F464563

General Info

Members Datasets Scaffolds Average Seq Length
567 241 1134 153

Family's Representative Sequence

Representative Sequence 3300050507|nmdc:mga05p37_1708981_c1|nmdc:mga05p37_1708981_c1_32_595
Length 187
Sequence MPWFSPTKRRQDHRDPTKGANDQEGFHCLECKSEETRMHIGIATDHGGFSLKEELLGALRAAGHEVVDFGAQRLSEGDDYPDYVVPLALAVAAGEVDRGVAICGSGVGASVCANKVRGIRAALIHDHFSAKQGVEDDHMNILCMGGRTVGPAVAWDLVQTFLAAKFSQAERHLRRLGKVASLEIGKK

Samples

Sample ID Description Type Environment
1 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
35 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
36 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
95 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
144 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
145 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
146 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
149 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
156 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
157 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
158 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
159 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
164 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
169 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
170 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
173 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
174 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
183 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
184 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
189 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
190 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
191 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
192 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
193 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
196 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
197 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
198 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
199 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
200 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
201 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
207 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
208 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
209 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
212 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
216 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
217 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
220 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
224 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
229 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
230 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
231 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
232 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
233 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
236 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
237 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
238 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
239 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
240 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.12
Rhizosphere 97.18
Stem 0
Stem Tuber 0
Unclassified 22.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 nmdc:mga05p37_1708981_c1 3300050507 Bacteria 613
2 Ga0065704_10020063 3300005289 Bacteria 1112
3 Ga0065704_10035148 3300005289 Bacteria 988
4 Ga0065704_10078374 3300005289 Bacteria 4449
5 Ga0065704_10605239 3300005289 Unclassified 605
6 Ga0065712_10206145 3300005290 Bacteria 1077
7 Ga0065712_10224392 3300005290 Bacteria 1031
8 Ga0065715_10364753 3300005293 Bacteria 919
9 Ga0065715_10375154 3300005293 Bacteria 896
10 Ga0065707_10026255 3300005295 Bacteria 1141
11 Ga0065707_10082126 3300005295 Bacteria 21286
12 Ga0065707_10202777 3300005295 Bacteria 1299
13 Ga0065707_10456669 3300005295 Bacteria 769
14 Ga0065707_10534383 3300005295 Bacteria 728
15 Ga0065707_11128509 3300005295 Bacteria 509
16 Ga0070676_10672252 3300005328 Bacteria 754
17 Ga0070670_100345630 3300005331 Bacteria 1306
18 Ga0070689_100161516 3300005340 Bacteria 1811
19 Ga0070689_100277444 3300005340 Bacteria 1389
20 Ga0070689_100748575 3300005340 Bacteria 856
21 Ga0070691_10518944 3300005341 Bacteria 691
22 Ga0070661_100516987 3300005344 Bacteria 957
23 Ga0070668_100340499 3300005347 Bacteria 1267
24 Ga0070668_101104812 3300005347 Unclassified 716
25 Ga0070675_100005730 3300005354 Bacteria 9502
26 Ga0070675_100174671 3300005354 Unclassified 1854
27 Ga0070675_100864593 3300005354 Bacteria 828
28 Ga0070671_100076903 3300005355 Unclassified 2789
29 Ga0070671_100715701 3300005355 Bacteria 869
30 Ga0070674_100569581 3300005356 Unclassified 953
31 Ga0070688_100098538 3300005365 Bacteria 1923
32 Ga0070667_100307160 3300005367 Bacteria 1429
33 Ga0070667_101257293 3300005367 Bacteria 693
34 Ga0070709_10231587 3300005434 Bacteria 1322
35 Ga0070709_10247882 3300005434 Unclassified 1282
36 Ga0070709_10537553 3300005434 Bacteria 893
37 Ga0070714_100049460 3300005435 Bacteria 3578
38 Ga0070714_100514347 3300005435 Bacteria 1143
39 Ga0070714_100851606 3300005435 Bacteria 884
40 Ga0070713_100420262 3300005436 Bacteria 1251
41 Ga0070710_10012653 3300005437 Bacteria 4197
42 Ga0070710_10834893 3300005437 Unclassified 661
43 Ga0070711_100326827 3300005439 Unclassified 1227
44 Ga0070711_100367603 3300005439 Unclassified 1160
45 Ga0070711_100525281 3300005439 Bacteria 979
46 Ga0070711_100533163 3300005439 Bacteria 972
47 Ga0070705_100219415 3300005440 Unclassified 1316
48 Ga0070705_100617900 3300005440 Bacteria 841
49 Ga0070705_100879912 3300005440 Bacteria 719
50 Ga0070700_100169933 3300005441 Bacteria 1509
51 Ga0070700_100489661 3300005441 Bacteria 944
