria 220487
197 Ga0395900_0026912 3300037418 Bacteria 5886
198 Ga0395898_0001324 3300037466 Bacteria 35935
199 Ga0395898_0008499 3300037466 Bacteria 10846
200 Ga0395898_0056911 3300037466 Bacteria 3810
201 Ga0395905_0002699 3300037471 Bacteria 19454
202 Ga0395905_0051256 3300037471 Bacteria 3865
203 Ga0395905_0074275 3300037471 Bacteria 3186
204 Ga0395905_0147103 3300037471 Bacteria 2217
205 Ga0395901_0004830 3300038443 Bacteria 13599
206 Ga0395901_0147855 3300038443 Bacteria 2469
207 Ga0436361_0126586 3300039447 Bacteria 4704
208 Ga0436361_0144792 3300039447 Bacteria 34252
209 Ga0436361_0148536 3300039447 Bacteria 3857
210 Ga0436361_0356304 3300039447 Bacteria 5683
211 Ga0436361_0362312 3300039447 Bacteria 55943
212 Ga0439454_009076 3300042011 Bacteria 1285
213 Ga0450888_000383 3300042126 Bacteria 4182
214 Ga0450891_000565 3300042129 Bacteria 3848
215 Ga0450892_000489 3300042130 Bacteria 4574
216 Ga0450904_000159 3300042139 Bacteria 14788
217 Ga0439459_0028409 3300042438 Bacteria 1122
218 Ga0450916_012272 3300042530 Bacteria 1092
219 Ga0451577_0003749 3300042876 Bacteria 16566
220 Ga0451577_0003877 3300042876 Bacteria 16213
221 Ga0466969_0000029 3300044656 Bacteria 92006
222 Ga0466969_0038270 3300044656 Bacteria 2415
223 Ga0466965_0002529 3300044683 Bacteria 7800
224 Ga0466965_0005451 3300044683 Bacteria 5734
225 Ga0466966_0026394 3300044684 Bacteria 3791
226 Ga0466961_0109647 3300044693 Bacteria 1737
227 Ga0466963_0027186 3300044694 Bacteria 3662
228 Ga0466964_0013162 3300044706 Bacteria 3136
229 Ga0453684_0297692 3300044712 Bacteria 1835
230 Ga0453684_0428084 3300044712 Bacteria 1477
231 Ga0466971_0008714 3300044719 Bacteria 4425
232 Ga0466970_0009189 3300044765 Bacteria 4987
233 Ga0466970_0047072 3300044765 Bacteria 2298
234 Ga0466970_0102217 3300044765 Bacteria 1561
235 Ga0466957_0013563 3300044842 Bacteria 4729
236 Ga0466959_0002381 3300045049 Bacteria 11985
237 Ga0466959_0202491 3300045049 Bacteria 1381
238 Ga0451576_0069862 3300045051 Bacteria 3655
239 Ga0451576_0163375 3300045051 Bacteria 2324
240 Ga0466958_0242967 3300045836 Bacteria 1150
241 Ga0466967_0031462 3300045976 Bacteria 4467
242 Ga0466967_0053715 3300045976 Bacteria 3542
243 Ga0466967_0054304 3300045976 Bacteria 3525
244 Ga0466967_0170719 3300045976 Bacteria 2046
245 Ga0495617_000108 3300046452 Bacteria 60724
246 Ga0495627_000249 3300046453 Bacteria 55885
247 Ga0495603_0033689 3300046455 Bacteria 3081
248 Ga0495603_0073856 3300046455 Bacteria 2003
249 Ga0495590_0000002 3300046457 Bacteria 485720
250 Ga0495590_0000263 3300046457 Bacteria 28597
251 Ga0495590_0046751 3300046457 Bacteria 1510
252 Ga0495591_000132 3300046458 Bacteria 81947
253 Ga0495629_0007599 3300046459 Bacteria 7987
254 Ga0495638_0000367 3300046460 Bacteria 55964
255 Ga0495638_0013166 3300046460 Bacteria 5643
256 Ga0495653_0000023 3300046463 Bacteria 166207
257 Ga0495653_0020939 3300046463 Bacteria 5298
258 Ga0495653_0038430 3300046463 Bacteria 3757
259 Ga0495653_0047587 3300046463 Bacteria 3316
260 Ga0495650_0000001 3300046471 Bacteria 1085492
261 Ga0495650_0000019 3300046471 Bacteria 533849
262 Ga0495650_0000521 3300046471 Bacteria 56415
263 Ga0495650_0000618 3300046471 Bacteria 48166
264 Ga0495650_0000933 3300046471 Bacteria 33909
265 Ga0495650_0003941 3300046471 Bacteria 10457
266 Ga0495650_0008822 3300046471 Bacteria 5826
267 Ga0495650_0009101 3300046471 Bacteria 5693
268 Ga0495650_0009787 3300046471 Bacteria 5419
269 Ga0495650_0014959 3300046471 Bacteria 4004
270 Ga0495650_0026018 3300046471 Bacteria 2730
271 Ga0495580_0022635 3300046472 Bacteria 4622
272 Ga0495580_0110002 3300046472 Bacteria 1913
273 Ga0495580_0150904 3300046472 Bacteria 1610
274 Ga0495582_0038139 3300046473 Bacteria 2643
275 Ga0495582_0118395 3300046473 Bacteria 1491
276 Ga0495605_0000028 3300046474 Bacteria 218471
277 Ga0495605_0000407 3300046474 Bacteria 39381
278 Ga0495605_0010717 3300046474 Bacteria 5123
279 Ga0495639_0007458 3300046475 Bacteria 4695
280 Ga0495639_0093404 3300046475 Bacteria 1414