52 Ga0070694_100046578 3300005444 Bacteria 2912
53 Ga0070694_100122476 3300005444 Bacteria 1868
54 Ga0070708_100050523 3300005445 Bacteria 3682
55 Ga0070708_100075904 3300005445 Bacteria 3034
56 Ga0070708_100119937 3300005445 Bacteria 2425
57 Ga0070708_100177902 3300005445 Bacteria 1988
58 Ga0070708_100308705 3300005445 Unclassified 1490
59 Ga0070708_100507464 3300005445 Bacteria 1138
60 Ga0070708_100761968 3300005445 Bacteria 910
61 Ga0070663_100334631 3300005455 Bacteria 1221
62 Ga0070662_100379198 3300005457 Unclassified 1164
63 Ga0070685_10285829 3300005466 Bacteria 1106
64 Ga0070685_10761012 3300005466 Bacteria 711
65 Ga0070706_100006291 3300005467 Bacteria 11220
66 Ga0070706_100020149 3300005467 Bacteria 6145
67 Ga0070706_100068939 3300005467 Bacteria 3271
68 Ga0070706_100173180 3300005467 Bacteria 2015
69 Ga0070706_100287138 3300005467 Bacteria 1535
70 Ga0070706_100320008 3300005467 Bacteria 1447
71 Ga0070706_100526471 3300005467 Bacteria 1100
72 Ga0070706_101710495 3300005467 Bacteria 573
73 Ga0070707_100011484 3300005468 Bacteria 8259
74 Ga0070707_100025826 3300005468 Bacteria 5575
75 Ga0070707_100174596 3300005468 Bacteria 2094
76 Ga0070707_100223172 3300005468 Unclassified 1835
77 Ga0070707_100323884 3300005468 Bacteria 1497
78 Ga0070707_100330310 3300005468 Bacteria 1481
79 Ga0070698_100072087 3300005471 Unclassified 3463
80 Ga0070698_100073139 3300005471 Bacteria 3435
81 Ga0070698_100111665 3300005471 Bacteria 2698
82 Ga0070698_100157732 3300005471 Bacteria 2214
83 Ga0070698_100173480 3300005471 Bacteria 2096
84 Ga0070698_100250870 3300005471 Bacteria 1702
85 Ga0070698_100385252 3300005471 Bacteria 1335
86 Ga0070698_100392545 3300005471 Bacteria 1321
87 Ga0070698_100828592 3300005471 Unclassified 870
88 Ga0070698_101613719 3300005471 Bacteria 601
89 Ga0070699_100003790 3300005518 Bacteria 13359
90 Ga0070699_100107353 3300005518 Bacteria 2449
91 Ga0070699_100145833 3300005518 Bacteria 2091
92 Ga0070699_100799907 3300005518 Bacteria 863
93 Ga0070699_100916434 3300005518 Bacteria 803
94 Ga0070699_101148149 3300005518 Unclassified 713
95 Ga0070699_101660704 3300005518 Bacteria 585
96 Ga0070684_100008302 3300005535 Bacteria 8113
97 Ga0070684_100720263 3300005535 Bacteria 931
98 Ga0070697_100059126 3300005536 Bacteria 3120
99 Ga0070697_100416939 3300005536 Bacteria 1166
100 Ga0070697_100444802 3300005536 Unclassified 1128
101 Ga0070697_100539200 3300005536 Bacteria 1022
102 Ga0070697_100629053 3300005536 Bacteria 944
103 Ga0070697_101248293 3300005536 Bacteria 662
104 Ga0070697_101331331 3300005536 Unclassified 641
105 Ga0070686_100132792 3300005544 Bacteria 1724
106 Ga0070686_100150596 3300005544 Bacteria 1629
107 Ga0070695_100012297 3300005545 Bacteria 5132
108 Ga0070696_100196754 3300005546 Bacteria 1503
109 Ga0070696_100506012 3300005546 Unclassified 962
110 Ga0070693_100515166 3300005547 Unclassified 851
111 Ga0070704_100014357 3300005549 Bacteria 4946
112 Ga0070704_100084516 3300005549 Unclassified 2346
113 Ga0070704_100314441 3300005549 Bacteria 1310
114 Ga0070704_100877053 3300005549 Bacteria 806
115 Ga0070704_101494944 3300005549 Bacteria 621
116 Ga0068855_100397959 3300005563 Bacteria 1510
117 Ga0068854_100768726 3300005578 Unclassified 837
118 Ga0070702_100194747 3300005615 Bacteria 1337
119 Ga0070702_100578871 3300005615 Bacteria 838
120 Ga0068859_100789094 3300005617 Bacteria 1038
121 Ga0068859_101868399 3300005617 Unclassified 663
122 Ga0068859_101887167 3300005617 Bacteria 660
123 Ga0068859_102410505 3300005617 Unclassified 580
124 Ga0068864_100213726 3300005618 Bacteria 1777
125 Ga0068864_101661101 3300005618 Unclassified 643
126 Ga0068861_100092591 3300005719 Bacteria 2388
127 Ga0068861_100225648 3300005719 Unclassified 1586
128 Ga0068861_101293996 3300005719 Bacteria 709
129 Ga0068870_10874634 3300005840 Bacteria 633
130 Ga0068863_100168513 3300005841 Bacteria 2100
131 Ga0068863_100352849 3300005841 Bacteria 1433
132 Ga0068863_101259240 3300005841 Bacteria 746
133 Ga0068858_100032451 3300005842 Bacteria 4849
134 Ga0068858_100354973 3300005842 Bacteria 1405
135 Ga0068858_100362205 3300005842 Bacteria 1390
136 Ga0068860_100040771 3300005843 Bacteria 4436
137 Ga0068862_100494336 3300005844 Bacteria 1160
138 Ga0068862_101502730 3300005844 Bacteria 679
139 Ga0081455_10004390 3300005937 Bacteria 15885
140 Ga0081540_1017992 3300005983 Bacteria 4352
141 Ga0081540_1119117 3300005983 Bacteria 1099
142 Ga0081540_1179754 3300005983 Bacteria 793
143 Ga0081540_1181968 3300005983 Unclassified 785
144 Ga0070717_10001557 3300006028 Bacteria 15889
145 Ga0070717_10077490 3300006028 Bacteria 2783
146 Ga0075432_10116867 3300006058 Bacteria 999
147 Ga0070715_10444456 3300006163 Unclassified 731
148 Ga0070716_100021080 3300006173 Bacteria 3430
149 Ga0070716_100367552 3300006173 Unclassified 1024
150 Ga0070712_100073246 3300006175 Bacteria 2456
151 Ga0070712_100372726 3300006175 Bacteria 1173
152 Ga0070712_100442683 3300006175 Unclassified 1081
153 Ga0070712_100466601 3300006175 Unclassified 1054
154 Ga0070712_100614490 3300006175 Bacteria 921
155 Ga0070712_100647821 3300006175 Unclassified 897
156 Ga0070712_100823232 3300006175 Unclassified 797
157 Ga0070712_100841546 3300006175 Unclassified 789
158 Ga0075427_10003376 3300006194 Bacteria 2196
159 Ga0097621_100271412 3300006237 Bacteria 1490
160 Ga0075428_100031237 3300006844 Bacteria 5890
161 Ga0075428_100243337 3300006844 Bacteria 1941
162 Ga0075428_100376828 3300006844 Bacteria 1521
163 Ga0075428_100546822 3300006844 Unclassified 1238
164 Ga0075428_100953503 3300006844 Unclassified 909
165 Ga0075428_101351605 3300006844 Bacteria 748
166 Ga0075428_101571655 3300006844 Unclassified 688
167 Ga0075428_101658826 3300006844 Bacteria 668
168 Ga0075430_100122226 3300006846 Bacteria 2170
169 Ga0075430_100546343 3300006846 Unclassified 955