281 Ga0495584_0000487 3300046491 Bacteria 27306
282 Ga0495584_0036699 3300046491 Bacteria 2476
283 Ga0495584_0118985 3300046491 Bacteria 1337
284 Ga0495585_0003243 3300046492 Bacteria 11094
285 Ga0495585_0009831 3300046492 Bacteria 5721
286 Ga0495585_0018215 3300046492 Bacteria 4052
287 Ga0495585_0027266 3300046492 Bacteria 3259
288 Ga0495585_0028076 3300046492 Bacteria 3211
289 Ga0495585_0033664 3300046492 Bacteria 2900
290 Ga0495585_0202963 3300046492 Bacteria 1008
291 Ga0495594_0069630 3300046499 Bacteria 1954
292 Ga0495594_0079511 3300046499 Bacteria 1830
293 Ga0495596_0002010 3300046500 Bacteria 11198
294 Ga0495596_0003257 3300046500 Bacteria 8297
295 Ga0495596_0005785 3300046500 Bacteria 5794
296 Ga0495596_0006173 3300046500 Bacteria 5552
297 Ga0495596_0008015 3300046500 Bacteria 4723
298 Ga0495596_0055070 3300046500 Bacteria 1554
299 Ga0495607_0001994 3300046501 Bacteria 17177
300 Ga0495607_0004620 3300046501 Bacteria 10078
301 Ga0495607_0006715 3300046501 Bacteria 8052
302 Ga0495607_0007751 3300046501 Bacteria 7392
303 Ga0495607_0114224 3300046501 Bacteria 1427
304 Ga0495607_0175319 3300046501 Bacteria 1079
305 Ga0495583_0000159 3300046506 Bacteria 113627
306 Ga0495583_0000741 3300046506 Bacteria 41476
307 Ga0495583_0000907 3300046506 Bacteria 35148
308 Ga0495583_0001433 3300046506 Bacteria 24228
309 Ga0495583_0003983 3300046506 Bacteria 10905
310 Ga0495583_0014597 3300046506 Bacteria 4323
311 Ga0495583_0061146 3300046506 Bacteria 1681
312 Ga0495606_0000001 3300046507 Bacteria 592123
313 Ga0495606_0000549 3300046507 Bacteria 60133
314 Ga0495606_0000601 3300046507 Bacteria 57004
315 Ga0495606_0001009 3300046507 Bacteria 40935
316 Ga0495606_0003740 3300046507 Bacteria 15849
317 Ga0495606_0003954 3300046507 Bacteria 15214
318 Ga0495606_0005710 3300046507 Bacteria 11774
319 Ga0495606_0010695 3300046507 Bacteria 7575
320 Ga0495606_0017867 3300046507 Bacteria 5341
321 Ga0495606_0090548 3300046507 Bacteria 1882
322 Ga0495606_0220788 3300046507 Bacteria 1068
323 Ga0495610_0000106 3300046512 Bacteria 97582
324 Ga0495610_0001401 3300046512 Bacteria 21420
325 Ga0495610_0002648 3300046512 Bacteria 14793
326 Ga0495610_0003856 3300046512 Bacteria 11397
327 Ga0495610_0004104 3300046512 Bacteria 10902
328 Ga0495610_0012181 3300046512 Bacteria 5194
329 Ga0495610_0019764 3300046512 Bacteria 3756
330 Ga0495616_0000611 3300046513 Bacteria 26961
331 Ga0495616_0004279 3300046513 Bacteria 9017
332 Ga0495616_0007856 3300046513 Bacteria 6362
333 Ga0495616_0041103 3300046513 Bacteria 2360
334 Ga0495616_0140128 3300046513 Bacteria 1101
335 Ga0495631_0004138 3300046518 Bacteria 7776
336 Ga0495631_0006120 3300046518 Bacteria 6240
337 Ga0495631_0008446 3300046518 Bacteria 5190
338 Ga0495631_0009708 3300046518 Bacteria 4797
339 Ga0495632_0000264 3300046519 Bacteria 52194
340 Ga0495632_0000674 3300046519 Bacteria 31134
341 Ga0495632_0002656 3300046519 Bacteria 13415
342 Ga0495632_0009857 3300046519 Bacteria 5712
343 Ga0495632_0013614 3300046519 Bacteria 4631
344 Ga0495637_0000028 3300046520 Bacteria 144203
345 Ga0495643_0000444 3300046522 Bacteria 53441
346 Ga0495643_0000643 3300046522 Bacteria 41372
347 Ga0495643_0015876 3300046522 Bacteria 4435
348 Ga0495644_0003657 3300046523 Bacteria 6059
349 Ga0495644_0003685 3300046523 Bacteria 6028
350 Ga0495644_0013544 3300046523 Bacteria 3128
351 Ga0495644_0037290 3300046523 Bacteria 1834
352 Ga0495644_0052454 3300046523 Bacteria 1531
353 Ga0495648_0000311 3300046524 Bacteria 53614
354 Ga0495648_0000836 3300046524 Bacteria 32474
355 Ga0495648_0002684 3300046524 Bacteria 16084
356 Ga0495648_0010964 3300046524 Bacteria 6872
357 Ga0495648_0032842 3300046524 Bacteria 3399
358 Ga0495648_0038113 3300046524 Bacteria 3079
359 Ga0495666_0000961 3300046526 Bacteria 13594
360 Ga0495666_0003876 3300046526 Bacteria 7565
361 Ga0495666_0004089 3300046526 Bacteria 7371
362 Ga0495642_0000801 3300046528 Bacteria 15285
363 Ga0495642_0002511 3300046528 Bacteria 7433
364 Ga0495642_0003207 3300046528 Bacteria 6484
365 Ga0495642_0007748 3300046528 Bacteria 4115