170 Ga0075430_100786094 3300006846 Bacteria 784
171 Ga0075430_101063677 3300006846 Bacteria 666
172 Ga0075430_101115444 3300006846 Bacteria 650
173 Ga0075431_100047920 3300006847 Bacteria 4406
174 Ga0075431_100247568 3300006847 Bacteria 1812
175 Ga0075431_100523812 3300006847 Bacteria 1175
176 Ga0075433_10000747 3300006852 Bacteria 22314
177 Ga0075433_10006116 3300006852 Bacteria 9482
178 Ga0075433_10097078 3300006852 Bacteria 2608
179 Ga0075433_10240695 3300006852 Bacteria 1606
180 Ga0075433_10259618 3300006852 Bacteria 1540
181 Ga0075433_10567019 3300006852 Bacteria 997
182 Ga0075433_11375930 3300006852 Unclassified 611
183 Ga0075434_100001047 3300006871 Bacteria 22564
184 Ga0075434_100073510 3300006871 Bacteria 3411
185 Ga0075434_100676797 3300006871 Bacteria 1050
186 Ga0075434_100710462 3300006871 Unclassified 1022
187 Ga0075434_100742642 3300006871 Bacteria 998
188 Ga0075434_100889756 3300006871 Bacteria 905
189 Ga0075434_100899471 3300006871 Bacteria 900
190 Ga0075429_100005287 3300006880 Bacteria 11107
191 Ga0075429_100020060 3300006880 Bacteria 5795
192 Ga0075429_100285413 3300006880 Bacteria 1445
193 Ga0075429_101032022 3300006880 Bacteria 719
194 Ga0075429_101162665 3300006880 Unclassified 674
195 Ga0068865_100508212 3300006881 Bacteria 1006
196 Ga0075436_100019930 3300006914 Bacteria 4600
197 Ga0075436_100105664 3300006914 Bacteria 1964
198 Ga0075436_100139575 3300006914 Bacteria 1703
199 Ga0075436_100233984 3300006914 Bacteria 1305
200 Ga0075436_100623146 3300006914 Bacteria 796
201 Ga0097620_100789048 3300006931 Bacteria 1038
202 Ga0097620_101868901 3300006931 Unclassified 663
203 Ga0097620_101886952 3300006931 Bacteria 660
204 Ga0097620_102410928 3300006931 Unclassified 580
205 Ga0075435_100056394 3300007076 Bacteria 3176
206 Ga0075435_100113476 3300007076 Bacteria 2255
207 Ga0075435_100140749 3300007076 Bacteria 2024
208 Ga0075435_100211272 3300007076 Bacteria 1646
209 Ga0075435_100212549 3300007076 Bacteria 1641
210 Ga0075435_100516162 3300007076 Bacteria 1033
211 Ga0099794_10020255 3300007265 Bacteria 3008
212 Ga0099795_10275585 3300007788 Unclassified 733
213 Ga0111539_10017875 3300009094 Bacteria 8781
214 Ga0111539_10339989 3300009094 Bacteria 1747
215 Ga0111539_10421102 3300009094 Bacteria 1555
216 Ga0111539_11217758 3300009094 Bacteria 874
217 Ga0111539_11853603 3300009094 Bacteria 699
218 Ga0105245_10218399 3300009098 Bacteria 1838
219 Ga0105245_10290441 3300009098 Bacteria 1601
220 Ga0114129_10002217 3300009147 Bacteria 26788
221 Ga0114129_10029104 3300009147 Bacteria 7824
222 Ga0114129_10301703 3300009147 Bacteria 2135
223 Ga0114129_10882096 3300009147 Bacteria 1135
224 Ga0114129_10969680 3300009147 Bacteria 1073
225 Ga0114129_11083171 3300009147 Bacteria 1004
226 Ga0114129_11225572 3300009147 Unclassified 933
227 Ga0114129_11436239 3300009147 Bacteria 850
228 Ga0114129_12629678 3300009147 Bacteria 600
229 Ga0105243_10725412 3300009148 Unclassified 972
230 Ga0105242_10165353 3300009176 Bacteria 1940
231 Ga0105242_11316881 3300009176 Bacteria 747
232 Ga0105248_10646235 3300009177 Bacteria 1193
233 Ga0105248_10726416 3300009177 Unclassified 1121
234 Ga0105248_11182893 3300009177 Bacteria 864
235 Ga0105248_11842802 3300009177 Unclassified 686
236 Ga0105237_10118512 3300009545 Bacteria 2641
237 Ga0105249_10155534 3300009553 Bacteria 2205
238 Ga0105249_11111563 3300009553 Unclassified 860
239 Ga0105239_10011903 3300010375 Bacteria 9705
240 Ga0105239_10471652 3300010375 Bacteria 1425
241 Ga0157337_1017362 3300012483 Unclassified 632
242 Ga0157374_10126010 3300013296 Bacteria 2476
243 Ga0157374_10479626 3300013296 Bacteria 1247
244 Ga0157374_11668577 3300013296 Unclassified 662
245 Ga0157378_10027166 3300013297 Bacteria 5050
246 Ga0157378_10031529 3300013297 Bacteria 4681
247 Ga0157378_10041025 3300013297 Bacteria 4106
248 Ga0157378_10072995 3300013297 Bacteria 3084
249 Ga0157378_10436430 3300013297 Bacteria 1297
250 Ga0157378_10445684 3300013297 Unclassified 1284
251 Ga0157378_11463435 3300013297 Bacteria 727
252 Ga0163162_10241103 3300013306 Bacteria 1939
253 Ga0163162_10468044 3300013306 Bacteria 1392
254 Ga0163162_10535652 3300013306 Bacteria 1300
255 Ga0163162_10544916 3300013306 Bacteria 1289
256 Ga0163162_10675249 3300013306 Bacteria 1156
257 Ga0163162_10856503 3300013306 Bacteria 1024
258 Ga0163162_11119066 3300013306 Bacteria 892
259 Ga0163162_11357900 3300013306 Unclassified 808
260 Ga0157372_11362663 3300013307 Unclassified 818
261 Ga0157375_10017715 3300013308 Bacteria 6438
262 Ga0157375_10134401 3300013308 Bacteria 2595
263 Ga0157375_11204510 3300013308 Bacteria 888
264 Ga0157375_11312796 3300013308 Bacteria 851
265 Ga0157375_11424034 3300013308 Unclassified 817
266 Ga0157375_13343707 3300013308 Unclassified 534
267 Ga0163163_10098475 3300014325 Unclassified 2945
268 Ga0163163_10586099 3300014325 Bacteria 1178
269 Ga0163163_10852432 3300014325 Bacteria 975
270 Ga0163163_11997852 3300014325 Bacteria 640
271 Ga0157380_10245693 3300014326 Bacteria 1616
272 Ga0157380_11321710 3300014326 Unclassified 769
273 Ga0157379_10008264 3300014968 Bacteria 9044
274 Ga0157376_10178227 3300014969 Bacteria 1941
275 Ga0157376_10741027 3300014969 Unclassified 991
276 Ga0157376_12666186 3300014969 Bacteria 540
277 Ga0163161_10135750 3300017792 Bacteria 1860
278 Ga0163161_10701570 3300017792 Bacteria 843
279 Ga0163161_11935701 3300017792 Unclassified 525
280 Ga0213872_10073681 3300021361 Viruses 1537
281 Ga0213876_10019074 3300021384 Bacteria 3621
282 Ga0213871_10001463 3300021441 Bacteria 3977
283 Ga0207666_1025284 3300025271 Bacteria 890
284 Ga0207697_10000197 3300025315 Bacteria 32111
285 Ga0207697_10155785 3300025315 Bacteria 995
286 Ga0207697_10209117 3300025315 Unclassified 859
287 Ga0207653_10182523 3300025885 Bacteria 785
288 Ga0207642_10302305 3300025899 Unclassified 928
289 Ga0207710_10058000 3300025900 Bacteria 1750