366 Ga0495642_0020024 3300046528 Bacteria 2624
367 Ga0495642_0028163 3300046528 Bacteria 2237
368 Ga0495652_0017070 3300046529 Bacteria 6482
369 Ga0495652_0033748 3300046529 Bacteria 4465
370 Ga0495654_0000015 3300046530 Bacteria 307873
371 Ga0495654_0001129 3300046530 Bacteria 19240
372 Ga0495654_0009628 3300046530 Bacteria 5291
373 Ga0495654_0012729 3300046530 Bacteria 4516
374 Ga0495654_0068932 3300046530 Bacteria 1680
375 Ga0495665_0009456 3300046531 Bacteria 5275
376 Ga0495665_0020604 3300046531 Bacteria 3540
377 Ga0495586_0021917 3300046535 Bacteria 3409
378 Ga0495586_0046548 3300046535 Bacteria 2338
379 Ga0495587_0044006 3300046536 Bacteria 2656
380 Ga0495609_0001680 3300046538 Bacteria 14357
381 Ga0495609_0002912 3300046538 Bacteria 10190
382 Ga0495609_0015887 3300046538 Bacteria 3515
383 Ga0495609_0098619 3300046538 Bacteria 1267
384 Ga0495597_0000327 3300046542 Bacteria 43101
385 Ga0495597_0001304 3300046542 Bacteria 18318
386 Ga0495597_0002613 3300046542 Bacteria 11206
387 Ga0495597_0055278 3300046542 Bacteria 1741
388 Ga0495645_0075302 3300046543 Bacteria 2429
389 Ga0495622_0000375 3300046557 Bacteria 30870
390 Ga0495622_0000567 3300046557 Bacteria 22203
391 Ga0495622_0101053 3300046557 Bacteria 1322
392 Ga0495633_0000244 3300046558 Bacteria 65398
393 Ga0495633_0004279 3300046558 Bacteria 9123
394 Ga0495633_0004813 3300046558 Bacteria 8466
395 Ga0495633_0006081 3300046558 Bacteria 7233
396 Ga0495633_0012680 3300046558 Bacteria 4472
397 Ga0495633_0023115 3300046558 Bacteria 3081
398 Ga0495633_0028237 3300046558 Bacteria 2737
399 Ga0495633_0049658 3300046558 Bacteria 1979
400 Ga0495667_0155983 3300046559 Bacteria 1469
401 Ga0495656_0001178 3300046615 Bacteria 8511
402 Ga0495668_0000241 3300046616 Bacteria 78040
403 Ga0495668_0000972 3300046616 Bacteria 31521
404 Ga0495668_0001358 3300046616 Bacteria 24017
405 Ga0495668_0001812 3300046616 Bacteria 19426
406 Ga0495668_0006872 3300046616 Bacteria 7376
407 Ga0495668_0038718 3300046616 Bacteria 2663
408 Ga0495668_0060072 3300046616 Bacteria 2097
409 Ga0495668_0114494 3300046616 Bacteria 1475
410 Ga0495634_0056764 3300046642 Bacteria 2615
411 Ga0495611_0000260 3300046648 Bacteria 36404
412 Ga0495611_0064376 3300046648 Bacteria 1669
413 Ga0495625_0001278 3300046660 Bacteria 31574
414 Ga0495625_0009607 3300046660 Bacteria 8071
415 Ga0495625_0015118 3300046660 Bacteria 6126
416 Ga0495625_0029273 3300046660 Bacteria 4122
417 Ga0495661_0013033 3300046665 Bacteria 5599
418 Ga0495661_0021688 3300046665 Bacteria 4183
419 Ga0495661_0030096 3300046665 Bacteria 3459
420 Ga0495661_0031595 3300046665 Bacteria 3357
421 Ga0495661_0069616 3300046665 Bacteria 2061
422 Ga0495661_0105680 3300046665 Bacteria 1576
423 Ga0495588_0003963 3300046674 Bacteria 6499
424 Ga0495588_0009565 3300046674 Bacteria 4485
425 Ga0495588_0096004 3300046674 Bacteria 1554
426 Ga0495623_0003760 3300046679 Bacteria 10004
427 Ga0495623_0012559 3300046679 Bacteria 5481
428 Ga0495623_0082547 3300046679 Bacteria 1986
429 Ga0495658_0120897 3300046683 Bacteria 1584
430 Ga0495669_0001080 3300046684 Bacteria 11310
431 Ga0495669_0003933 3300046684 Bacteria 6120
432 Ga0495669_0005276 3300046684 Bacteria 5382
433 Ga0495669_0025446 3300046684 Bacteria 2581
434 Ga0495669_0097043 3300046684 Bacteria 1366
435 Ga0495613_0083263 3300046689 Bacteria 2323
436 Ga0495624_0001233 3300046690 Bacteria 20184
437 Ga0495624_0066081 3300046690 Bacteria 2258
438 Ga0495670_0010685 3300046691 Bacteria 4513
439 Ga0495670_0027381 3300046691 Bacteria 2823
440 Ga0495670_0211314 3300046691 Bacteria 1029
441 Ga0495671_0000006 3300046692 Bacteria 500471
442 Ga0495671_0001032 3300046692 Bacteria 19378
443 Ga0495671_0002705 3300046692 Bacteria 11103
444 Ga0495671_0005308 3300046692 Bacteria 7561
445 Ga0495671_0038930 3300046692 Bacteria 2402
446 Ga0495671_0159254 3300046692 Bacteria 1098
447 Ga0495649_0000185 3300046694 Bacteria 54619
448 Ga0495649_0003174 3300046694 Bacteria 11239
449 Ga0495649_0005881 3300046694 Bacteria 7705
450 Ga0495649_0015307 3300046694 Bacteria 4367
451 Ga0495649_0024060 3300046694 Bacteria 3400
452 Ga0495649_0037120 3300046694 Bacteria 2675
453 Ga0495649_0165019 3300046694 Bacteria 1161
454 Ga0495649_0305677 3300046694 Bacteria 809
455 Ga0495589_0000705 3300046794 Bacteria 21771
456 Ga0495589_0028693 3300046794 Bacteria 2807
457 Ga0495589_0039914 3300046794 Bacteria 2344
458 Ga0495600_0053182 3300046809 Bacteria 2644
459 Ga0495600_0147855 3300046809 Bacteria 1522
460 Ga0495660_0006530 3300046810 Bacteria 6890
461 Ga0495660_0009426 3300046810 Bacteria 5694
462 Ga0495660_0013392 3300046810 Bacteria 4754
463 Ga0495581_0005630 3300047315 Bacteria 7262
464 Ga0495604_0026315 3300047317 Bacteria 4632
465 Ga0495604_0164503 3300047317 Bacteria 1565
466 Ga0495672_0000305 3300047320 Bacteria 66204
467 Ga0495672_0000753 3300047320 Bacteria 35468
468 Ga0495672_0000765 3300047320 Bacteria 34954
469 Ga0495672_0066960 3300047320 Bacteria 2047
470 Ga0495676_0268964 3300047321 Bacteria 1157
471 Ga0495680_0067165 3300047322 Bacteria 2742
472 Ga0495683_0001053 3300047323 Bacteria 19170
473 Ga0495683_0007403 3300047323 Bacteria 5944
474 Ga0495683_0011684 3300047323 Bacteria 4619
475 Ga0495683_0042278 3300047323 Bacteria 2298
476 Ga0495683_0051506 3300047323 Bacteria 2057
477 Ga0495683_0065786 3300047323 Bacteria 1787
478 Ga0495687_005888 3300047443 Bacteria 7670
479 Ga0495687_005940 3300047443 Bacteria 7625
480 Ga0495675_0008345 3300047444 Bacteria 6413
481 Ga0495677_0000193 3300047445 Bacteria 28150
482 Ga0495677_0000799 3300047445 Bacteria 12713
483 Ga0495677_0005280 3300047445 Bacteria 4905
484 Ga0495677_0025216 3300047445 Bacteria 2157
485 Ga0495679_006578 3300047446 Bacteria 4975
486 Ga0495679_016128 3300047446 Bacteria 2710
487 Ga0495679_016359 3300047446 Bacteria 2685
488 Ga0495685_055237 3300047447 Bacteria 1343
489 Ga0495673_0000003 3300047469 Bacteria 1491337
490 Ga0495673_0000061 3300047469 Bacteria 230647
491 Ga0495673_0000351 3300047469 Bacteria 57305
492 Ga0495681_0000317 3300047470 Bacteria 38608
493 Ga0495681_0035659 3300047470 Bacteria 2468
494 Ga0495681_0059974 3300047470 Bacteria 1757
495 Ga0495686_0000735 3300047472 Bacteria 43727
496 Ga0495686_0001857 3300047472 Bacteria 21192
497 Ga0495686_0005890 3300047472 Bacteria 9552
498 Ga0495686_0072476 3300047472 Bacteria 2117
499 Ga0495686_0091568 3300047472 Bacteria 1845
500 Ga0495593_0022436 3300047673 Bacteria 3517
501 Ga0495593_0093625 3300047673 Bacteria 1546
502 Ga0495593_0102611 3300047673 Bacteria 1466
503 Ga0495602_0001033 3300048088 Bacteria 27111
504 Ga0495602_0112876 3300048088 Bacteria 2204
505 Ga0495626_0007035 3300048091 Bacteria 6318
506 Ga0495626_0012659 3300048091 Bacteria 4412
507 Ga0495626_0021189 3300048091 Bacteria 3228
508 Ga0495626_0025958 3300048091 Bacteria 2859
509 Ga0495626_0027138 3300048091 Bacteria 2785
510 Ga0495626_0165214 3300048091 Bacteria 925
511 Ga0496100_0087665 3300048903 Bacteria 2116
512 Ga0496102_0005900 3300048905 Bacteria 10428
513 Ga0496102_0043006 3300048905 Bacteria 4095
514 Ga0496102_0186743 3300048905 Bacteria 1953
515 Ga0496102_0724437 3300048905 Bacteria 917
516 Ga0496103_0006928 3300048906 Bacteria 6767
517 Ga0496103_0097291 3300048906 Bacteria 1860
518 Ga0496105_0255795 3300048908 Bacteria 1418
519 Ga0496106_0173740 3300048909 Bacteria 1709
520 Ga0496115_0043245 3300048918 Bacteria 3592
521 Ga0496115_0111169 3300048918 Bacteria 2251
522 Ga0496122_0018898 3300048925 Bacteria 6330
523 Ga0496122_0053829 3300048925 Bacteria 3029
524 Ga0496123_0012508 3300048926 Bacteria 7230
525 Ga0496124_0019804 3300048927 Bacteria 6244
526 Ga0496124_0027331 3300048927 Bacteria 5123
527 Ga0496124_0045340 3300048927 Bacteria 3769
528 Ga0496124_0064950 3300048927 Bacteria 3045
529 Ga0496124_0104049 3300048927 Bacteria 2296
530 Ga0496126_0025849 3300048929 Bacteria 5640
531 Ga0496126_0232672 3300048929 Bacteria 1543
532 Ga0495678_000188 3300049459 Bacteria 72283
533 Ga0495678_000264 3300049459 Bacteria 58107
534 Ga0495678_000917 3300049459 Bacteria 25905