290 Ga0207647_10020282 3300025904 Bacteria 4459
291 Ga0207685_10007093 3300025905 Bacteria 3101
292 Ga0207684_10000956 3300025910 Bacteria 32546
293 Ga0207684_10129796 3300025910 Unclassified 2163
294 Ga0207684_10140839 3300025910 Bacteria 2073
295 Ga0207684_10219348 3300025910 Bacteria 1641
296 Ga0207684_10342573 3300025910 Bacteria 1287
297 Ga0207684_10585493 3300025910 Bacteria 953
298 Ga0207671_10120411 3300025914 Bacteria 2006
299 Ga0207693_10046701 3300025915 Bacteria 3402
300 Ga0207693_10260290 3300025915 Bacteria 1361
301 Ga0207693_10314917 3300025915 Bacteria 1225
302 Ga0207693_10421146 3300025915 Unclassified 1044
303 Ga0207693_10447237 3300025915 Bacteria 1010
304 Ga0207693_11182073 3300025915 Unclassified 577
305 Ga0207663_10256391 3300025916 Bacteria 1290
306 Ga0207662_10155972 3300025918 Bacteria 1455
307 Ga0207662_10263831 3300025918 Bacteria 1134
308 Ga0207657_10067628 3300025919 Bacteria 3038
309 Ga0207649_10753748 3300025920 Bacteria 758
310 Ga0207646_10010132 3300025922 Bacteria 9235
311 Ga0207646_10022118 3300025922 Bacteria 5864
312 Ga0207646_10038711 3300025922 Bacteria 4293
313 Ga0207646_10266469 3300025922 Bacteria 1548
314 Ga0207646_10585391 3300025922 Bacteria 1002
315 Ga0207681_10917708 3300025923 Bacteria 734
316 Ga0207650_11150240 3300025925 Bacteria 661
317 Ga0207659_10237016 3300025926 Bacteria 1474
318 Ga0207687_10010729 3300025927 Bacteria 5984
319 Ga0207687_10367618 3300025927 Bacteria 1175
320 Ga0207687_10458638 3300025927 Bacteria 1058
321 Ga0207700_10289731 3300025928 Unclassified 1411
322 Ga0207664_10047437 3300025929 Bacteria 3374
323 Ga0207690_10013431 3300025932 Bacteria 4921
324 Ga0207706_10115504 3300025933 Bacteria 2361
325 Ga0207706_10579044 3300025933 Bacteria 965
326 Ga0207686_10100745 3300025934 Bacteria 1928
327 Ga0207709_10009434 3300025935 Bacteria 5370
328 Ga0207670_10199273 3300025936 Bacteria 1520
329 Ga0207670_10524590 3300025936 Bacteria 965
330 Ga0207669_10294036 3300025937 Unclassified 1231
331 Ga0207704_10221406 3300025938 Bacteria 1401
332 Ga0207704_11386554 3300025938 Unclassified 602
333 Ga0207665_10231225 3300025939 Unclassified 1359
334 Ga0207665_10279493 3300025939 Bacteria 1242
335 Ga0207665_10721217 3300025939 Bacteria 785
336 Ga0207691_10980752 3300025940 Bacteria 706
337 Ga0207711_10685887 3300025941 Unclassified 955
338 Ga0207661_10062949 3300025944 Bacteria 3003
339 Ga0207679_11249339 3300025945 Bacteria 682
340 Ga0207667_10107570 3300025949 Bacteria 2877
341 Ga0207712_10113353 3300025961 Bacteria 2038
342 Ga0207712_10346512 3300025961 Bacteria 1233
343 Ga0207712_11671971 3300025961 Unclassified 571
344 Ga0207668_10104859 3300025972 Bacteria 2109
345 Ga0207668_10495963 3300025972 Bacteria 1050
346 Ga0207658_10187904 3300025986 Bacteria 1715
347 Ga0207677_11568731 3300026023 Unclassified 609
348 Ga0207703_10048594 3300026035 Bacteria 3426
349 Ga0207703_10322346 3300026035 Unclassified 1415
350 Ga0207703_10357771 3300026035 Bacteria 1345
351 Ga0207703_10406691 3300026035 Bacteria 1264
352 Ga0207678_10112731 3300026067 Bacteria 2320
353 Ga0207708_10093971 3300026075 Bacteria 2315
354 Ga0207708_10103298 3300026075 Bacteria 2208
355 Ga0207708_10213752 3300026075 Bacteria 1542
356 Ga0207641_10020394 3300026088 Bacteria 5444
357 Ga0207641_10065822 3300026088 Bacteria 3101
358 Ga0207641_10537651 3300026088 Bacteria 1138
359 Ga0207641_11033596 3300026088 Bacteria 819
360 Ga0207648_11884801 3300026089 Bacteria 559
361 Ga0207676_10222432 3300026095 Bacteria 1682
362 Ga0207676_10245475 3300026095 Bacteria 1609
363 Ga0207675_100044700 3300026118 Bacteria 4140
364 Ga0207675_100086017 3300026118 Bacteria 2952
365 Ga0207675_100197935 3300026118 Bacteria 1929
366 Ga0207675_100242913 3300026118 Bacteria 1740
367 Ga0207675_100547598 3300026118 Bacteria 1156
368 Ga0207428_10272492 3300027907 Bacteria 1258
369 Ga0207428_10599927 3300027907 Bacteria 793
370 Ga0268265_11053039 3300028380 Unclassified 806
371 Ga0268265_11682700 3300028380 Bacteria 640
372 Ga0268264_10735715 3300028381 Bacteria 982
373 Ga0265325_10410121 3300031241 Bacteria 593
374 Ga0316578_10331349 3300031728 Bacteria 908
375 Ga0307416_101245510 3300032002 Bacteria 850
376 Ga0373948_0036150 3300034817 Unclassified 1017
377 Ga0373926_0139293 3300035083 Bacteria 921
378 Ga0373944_0085316 3300035089 Bacteria 1049
379 Ga0373944_0145865 3300035089 Unclassified 831
380 Ga0373949_0091317 3300035090 Bacteria 824
381 Ga0373923_0454387 3300035111 Unclassified 621
382 Ga0373932_0102199 3300035112 Bacteria 934
383 Ga0373939_0041613 3300035114 Bacteria 1385
384 Ga0373941_0027328 3300035115 Bacteria 1665
385 Ga0373945_0043825 3300035116 Bacteria 1625
386 Ga0373943_0036822 3300035170 Unclassified 2345
387 Ga0373942_0207081 3300035207 Unclassified 653
388 Ga0373962_0017356 3300035242 Bacteria 1865
389 Ga0373924_0287980 3300035410 Unclassified 729
390 Ga0373931_0006697 3300035691 Bacteria 5403
391 Ga0373931_0121454 3300035691 Bacteria 1493
392 Ga0373931_0139724 3300035691 Unclassified 1402
393 Ga0373931_0197614 3300035691 Bacteria 1200
394 Ga0373927_0176957 3300035695 Bacteria 1399
395 Ga0373933_0502200 3300035724 Unclassified 795
396 Ga0373947_0020056 3300035725 Bacteria 3858
397 Ga0373937_0788287 3300036401 Bacteria 898
398 Ga0373937_1069423 3300036401 Bacteria 756
399 Ga0373925_0199016 3300037068 Bacteria 1593
400 Ga0373925_0589441 3300037068 Bacteria 915
401 Ga0395905_0476807 3300037471 Bacteria 1147
402 Ga0395905_0793803 3300037471 Bacteria 850
403 Ga0436364_0863328 3300037853 Bacteria 1569
404 Ga0436365_0081021 3300039437 Bacteria 15657
405 Ga0436360_0134488 3300039438 Unclassified 581
406 Ga0436360_0430870 3300039438 Bacteria 7868
407 Ga0436360_0754657 3300039438 Bacteria 1021
408 Ga0436360_1247953 3300039438 Unclassified 665
409 Ga0436361_0238422 3300039447 Bacteria 3555