535 Ga0495678_001434 3300049459 Bacteria 18756
536 Ga0495678_010898 3300049459 Bacteria 4382
537 Ga0495682_0004222 3300049460 Bacteria 6216
538 Ga0495682_0004832 3300049460 Bacteria 5690
539 Ga0501211_008053 3300049658 Bacteria 1030
540 Ga0501249_001953 3300049679 Bacteria 4194
541 Ga0501221_045392 3300049704 Bacteria 973
542 Ga0501267_000045 3300049764 Bacteria 6853
543 Ga0501269_000545 3300049766 Bacteria 7303
544 Ga0501272_000469 3300049769 Bacteria 3552
545 Ga0501035_0070534 3300049822 Bacteria 3095
546 nmdc:mga0k408_220_c1 3300050493 Bacteria 24186
547 nmdc:mga0k408_71619_c1 3300050493 Bacteria 2023
548 nmdc:mga0k408_87236_c1 3300050493 Bacteria 1832
549 nmdc:mga0k408_9548_c1 3300050493 Bacteria 5235
550 nmdc:mga07m45_85950_c1 3300050496 Bacteria 1799
551 nmdc:mga07m45_89868_c1 3300050496 Bacteria 1759
552 Ga0500635_0001602 3300053080 Bacteria 5459
553 Ga0500586_000241 3300053145 Bacteria 10810
554 Ga0500586_001437 3300053145 Bacteria 5024
555 Ga0500636_0038941 3300053177 Bacteria 2811
556 Ga0466962_0003423 3300061719 Bacteria 7556
557 2643744379 2643221544 Bacteria 5886209
558 2643934334 2643221585 Bacteria 5812563
559 2644219445 2643221639 Bacteria 6649903
560 2644255881 2643221646 Bacteria 6433402
561 2644315821 2643221656 Bacteria 5809961
562 2739054339 2738541337 Bacteria 6183410
563 2809147265 2808606418 Bacteria 6724496
564 2831865334 2831864461 Bacteria 6502356
565 2842712681 2842711865 Bacteria 7155354
566 2857561063 2857558681 Bacteria 6617694
567 2904425485 2904424332 Bacteria 7633521
568 Ga0500622_0000921
569 JGI25156J39149_1000218
570 JGI25154J39366_1000340
571 JGI25154J39366_1003707
572 JGI25157J39369_1000018
573 JGI25150J39212_1006993
574 JGI25153J46596_10026164
575 rootH1_10007910
576 rootH1_10014334
577 rootH1_10015244
578 rootH1_10043190
579 rootH2_10041163
580 rootL2_10000355
581 rootL2_10003893
582 rootL2_10004528
583 rootL2_10026363
584 rootL2_10058409
585 rootL2_10058410
586 rootL2_10066771
587 rootH1_10001551
588 rootH1_10007488
589 rootH1_10056027
590 rootH1_10066620
591 rootH1_10084380
592 rootH1_10092016
593 Ga0055539_1000240
594 Ga0055539_1000791
595 Ga0055533_1000103
596 Ga0055525_1000013
597 Ga0055535_1000087
598 Ga0055529_1000032
599 Ga0055529_1000139
600 Ga0055526_1000320
601 Ga0055526_1000430
602 Ga0055526_1005697
603 Ga0055524_1000003
604 Ga0055524_1000479
605 Ga0055524_1000490
606 Ga0055524_1008098
607 Ga0055531_10000022
608 Ga0055531_10001050
609 Ga0055543_1002108
610 Ga0065165_1000079
611 Ga0070658_10159080
612 Ga0070658_10395357
613 Ga0070658_10535885
614 Ga0070690_100093821
615 Ga0068869_100130835
616 Ga0070682_100023330
617 Ga0070682_100141983
618 Ga0070660_100136499
619 Ga0070673_100291513
620 Ga0068867_100117105
621 Ga0070684_100063392
622 Ga0068855_100002529
623 Ga0068855_100101470
624 Ga0068855_100471430
625 Ga0068857_100001688
626 Ga0068856_100145377
627 Ga0068852_100127424
628 Ga0068861_100026072
629 Ga0068860_100011524
630 Ga0070717_10112959
631 Ga0075366_10003557
632 Ga0075366_10276070
633 Ga0075370_10016522
634 Ga0075370_10027510
635 Ga0099823_1000002
636 Ga0099826_10000002
637 Ga0105240_10041904
638 Ga0105240_10108853
639 Ga0105243_10022566
640 Ga0105242_10195460
641 Ga0105242_10203544
642 Ga0105238_10120500
643 Ga0105239_10079521
644 Ga0157317_1003366
645 Ga0157319_1000007
646 Ga0157371_10000077
647 Ga0157369_10034309
648 Ga0157372_10097273
649 Ga0157372_10354207
650 Ga0163163_10369838
651 Ga0157379_10015004
652 Ga0182005_1000037
653 Ga0213872_10000008
654 Ga0213872_10000127
655 Ga0213872_10000683
656 Ga0213872_10011112
657 Ga0213872_10014422
658 Ga0209674_100003
659 Ga0209672_103728
660 Ga0209563_100025
661 Ga0209563_100141
662 Ga0207427_102220
663 Ga0209258_100044
664 Ga0209258_100531
665 Ga0209258_105996
666 Ga0207425_1000245
667 Ga0209646_1000051
668 Ga0209646_1000067
669 Ga0209026_1000033
670 Ga0209677_100293
671 Ga0209677_100339
672 Ga0209677_104350
673 Ga0209759_1000024
674 Ga0209759_1006309
675 Ga0209759_1015591
676 Ga0209455_1000043
677 Ga0209455_1000048
678 Ga0209673_1014611
679 Ga0209673_1019225
680 Ga0209025_1010537
681 Ga0209564_1000011
682 Ga0209564_1000030
683 Ga0209564_1000089
684 Ga0209758_1004343
685 Ga0209050_1002079
686 Ga0209050_1006524
687 Ga0209256_1000007
688 Ga0209256_1000154
689 Ga0209256_1000659
690 Ga0209256_1025868
691 Ga0209051_1002564
692 Ga0209051_1002662
693 Ga0209257_1000061
694 Ga0209257_1001047
695 Ga0207655_1017254
696 Ga0207705_10072458
697 Ga0207705_10110400
698 Ga0207695_10022513
699 Ga0207695_10037598
700 Ga0207695_10246802
701 Ga0207671_10482032
702 Ga0207657_10007109
703 Ga0207694_10024369
704 Ga0207686_10049096
705 Ga0207686_10114828
706 Ga0207709_10020352
707 Ga0207709_10068913
708 Ga0207709_10300816
709 Ga0207704_10259028
710 Ga0207689_10129109
711 Ga0207667_10021616
712 Ga0207667_10109599
713 Ga0207667_10302821
714 Ga0207667_10346337
715 Ga0207651_10016670
716 Ga0207640_10001453
717 Ga0207639_10314482
718 Ga0207678_10258077
719 Ga0207702_10040381
720 Ga0207702_10082723
721 Ga0207648_10155551
722 Ga0207674_10013645
723 Ga0207674_10077253
724 Ga0207674_10538835
725 Ga0207675_100170901
726 Ga0209281_1011276
727 Ga0209389_1000340
728 Ga0209282_1000001
729 Ga0268264_10078009
730 Ga0265336_10000053
731 Ga0307515_10042541
732 Ga0307515_10099223
733 Ga0307515_10198674
734 Ga0265324_10000132
735 Ga0307512_10013050
736 Ga0316177_1113771
737 Ga0316180_1171083
738 Ga0265328_10007408
739 Ga0265331_10002254
740 Ga0265327_10000309
741 Ga0307509_10000135
742 Ga0307509_10042110
743 Ga0307509_10044925
744 Ga0307408_100000006
745 Ga0307408_100000010
746 Ga0307408_100006745
747 Ga0307508_10032855
748 Ga0307514_10122887
749 Ga0307516_10021704
750 Ga0307411_10000146
751 Ga0307507_10039139
752 Ga0307510_10003036
753 Ga0307510_10010819
754 Ga0373950_0003785
755 Ga0373934_0051111
756 Ga0373940_0010265
757 Ga0373939_0000157
758 Ga0373960_0000353
759 Ga0373961_0022987
760 Ga0373931_0043937
761 Ga0373931_0401244
762 Ga0395899_0023228
763 Ga0395900_0000054
764 Ga0395900_0026912
765 Ga0395898_0001324
766 Ga0395898_0008499
767 Ga0395898_0056911
768 Ga0395905_0002699
769 Ga0395905_0051256
770 Ga0395905_0074275
771 Ga0395905_0147103
772 Ga0395901_0004830
773 Ga0395901_0147855
774 Ga0436361_0126586
775 Ga0436361_0144792
776 Ga0436361_0148536
777 Ga0436361_0356304
778 Ga0436361_0362312
779 Ga0439454_009076
780 Ga0450888_000383
781 Ga0450891_000565
782 Ga0450892_000489
783 Ga0450904_000159
784 Ga0439459_0028409
785 Ga0450916_012272
786 Ga0451577_0003749
787 Ga0451577_0003877
788 Ga0466969_0000029
789 Ga0466969_0038270
790 Ga0466965_0002529
791 Ga0466965_0005451
792 Ga0466966_0026394
793 Ga0466961_0109647
794 Ga0466963_0027186
795 Ga0466964_0013162
796 Ga0453684_0297692
797 Ga0453684_0428084
798 Ga0466971_0008714
799 Ga0466970_0009189
800 Ga0466970_0047072
801 Ga0466970_0102217
802 Ga0466957_0013563
803 Ga0466959_0002381
804 Ga0466959_0202491
805 Ga0451576_0069862
806 Ga0451576_0163375
807 Ga0466958_0242967
808 Ga0466967_0031462
809 Ga0466967_0053715
810 Ga0466967_0054304
811 Ga0466967_0170719
812 Ga0495617_000108
813 Ga0495627_000249
814 Ga0495603_0033689
815 Ga0495603_0073856
816 Ga0495590_0000002
817 Ga0495590_0000263
818 Ga0495590_0046751
819 Ga0495591_000132
820 Ga0495629_0007599
821 Ga0495638_0000367
822 Ga0495638_0013166
823 Ga0495653_0000023
824 Ga0495653_0020939
825 Ga0495653_0038430
826 Ga0495653_0047587
827 Ga0495650_0000001
828 Ga0495650_0000019
829 Ga0495650_0000521
830 Ga0495650_0000618
831 Ga0495650_0000933
832 Ga0495650_0003941
833 Ga0495650_0008822
834 Ga0495650_0009101
835 Ga0495650_0009787
836 Ga0495650_0014959
837 Ga0495650_0026018
838 Ga0495580_0022635
839 Ga0495580_0110002
840 Ga0495580_0150904
841 Ga0495582_0038139
842 Ga0495582_0118395
843 Ga0495605_0000028
844 Ga0495605_0000407
845 Ga0495605_0010717
846 Ga0495639_0007458
847 Ga0495639_0093404
848 Ga0495584_0000487
849 Ga0495584_0036699
850 Ga0495584_0118985
851 Ga0495585_0003243
852 Ga0495585_0009831
853 Ga0495585_0018215
854 Ga0495585_0027266
855 Ga0495585_0028076
856 Ga0495585_0033664
857 Ga0495585_0202963