410 Ga0436361_0436414 3300039447 Bacteria 1961
411 Ga0436361_0635148 3300039447 Unclassified 1488
412 Ga0436361_0874952 3300039447 Bacteria 4448
413 Ga0436363_0248341 3300039450 Bacteria 1928
414 Ga0451577_0210702 3300042876 Bacteria 1755
415 Ga0453683_0005116 3300044673 Bacteria 9198
416 Ga0453683_0090168 3300044673 Bacteria 1922
417 Ga0453684_0078401 3300044712 Bacteria 4134
418 Ga0453684_0787939 3300044712 Bacteria 1026
419 Ga0451576_0116810 3300045051 Unclassified 2777
420 Ga0451576_0278538 3300045051 Bacteria 1749
421 Ga0495603_0508225 3300046455 Unclassified 690
422 Ga0495629_0267057 3300046459 Bacteria 1176
423 Ga0495629_0430218 3300046459 Unclassified 895
424 Ga0495629_1041813 3300046459 Unclassified 531
425 Ga0495651_0004483 3300046462 Bacteria 10693
426 Ga0495651_0212038 3300046462 Bacteria 1347
427 Ga0495580_0151798 3300046472 Bacteria 1605
428 Ga0495580_0199084 3300046472 Bacteria 1381
429 Ga0495580_0615973 3300046472 Bacteria 716
430 Ga0495580_0623957 3300046472 Unclassified 711
431 Ga0495582_0060524 3300046473 Bacteria 2090
432 Ga0495605_0074554 3300046474 Unclassified 1597
433 Ga0495662_0630615 3300046476 Unclassified 524
434 Ga0495584_0223536 3300046491 Unclassified 957
435 Ga0495585_0053476 3300046492 Bacteria 2235
436 Ga0495585_0320723 3300046492 Bacteria 758
437 Ga0495594_0266355 3300046499 Bacteria 976
438 Ga0495618_0431945 3300046514 Unclassified 802
439 Ga0495618_0764543 3300046514 Unclassified 564
440 Ga0495628_0097281 3300046516 Bacteria 2274
441 Ga0495628_0645715 3300046516 Unclassified 752
442 Ga0495628_0853055 3300046516 Bacteria 635
443 Ga0495630_0038528 3300046517 Bacteria 3575
444 Ga0495630_0110849 3300046517 Bacteria 2079
445 Ga0495663_0008955 3300046525 Bacteria 2775
446 Ga0495666_0106835 3300046526 Bacteria 1317
447 Ga0495642_0024236 3300046528 Unclassified 2400
448 Ga0495652_0023503 3300046529 Bacteria 5465
449 Ga0495640_0060181 3300046533 Bacteria 2584
450 Ga0495640_0220996 3300046533 Unclassified 1195
451 Ga0495586_0390466 3300046535 Bacteria 801
452 Ga0495587_0017283 3300046536 Bacteria 4484
453 Ga0495587_0071653 3300046536 Bacteria 2015
454 Ga0495645_0087552 3300046543 Bacteria 2228
455 Ga0495645_0234757 3300046543 Unclassified 1227
456 Ga0495645_0342453 3300046543 Bacteria 965
457 Ga0495667_0008911 3300046559 Bacteria 6821
458 Ga0495667_0046614 3300046559 Bacteria 2866
459 Ga0495656_0181394 3300046615 Bacteria 1035
460 Ga0495635_0333081 3300046663 Bacteria 1014
461 Ga0495659_0096137 3300046664 Bacteria 1143
462 Ga0495659_0116435 3300046664 Unclassified 1048
463 Ga0495659_0133593 3300046664 Unclassified 985
464 Ga0495599_0016708 3300046678 Bacteria 4558
465 Ga0495623_0022348 3300046679 Bacteria 4086
466 Ga0495623_0275570 3300046679 Bacteria 938
467 Ga0495669_0005798 3300046684 Bacteria 5150
468 Ga0495669_0381913 3300046684 Unclassified 682
469 Ga0495613_0091849 3300046689 Bacteria 2199
470 Ga0495613_0325483 3300046689 Bacteria 1060
471 Ga0495624_0737633 3300046690 Unclassified 584
472 Ga0495624_0912547 3300046690 Unclassified 517
473 Ga0495670_0351008 3300046691 Bacteria 794
474 Ga0495670_0539168 3300046691 Unclassified 635
475 Ga0495670_0607660 3300046691 Unclassified 596
476 Ga0495670_0697542 3300046691 Unclassified 554
477 Ga0495589_0155505 3300046794 Bacteria 1091
478 Ga0495589_0291273 3300046794 Unclassified 758
479 Ga0495581_0170300 3300047315 Bacteria 1274
480 Ga0495604_0028874 3300047317 Bacteria 4413
481 Ga0495604_0096821 3300047317 Bacteria 2177
482 Ga0495636_0187168 3300047318 Bacteria 941
483 Ga0495674_0099342 3300047319 Bacteria 2478
484 Ga0495674_0525006 3300047319 Bacteria 945
485 Ga0495680_0019946 3300047322 Bacteria 5651
486 Ga0495675_0002110 3300047444 Bacteria 11860
487 Ga0495675_0191111 3300047444 Bacteria 1250
488 Ga0495684_0001101 3300047471 Bacteria 21755
489 Ga0495684_0008556 3300047471 Bacteria 7924
490 Ga0495684_0283855 3300047471 Bacteria 1194
491 Ga0495684_0751264 3300047471 Unclassified 642
492 Ga0495602_0034229 3300048088 Bacteria 4756
493 Ga0496101_1547151 3300048904 Bacteria 516
494 Ga0496102_1735559 3300048905 Unclassified 542
495 Ga0496104_0153837 3300048907 Unclassified 2208
496 Ga0496104_0562677 3300048907 Bacteria 1051
497 Ga0496106_0562607 3300048909 Unclassified 915
498 Ga0496109_0106189 3300048912 Bacteria 2608
499 Ga0496110_0100963 3300048913 Bacteria 2586
500 Ga0496111_1174836 3300048914 Unclassified 545
501 Ga0496113_0211436 3300048916 Bacteria 1544
502 Ga0496115_0265271 3300048918 Unclassified 1412
503 Ga0496115_0331188 3300048918 Bacteria 1244
504 Ga0496115_0808872 3300048918 Unclassified 729
505 Ga0501031_0715377 3300049568 Unclassified 643
506 Ga0501047_0834863 3300049581 Bacteria 736
507 Ga0501048_0654645 3300049582 Bacteria 754
508 Ga0501077_0110294 3300049593 Bacteria 1743
509 Ga0501077_0411601 3300049593 Bacteria 865
510 Ga0501044_0642141 3300049823 Bacteria 951
511 nmdc:mga05p37_1051948_c1 3300050507 Unclassified 858
512 nmdc:mga05p37_109207_c1 3300050507 Bacteria 3403
513 nmdc:mga05p37_169474_c1 3300050507 Bacteria 2664
514 nmdc:mga05p37_250442_c1 3300050507 Bacteria 2125
515 nmdc:mga05p37_384018_c1 3300050507 Bacteria 1645
516 nmdc:mga05p37_65541_c1 3300050507 Bacteria 4469
517 nmdc:mga05p37_68315_c1 3300050507 Bacteria 4370
518 nmdc:mga05p37_7890_c1 3300050507 Bacteria 12564
519 nmdc:mga05p37_82887_c1 3300050507 Bacteria 3952
520 nmdc:mga09592_1509300_c1 3300050508 Unclassified 546
521 nmdc:mga09592_262605_c1 3300050508 Bacteria 1498
522 nmdc:mga09592_4603_c1 3300050508 Bacteria 11170
523 nmdc:mga09592_520274_c1 3300050508 Unclassified 1023
524 nmdc:mga09592_94726_c1 3300050508 Unclassified 2554
525 nmdc:mga0qj67_1519864_c1 3300050509 Unclassified 515
526 nmdc:mga0qj67_3953_c1 3300050509 Bacteria 10726
527 nmdc:mga06r32_252107_c1 3300050510 Bacteria 1753
528 nmdc:mga06r32_599955_c1 3300050510 Bacteria 1072