858 Ga0495594_0069630
859 Ga0495594_0079511
860 Ga0495596_0002010
861 Ga0495596_0003257
862 Ga0495596_0005785
863 Ga0495596_0006173
864 Ga0495596_0008015
865 Ga0495596_0055070
866 Ga0495607_0001994
867 Ga0495607_0004620
868 Ga0495607_0006715
869 Ga0495607_0007751
870 Ga0495607_0114224
871 Ga0495607_0175319
872 Ga0495583_0000159
873 Ga0495583_0000741
874 Ga0495583_0000907
875 Ga0495583_0001433
876 Ga0495583_0003983
877 Ga0495583_0014597
878 Ga0495583_0061146
879 Ga0495606_0000001
880 Ga0495606_0000549
881 Ga0495606_0000601
882 Ga0495606_0001009
883 Ga0495606_0003740
884 Ga0495606_0003954
885 Ga0495606_0005710
886 Ga0495606_0010695
887 Ga0495606_0017867
888 Ga0495606_0090548
889 Ga0495606_0220788
890 Ga0495610_0000106
891 Ga0495610_0001401
892 Ga0495610_0002648
893 Ga0495610_0003856
894 Ga0495610_0004104
895 Ga0495610_0012181
896 Ga0495610_0019764
897 Ga0495616_0000611
898 Ga0495616_0004279
899 Ga0495616_0007856
900 Ga0495616_0041103
901 Ga0495616_0140128
902 Ga0495631_0004138
903 Ga0495631_0006120
904 Ga0495631_0008446
905 Ga0495631_0009708
906 Ga0495632_0000264
907 Ga0495632_0000674
908 Ga0495632_0002656
909 Ga0495632_0009857
910 Ga0495632_0013614
911 Ga0495637_0000028
912 Ga0495643_0000444
913 Ga0495643_0000643
914 Ga0495643_0015876
915 Ga0495644_0003657
916 Ga0495644_0003685
917 Ga0495644_0013544
918 Ga0495644_0037290
919 Ga0495644_0052454
920 Ga0495648_0000311
921 Ga0495648_0000836
922 Ga0495648_0002684
923 Ga0495648_0010964
924 Ga0495648_0032842
925 Ga0495648_0038113
926 Ga0495666_0000961
927 Ga0495666_0003876
928 Ga0495666_0004089
929 Ga0495642_0000801
930 Ga0495642_0002511
931 Ga0495642_0003207
932 Ga0495642_0007748
933 Ga0495642_0020024
934 Ga0495642_0028163
935 Ga0495652_0017070
936 Ga0495652_0033748
937 Ga0495654_0000015
938 Ga0495654_0001129
939 Ga0495654_0009628
940 Ga0495654_0012729
941 Ga0495654_0068932
942 Ga0495665_0009456
943 Ga0495665_0020604
944 Ga0495586_0021917
945 Ga0495586_0046548
946 Ga0495587_0044006
947 Ga0495609_0001680
948 Ga0495609_0002912
949 Ga0495609_0015887
950 Ga0495609_0098619
951 Ga0495597_0000327
952 Ga0495597_0001304
953 Ga0495597_0002613
954 Ga0495597_0055278
955 Ga0495645_0075302
956 Ga0495622_0000375
957 Ga0495622_0000567
958 Ga0495622_0101053
959 Ga0495633_0000244
960 Ga0495633_0004279
961 Ga0495633_0004813
962 Ga0495633_0006081
963 Ga0495633_0012680
964 Ga0495633_0023115
965 Ga0495633_0028237
966 Ga0495633_0049658
967 Ga0495667_0155983
968 Ga0495656_0001178
969 Ga0495668_0000241
970 Ga0495668_0000972
971 Ga0495668_0001358
972 Ga0495668_0001812
973 Ga0495668_0006872
974 Ga0495668_0038718
975 Ga0495668_0060072
976 Ga0495668_0114494
977 Ga0495634_0056764
978 Ga0495611_0000260
979 Ga0495611_0064376
980 Ga0495625_0001278
981 Ga0495625_0009607
982 Ga0495625_0015118
983 Ga0495625_0029273
984 Ga0495661_0013033
985 Ga0495661_0021688
986 Ga0495661_0030096
987 Ga0495661_0031595
988 Ga0495661_0069616
989 Ga0495661_0105680
990 Ga0495588_0003963
991 Ga0495588_0009565
992 Ga0495588_0096004
993 Ga0495623_0003760
994 Ga0495623_0012559
995 Ga0495623_0082547
996 Ga0495658_0120897
997 Ga0495669_0001080
998 Ga0495669_0003933
999 Ga0495669_0005276
1000 Ga0495669_0025446
1001 Ga0495669_0097043
1002 Ga0495613_0083263
1003 Ga0495624_0001233
1004 Ga0495624_0066081
1005 Ga0495670_0010685
1006 Ga0495670_0027381
1007 Ga0495670_0211314
1008 Ga0495671_0000006
1009 Ga0495671_0001032
1010 Ga0495671_0002705
1011 Ga0495671_0005308
1012 Ga0495671_0038930
1013 Ga0495671_0159254
1014 Ga0495649_0000185
1015 Ga0495649_0003174
1016 Ga0495649_0005881
1017 Ga0495649_0015307
1018 Ga0495649_0024060
1019 Ga0495649_0037120
1020 Ga0495649_0165019
1021 Ga0495649_0305677
1022 Ga0495589_0000705
1023 Ga0495589_0028693
1024 Ga0495589_0039914
1025 Ga0495600_0053182
1026 Ga0495600_0147855
1027 Ga0495660_0006530
1028 Ga0495660_0009426
1029 Ga0495660_0013392
1030 Ga0495581_0005630
1031 Ga0495604_0026315
1032 Ga0495604_0164503
1033 Ga0495672_0000305
1034 Ga0495672_0000753
1035 Ga0495672_0000765
1036 Ga0495672_0066960
1037 Ga0495676_0268964