529 nmdc:mga06r32_71190_c1 3300050510 Bacteria 3365
530 nmdc:mga06r32_86125_c1 3300050510 Bacteria 3064
531 nmdc:mga08y16_451159_c1 3300050511 Bacteria 1311
532 nmdc:mga08y16_533729_c1 3300050511 Bacteria 1189
533 nmdc:mga0n895_1057308_c1 3300050512 Bacteria 791
534 nmdc:mga0n895_1636076_c1 3300050512 Bacteria 608
535 nmdc:mga0n895_1947_c1 3300050512 Bacteria 15854
536 nmdc:mga0n895_269379_c1 3300050512 Bacteria 1728
537 nmdc:mga0n895_284316_c1 3300050512 Bacteria 1677
538 nmdc:mga0n895_299753_c1 3300050512 Bacteria 1629
539 nmdc:mga0n895_61863_c1 3300050512 Bacteria 3698
540 nmdc:mga0n895_81755_c1 3300050512 Bacteria 3219
541 nmdc:mga0n895_912063_c1 3300050512 Bacteria 864
542 nmdc:mga0rr50_109743_c1 3300050513 Unclassified 2181
543 nmdc:mga0rr50_1297059_c1 3300050513 Bacteria 618
544 nmdc:mga0rr50_153414_c1 3300050513 Bacteria 1864
545 nmdc:mga0rr50_29858_c1 3300050513 Bacteria 3851
546 nmdc:mga0rr50_3060_c1 3300050513 Bacteria 9572
547 nmdc:mga0rr50_32878_c1 3300050513 Bacteria 3701
548 nmdc:mga0rr50_342854_c1 3300050513 Unclassified 1256
549 nmdc:mga0rr50_462784_c1 3300050513 Bacteria 1076
550 nmdc:mga0rr50_531134_c1 3300050513 Unclassified 1001
551 nmdc:mga0rr50_559195_c1 3300050513 Bacteria 974
552 nmdc:mga0rr50_790751_c1 3300050513 Unclassified 809
553 nmdc:mga08x19_308005_c1 3300050514 Unclassified 734
554 nmdc:mga08x19_421177_c1 3300050514 Bacteria 938
555 nmdc:mga0a205_100620_c1 3300050515 Bacteria 2789
556 nmdc:mga0a205_198259_c1 3300050515 Bacteria 1899
557 nmdc:mga0a205_594_c1 3300050515 Bacteria 28735
558 nmdc:mga0a205_758672_c1 3300050515 Bacteria 819
559 nmdc:mga0a205_786222_c1 3300050515 Unclassified 800
560 nmdc:mga0a205_868510_c1 3300050515 Unclassified 749
561 nmdc:mga0a205_96511_c1 3300050515 Bacteria 2855
562 nmdc:mga0a205_99641_c1 3300050515 Bacteria 2804
563 Ga0495655_0010605 3300053083 Unclassified 1824
564 Ga0495595_0350509 3300053084 Bacteria 745
565 Ga0495619_0244919 3300053085 Bacteria 1242
566 Ga0501082_0982917 3300060353 Unclassified 738
567 Ga0530510_0335008 3300061734 Bacteria 1135
568 nmdc:mga05p37_1708981_c1
569 Ga0065704_10020063
570 Ga0065704_10035148
571 Ga0065704_10078374
572 Ga0065704_10605239
573 Ga0065712_10206145
574 Ga0065712_10224392
575 Ga0065715_10364753
576 Ga0065715_10375154
577 Ga0065707_10026255
578 Ga0065707_10082126
579 Ga0065707_10202777
580 Ga0065707_10456669
581 Ga0065707_10534383
582 Ga0065707_11128509
583 Ga0070676_10672252
584 Ga0070670_100345630
585 Ga0070689_100161516
586 Ga0070689_100277444
587 Ga0070689_100748575
588 Ga0070691_10518944
589 Ga0070661_100516987
590 Ga0070668_100340499
591 Ga0070668_101104812
592 Ga0070675_100005730
593 Ga0070675_100174671
594 Ga0070675_100864593
595 Ga0070671_100076903
596 Ga0070671_100715701
597 Ga0070674_100569581
598 Ga0070688_100098538
599 Ga0070667_100307160
600 Ga0070667_101257293
601 Ga0070709_10231587
602 Ga0070709_10247882
603 Ga0070709_10537553
604 Ga0070714_100049460
605 Ga0070714_100514347
606 Ga0070714_100851606
607 Ga0070713_100420262
608 Ga0070710_10012653
609 Ga0070710_10834893
610 Ga0070711_100326827
611 Ga0070711_100367603
612 Ga0070711_100525281
613 Ga0070711_100533163
614 Ga0070705_100219415
615 Ga0070705_100617900
616 Ga0070705_100879912
617 Ga0070700_100169933
618 Ga0070700_100489661
619 Ga0070694_100046578
620 Ga0070694_100122476
621 Ga0070708_100050523
622 Ga0070708_100075904
623 Ga0070708_100119937
624 Ga0070708_100177902
625 Ga0070708_100308705
626 Ga0070708_100507464
627 Ga0070708_100761968
628 Ga0070663_100334631
629 Ga0070662_100379198
630 Ga0070685_10285829
631 Ga0070685_10761012
632 Ga0070706_100006291
633 Ga0070706_100020149
634 Ga0070706_100068939
635 Ga0070706_100173180
636 Ga0070706_100287138
637 Ga0070706_100320008
638 Ga0070706_100526471
639 Ga0070706_101710495
640 Ga0070707_100011484
641 Ga0070707_100025826
642 Ga0070707_100174596
643 Ga0070707_100223172
644 Ga0070707_100323884
645 Ga0070707_100330310
646 Ga0070698_100072087
647 Ga0070698_100073139
648 Ga0070698_100111665
649 Ga0070698_100157732
650 Ga0070698_100173480
651 Ga0070698_100250870
652 Ga0070698_100385252
653 Ga0070698_100392545
654 Ga0070698_100828592
655 Ga0070698_101613719
656 Ga0070699_100003790
657 Ga0070699_100107353
658 Ga0070699_100145833
659 Ga0070699_100799907
660 Ga0070699_100916434
661 Ga0070699_101148149
662 Ga0070699_101660704
663 Ga0070684_100008302
664 Ga0070684_100720263
665 Ga0070697_100059126
666 Ga0070697_100416939
667 Ga0070697_100444802
668 Ga0070697_100539200
669 Ga0070697_100629053
670 Ga0070697_101248293
671 Ga0070697_101331331
672 Ga0070686_100132792
673 Ga0070686_100150596
674 Ga0070695_100012297
675 Ga0070696_100196754
676 Ga0070696_100506012
677 Ga0070693_100515166
678 Ga0070704_100014357
679 Ga0070704_100084516
680 Ga0070704_100314441
681 Ga0070704_100877053
682 Ga0070704_101494944
683 Ga0068855_100397959
684 Ga0068854_100768726
685 Ga0070702_100194747
686 Ga0070702_100578871
687 Ga0068859_100789094
688 Ga0068859_101868399
689 Ga0068859_101887167
690 Ga0068859_102410505
691 Ga0068864_100213726
692 Ga0068864_101661101
693 Ga0068861_100092591
694 Ga0068861_100225648
695 Ga0068861_101293996
696 Ga0068870_10874634
697 Ga0068863_100168513
698 Ga0068863_100352849
699 Ga0068863_101259240
700 Ga0068858_100032451
701 Ga0068858_100354973
702 Ga0068858_100362205
703 Ga0068860_100040771
704 Ga0068862_100494336
705 Ga0068862_101502730
706 Ga0081455_10004390
707 Ga0081540_1017992
708 Ga0081540_1119117
709 Ga0081540_1179754
710 Ga0081540_1181968
711 Ga0070717_10001557
712 Ga0070717_10077490
713 Ga0075432_10116867
714 Ga0070715_10444456
715 Ga0070716_100021080
716 Ga0070716_100367552
717 Ga0070712_100073246
718 Ga0070712_100372726
719 Ga0070712_100442683
720 Ga0070712_100466601
721 Ga0070712_100614490
722 Ga0070712_100647821
723 Ga0070712_100823232
724 Ga0070712_100841546
725 Ga0075427_10003376