1038 Ga0495680_0067165
1039 Ga0495683_0001053
1040 Ga0495683_0007403
1041 Ga0495683_0011684
1042 Ga0495683_0042278
1043 Ga0495683_0051506
1044 Ga0495683_0065786
1045 Ga0495687_005888
1046 Ga0495687_005940
1047 Ga0495675_0008345
1048 Ga0495677_0000193
1049 Ga0495677_0000799
1050 Ga0495677_0005280
1051 Ga0495677_0025216
1052 Ga0495679_006578
1053 Ga0495679_016128
1054 Ga0495679_016359
1055 Ga0495685_055237
1056 Ga0495673_0000003
1057 Ga0495673_0000061
1058 Ga0495673_0000351
1059 Ga0495681_0000317
1060 Ga0495681_0035659
1061 Ga0495681_0059974
1062 Ga0495686_0000735
1063 Ga0495686_0001857
1064 Ga0495686_0005890
1065 Ga0495686_0072476
1066 Ga0495686_0091568
1067 Ga0495593_0022436
1068 Ga0495593_0093625
1069 Ga0495593_0102611
1070 Ga0495602_0001033
1071 Ga0495602_0112876
1072 Ga0495626_0007035
1073 Ga0495626_0012659
1074 Ga0495626_0021189
1075 Ga0495626_0025958
1076 Ga0495626_0027138
1077 Ga0495626_0165214
1078 Ga0496100_0087665
1079 Ga0496102_0005900
1080 Ga0496102_0043006
1081 Ga0496102_0186743
1082 Ga0496102_0724437
1083 Ga0496103_0006928
1084 Ga0496103_0097291
1085 Ga0496105_0255795
1086 Ga0496106_0173740
1087 Ga0496115_0043245
1088 Ga0496115_0111169
1089 Ga0496122_0018898
1090 Ga0496122_0053829
1091 Ga0496123_0012508
1092 Ga0496124_0019804
1093 Ga0496124_0027331
1094 Ga0496124_0045340
1095 Ga0496124_0064950
1096 Ga0496124_0104049
1097 Ga0496126_0025849
1098 Ga0496126_0232672
1099 Ga0495678_000188
1100 Ga0495678_000264
1101 Ga0495678_000917
1102 Ga0495678_001434
1103 Ga0495678_010898
1104 Ga0495682_0004222
1105 Ga0495682_0004832
1106 Ga0501211_008053
1107 Ga0501249_001953
1108 Ga0501221_045392
1109 Ga0501267_000045
1110 Ga0501269_000545
1111 Ga0501272_000469
1112 Ga0501035_0070534
1113 nmdc:mga0k408_220_c1
1114 nmdc:mga0k408_71619_c1
1115 nmdc:mga0k408_87236_c1
1116 nmdc:mga0k408_9548_c1
1117 nmdc:mga07m45_85950_c1
1118 nmdc:mga07m45_89868_c1
1119 Ga0500635_0001602
1120 Ga0500586_000241
1121 Ga0500586_001437
1122 Ga0500636_0038941
1123 Ga0466962_0003423
1124 2643744379
1125 2643934334
1126 2644219445
1127 2644255881
1128 2644315821
1129 2739054339
1130 2809147265
1131 2831865334
1132 2842712681
1133 2857561063
1134 2904425485

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

54

193

0.96

PF13304

AAA_21

AAA domain, putative AbiEii toxin, Type IV TA system

158

226

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7z16-assembly1.cif.gz_J e. coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation 0.9116 11 228
3rlf-assembly1.cif.gz_B crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to mgamppnp 0.9023 13 232
4rvc-assembly1.cif.gz_A structure of atp binding subunit of abc transporter 0.9015 12 224
3puy-assembly1.cif.gz_B crystal structure of an outward-facing mbp-maltose transporter complex bound to amp-pnp after crystal soaking of the pretranslocation state 0.8993 13 232
7tch-assembly1.cif.gz_C bceab e169q variant atp-bound conformation 0.899 12 222
ID Description Score Start End Superfamily
af_O86311_2_235_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9319 7 224 3.40.50.300
af_Q2G1V4_2_236_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.929 11 224 3.40.50.300
af_O53149_2_239_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9262 3 225 3.40.50.300
af_Q2FWW7_2_234_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9256 12 224 3.40.50.300
af_Q55EH8_3_247_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9238 10 227 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A496QEB7-F1-model_v4 ABC transporter ATP-binding protein 0.9601 9 225 GO:0005524
GO:0016887
AF-A0A1G6INW8-F1-model_v4 ABC-2 type transport system ATP-binding protein 0.9489 13 228 GO:0005524
GO:0016887
AF-A0A2G2M205-F1-model_v4 Multidrug ABC transporter ATP-binding protein 0.9404 10 224 GO:0005524
GO:0016887
AF-A0A328VDH5-F1-model_v4 ABC transporter domain-containing protein 0.9383 11 222 GO:0005524
GO:0016887
AF-A0A830FP66-F1-model_v4 Copper ABC transporter ATP-binding protein 0.9381 9 225 GO:0005524
GO:0016887

Map