726 Ga0097621_100271412
727 Ga0075428_100031237
728 Ga0075428_100243337
729 Ga0075428_100376828
730 Ga0075428_100546822
731 Ga0075428_100953503
732 Ga0075428_101351605
733 Ga0075428_101571655
734 Ga0075428_101658826
735 Ga0075430_100122226
736 Ga0075430_100546343
737 Ga0075430_100786094
738 Ga0075430_101063677
739 Ga0075430_101115444
740 Ga0075431_100047920
741 Ga0075431_100247568
742 Ga0075431_100523812
743 Ga0075433_10000747
744 Ga0075433_10006116
745 Ga0075433_10097078
746 Ga0075433_10240695
747 Ga0075433_10259618
748 Ga0075433_10567019
749 Ga0075433_11375930
750 Ga0075434_100001047
751 Ga0075434_100073510
752 Ga0075434_100676797
753 Ga0075434_100710462
754 Ga0075434_100742642
755 Ga0075434_100889756
756 Ga0075434_100899471
757 Ga0075429_100005287
758 Ga0075429_100020060
759 Ga0075429_100285413
760 Ga0075429_101032022
761 Ga0075429_101162665
762 Ga0068865_100508212
763 Ga0075436_100019930
764 Ga0075436_100105664
765 Ga0075436_100139575
766 Ga0075436_100233984
767 Ga0075436_100623146
768 Ga0097620_100789048
769 Ga0097620_101868901
770 Ga0097620_101886952
771 Ga0097620_102410928
772 Ga0075435_100056394
773 Ga0075435_100113476
774 Ga0075435_100140749
775 Ga0075435_100211272
776 Ga0075435_100212549
777 Ga0075435_100516162
778 Ga0099794_10020255
779 Ga0099795_10275585
780 Ga0111539_10017875
781 Ga0111539_10339989
782 Ga0111539_10421102
783 Ga0111539_11217758
784 Ga0111539_11853603
785 Ga0105245_10218399
786 Ga0105245_10290441
787 Ga0114129_10002217
788 Ga0114129_10029104
789 Ga0114129_10301703
790 Ga0114129_10882096
791 Ga0114129_10969680
792 Ga0114129_11083171
793 Ga0114129_11225572
794 Ga0114129_11436239
795 Ga0114129_12629678
796 Ga0105243_10725412
797 Ga0105242_10165353
798 Ga0105242_11316881
799 Ga0105248_10646235
800 Ga0105248_10726416
801 Ga0105248_11182893
802 Ga0105248_11842802
803 Ga0105237_10118512
804 Ga0105249_10155534
805 Ga0105249_11111563
806 Ga0105239_10011903
807 Ga0105239_10471652
808 Ga0157337_1017362
809 Ga0157374_10126010
810 Ga0157374_10479626
811 Ga0157374_11668577
812 Ga0157378_10027166
813 Ga0157378_10031529
814 Ga0157378_10041025
815 Ga0157378_10072995
816 Ga0157378_10436430
817 Ga0157378_10445684
818 Ga0157378_11463435
819 Ga0163162_10241103
820 Ga0163162_10468044
821 Ga0163162_10535652
822 Ga0163162_10544916
823 Ga0163162_10675249
824 Ga0163162_10856503
825 Ga0163162_11119066
826 Ga0163162_11357900
827 Ga0157372_11362663
828 Ga0157375_10017715
829 Ga0157375_10134401
830 Ga0157375_11204510
831 Ga0157375_11312796
832 Ga0157375_11424034
833 Ga0157375_13343707
834 Ga0163163_10098475
835 Ga0163163_10586099
836 Ga0163163_10852432
837 Ga0163163_11997852
838 Ga0157380_10245693
839 Ga0157380_11321710
840 Ga0157379_10008264
841 Ga0157376_10178227
842 Ga0157376_10741027
843 Ga0157376_12666186
844 Ga0163161_10135750
845 Ga0163161_10701570
846 Ga0163161_11935701
847 Ga0213872_10073681
848 Ga0213876_10019074
849 Ga0213871_10001463
850 Ga0207666_1025284
851 Ga0207697_10000197
852 Ga0207697_10155785
853 Ga0207697_10209117
854 Ga0207653_10182523
855 Ga0207642_10302305
856 Ga0207710_10058000
857 Ga0207647_10020282
858 Ga0207685_10007093
859 Ga0207684_10000956
860 Ga0207684_10129796
861 Ga0207684_10140839
862 Ga0207684_10219348
863 Ga0207684_10342573
864 Ga0207684_10585493
865 Ga0207671_10120411
866 Ga0207693_10046701
867 Ga0207693_10260290
868 Ga0207693_10314917
869 Ga0207693_10421146
870 Ga0207693_10447237
871 Ga0207693_11182073
872 Ga0207663_10256391
873 Ga0207662_10155972
874 Ga0207662_10263831
875 Ga0207657_10067628
876 Ga0207649_10753748
877 Ga0207646_10010132
878 Ga0207646_10022118
879 Ga0207646_10038711
880 Ga0207646_10266469
881 Ga0207646_10585391
882 Ga0207681_10917708
883 Ga0207650_11150240
884 Ga0207659_10237016
885 Ga0207687_10010729
886 Ga0207687_10367618
887 Ga0207687_10458638
888 Ga0207700_10289731
889 Ga0207664_10047437
890 Ga0207690_10013431
891 Ga0207706_10115504
892 Ga0207706_10579044
893 Ga0207686_10100745
894 Ga0207709_10009434
895 Ga0207670_10199273
896 Ga0207670_10524590
897 Ga0207669_10294036
898 Ga0207704_10221406
899 Ga0207704_11386554
900 Ga0207665_10231225
901 Ga0207665_10279493
902 Ga0207665_10721217
903 Ga0207691_10980752
904 Ga0207711_10685887
905 Ga0207661_10062949
906 Ga0207679_11249339
907 Ga0207667_10107570
908 Ga0207712_10113353
909 Ga0207712_10346512
910 Ga0207712_11671971
911 Ga0207668_10104859
912 Ga0207668_10495963
913 Ga0207658_10187904
914 Ga0207677_11568731
915 Ga0207703_10048594
916 Ga0207703_10322346
917 Ga0207703_10357771
918 Ga0207703_10406691
919 Ga0207678_10112731
920 Ga0207708_10093971
921 Ga0207708_10103298
922 Ga0207708_10213752
923 Ga0207641_10020394
924 Ga0207641_10065822
925 Ga0207641_10537651
926 Ga0207641_11033596
927 Ga0207648_11884801
928 Ga0207676_10222432
929 Ga0207676_10245475
930 Ga0207675_100044700
931 Ga0207675_100086017
932 Ga0207675_100197935
933 Ga0207675_100242913
934 Ga0207675_100547598
935 Ga0207428_10272492
936 Ga0207428_10599927
937 Ga0268265_11053039
938 Ga0268265_11682700
939 Ga0268264_10735715
940 Ga0265325_10410121
941 Ga0316578_10331349
942 Ga0307416_101245510
943 Ga0373948_0036150
944 Ga0373926_0139293
945 Ga0373944_0085316
946 Ga0373944_0145865
947 Ga0373949_0091317
948 Ga0373923_0454387
949 Ga0373932_0102199
950 Ga0373939_0041613
951 Ga0373941_0027328
952 Ga0373945_0043825
953 Ga0373943_0036822
954 Ga0373942_0207081
955 Ga0373962_0017356
956 Ga0373924_0287980
957 Ga0373931_0006697
958 Ga0373931_0121454
959 Ga0373931_0139724
960 Ga0373931_0197614
961 Ga0373927_0176957
962 Ga0373933_0502200
963 Ga0373947_0020056
964 Ga0373937_0788287
965 Ga0373937_1069423
966 Ga0373925_0199016
967 Ga0373925_0589441
968 Ga0395905_0476807
969 Ga0395905_0793803
970 Ga0436364_0863328
971 Ga0436365_0081021
972 Ga0436360_0134488
973 Ga0436360_0430870
974 Ga0436360_0754657
975 Ga0436360_1247953
976 Ga0436361_0238422
977 Ga0436361_0436414
978 Ga0436361_0635148
979 Ga0436361_0874952
980 Ga0436363_0248341
981 Ga0451577_0210702
982 Ga0453683_0005116
983 Ga0453683_0090168
984 Ga0453684_0078401
985 Ga0453684_0787939
986 Ga0451576_0116810
987 Ga0451576_0278538
988 Ga0495603_0508225
989 Ga0495629_0267057
990 Ga0495629_0430218
991 Ga0495629_1041813
992 Ga0495651_0004483
993 Ga0495651_0212038
994 Ga0495580_0151798
995 Ga0495580_0199084
996 Ga0495580_0615973
997 Ga0495580_0623957
998 Ga0495582_0060524
999 Ga0495605_0074554
1000 Ga0495662_0630615
1001 Ga0495584_0223536
1002 Ga0495585_0053476
1003 Ga0495585_0320723
1004 Ga0495594_0266355
1005 Ga0495618_0431945
1006 Ga0495618_0764543
1007 Ga0495628_0097281
1008 Ga0495628_0645715
1009 Ga0495628_0853055
1010 Ga0495630_0038528
1011 Ga0495630_0110849
1012 Ga0495663_0008955
1013 Ga0495666_0106835
1014 Ga0495642_0024236
1015 Ga0495652_0023503
1016 Ga0495640_0060181
1017 Ga0495640_0220996
1018 Ga0495586_0390466
1019 Ga0495587_0017283
1020 Ga0495587_0071653
1021 Ga0495645_0087552
1022 Ga0495645_0234757
1023 Ga0495645_0342453
1024 Ga0495667_0008911
1025 Ga0495667_0046614
1026 Ga0495656_0181394
1027 Ga0495635_0333081
1028 Ga0495659_0096137
1029 Ga0495659_0116435
1030 Ga0495659_0133593
1031 Ga0495599_0016708
1032 Ga0495623_0022348
1033 Ga0495623_0275570
1034 Ga0495669_0005798
1035 Ga0495669_0381913
1036 Ga0495613_0091849
1037 Ga0495613_0325483
1038 Ga0495624_0737633
1039 Ga0495624_0912547
1040 Ga0495670_0351008
1041 Ga0495670_0539168
1042 Ga0495670_0607660
1043 Ga0495670_0697542
1044 Ga0495589_0155505
1045 Ga0495589_0291273
1046 Ga0495581_0170300
1047 Ga0495604_0028874
1048 Ga0495604_0096821
1049 Ga0495636_0187168
1050 Ga0495674_0099342
1051 Ga0495674_0525006
1052 Ga0495680_0019946
1053 Ga0495675_0002110
1054 Ga0495675_0191111
1055 Ga0495684_0001101
1056 Ga0495684_0008556
1057 Ga0495684_0283855
1058 Ga0495684_0751264
1059 Ga0495602_0034229
1060 Ga0496101_1547151
1061 Ga0496102_1735559
1062 Ga0496104_0153837
1063 Ga0496104_0562677
1064 Ga0496106_0562607
1065 Ga0496109_0106189
1066 Ga0496110_0100963
1067 Ga0496111_1174836
1068 Ga0496113_0211436
1069 Ga0496115_0265271
1070 Ga0496115_0331188
1071 Ga0496115_0808872
1072 Ga0501031_0715377
1073 Ga0501047_0834863
1074 Ga0501048_0654645
1075 Ga0501077_0110294
1076 Ga0501077_0411601
1077 Ga0501044_0642141
1078 nmdc:mga05p37_1051948_c1
1079 nmdc:mga05p37_109207_c1
1080 nmdc:mga05p37_169474_c1
1081 nmdc:mga05p37_250442_c1
1082 nmdc:mga05p37_384018_c1
1083 nmdc:mga05p37_65541_c1
1084 nmdc:mga05p37_68315_c1
1085 nmdc:mga05p37_7890_c1
1086 nmdc:mga05p37_82887_c1
1087 nmdc:mga09592_1509300_c1
1088 nmdc:mga09592_262605_c1
1089 nmdc:mga09592_4603_c1
1090 nmdc:mga09592_520274_c1
1091 nmdc:mga09592_94726_c1
1092 nmdc:mga0qj67_1519864_c1
1093 nmdc:mga0qj67_3953_c1
1094 nmdc:mga06r32_252107_c1
1095 nmdc:mga06r32_599955_c1
1096 nmdc:mga06r32_71190_c1
1097 nmdc:mga06r32_86125_c1
1098 nmdc:mga08y16_451159_c1
1099 nmdc:mga08y16_533729_c1
1100 nmdc:mga0n895_1057308_c1
1101 nmdc:mga0n895_1636076_c1
1102 nmdc:mga0n895_1947_c1
1103 nmdc:mga0n895_269379_c1
1104 nmdc:mga0n895_284316_c1
1105 nmdc:mga0n895_299753_c1
1106 nmdc:mga0n895_61863_c1
1107 nmdc:mga0n895_81755_c1
1108 nmdc:mga0n895_912063_c1
1109 nmdc:mga0rr50_109743_c1
1110 nmdc:mga0rr50_1297059_c1
1111 nmdc:mga0rr50_153414_c1
1112 nmdc:mga0rr50_29858_c1
1113 nmdc:mga0rr50_3060_c1
1114 nmdc:mga0rr50_32878_c1
1115 nmdc:mga0rr50_342854_c1
1116 nmdc:mga0rr50_462784_c1
1117 nmdc:mga0rr50_531134_c1
1118 nmdc:mga0rr50_559195_c1
1119 nmdc:mga0rr50_790751_c1
1120 nmdc:mga08x19_308005_c1
1121 nmdc:mga08x19_421177_c1
1122 nmdc:mga0a205_100620_c1
1123 nmdc:mga0a205_198259_c1
1124 nmdc:mga0a205_594_c1
1125 nmdc:mga0a205_758672_c1
1126 nmdc:mga0a205_786222_c1
1127 nmdc:mga0a205_868510_c1
1128 nmdc:mga0a205_96511_c1
1129 nmdc:mga0a205_99641_c1
1130 Ga0495655_0010605
1131 Ga0495595_0350509
1132 Ga0495619_0244919
1133 Ga0501082_0982917
1134 Ga0530510_0335008

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02502

LacAB_rpiB

Ribose/Galactose Isomerase

40

179

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lfk-assembly1.cif.gz_B crystal structure of d-galactose-6-phosphate isomerase in a substrate-free form 0.9687 1 142
1o1x-assembly1.cif.gz_A crystal structure of a ribose 5-phosphate isomerase rpib (tm1080) from thermotoga maritima at 1.90 a resolution 0.9612 2 142
2vvr-assembly1.cif.gz_A crystal structure of the h99n mutant of ribose-5-phosphate isomerase b from e. coli soaked with ribose 5-phosphate 0.9562 2 147
1nn4-assembly1.cif.gz_A structural genomics, rpib/alsb 0.9561 2 146
3ph4-assembly1.cif.gz_A clostridium thermocellum ribose-5-phosphate isomerase b with d-allose 0.9554 1 150
ID Description Score Start End Superfamily
4lfkB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9687 1 142 3.40.1400.10
1o1xA00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.959 2 142 3.40.1400.10
1nn4D00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.957 2 147 3.40.1400.10
3s5pB00 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.952 1 130 3.40.1400.10
af_P9WKD7_1_162_3.40.1400.10 Alpha Beta;3-Layer(aba) Sandwich;Ribose 5-phosphate Isomerase B; Chain: A,;Sugar-phosphate isomerase, RpiB/LacA/LacB 0.9513 1 150 3.40.1400.10
ID Description Score Start End GO Terms
AF-L0DAW5-F1-model_v4 Sugar-phosphate isomerase, RpiB/LacA/LacB family 0.9887 1 144 GO:0005975
GO:0016861
AF-A0A7V7VPN7-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9886 2 145 GO:0005975
GO:0006098
GO:0016861
GO:0017057
AF-A0A518D8V1-F1-model_v4 6-phosphogluconolactonase (EC 3.1.1.31) 0.9858 1 146 GO:0005975
GO:0006098
GO:0016861
GO:0017057
AF-A0A3A4VMN2-F1-model_v4 Ribose 5-phosphate isomerase B (EC 5.3.1.6) 0.9858 1 139 GO:0004751
GO:0005975
AF-A0A5C6D3P3-F1-model_v4 Putative sugar phosphate isomerase YwlF (EC 5.3.1.-) 0.9857 2 146 GO:0005975
GO:0016861

Map