F464530

General Info

Members Datasets Scaffolds Average Seq Length
567 277 550 344

Family's Representative Sequence

Representative Sequence 3300038443|Ga0395901_0119300|Ga0395901_0119300_1340_2497
Length 385
Sequence MAWGNDRERLGNMEYRTLTDPLPAEGSNGLTGDGSIRVQSDGIASRPSPLALPAPYLLFLGDVTEPSYAKTAFGLHDWASERCVGEFVSDPRAVRTGLPRLSPAEAAAKGARAMVIAVANSGGYIPESWHPSLLEALGAGLDLVAGMHVKLASIPAVAQAAQDLGRQLIDVRTPPRNIPVATGEKRSGKRLLTVGTDCALGKKYTALALAHAFARRGLKVDFRATGQTGIMIAGGGIPMDAVVSDFEAGAAELLSPDAAPDHWDVIEGQGSLLHPAYSAVSMGLLHGSQPDVFVVCHDPSRSTMLGHPNFPIPAIEEIISLTTELGRRTNPAIRCGGVAYNTSALRAEDAAALMERDSERLGLEIADPIRRGPAFDRLVNSCLEA

Samples

Sample ID Description Type Environment
1 2512564014 Sphingobium sp. AP49 Isolate Rhizosphere
2 2643221560 Sphingopyxis sp. Root1497 Isolate Unclassified
3 2643221563 Sphingopyxis sp. Root154 Isolate Unclassified
4 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
5 2643221608 Sphingopyxis sp. Root214 Isolate Unclassified
6 2643221622 Sphingomonas sp. Root241 Isolate Unclassified
7 2852653556 Sphingopyxis sp. JAI108 Isolate Rhizosphere
8 2852680915 Sphingopyxis sp. JAI128 Isolate Rhizosphere
9 2882806704 Pelagerythrobacter rhizovicinus AY-3R Isolate Rhizosphere
10 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
11 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
12 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
13 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
14 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
15 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
16 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
17 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
18 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
19 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
20 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
21 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
22 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
28 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
32 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
72 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
73 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
74 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
80 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
81 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
82 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
83 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
86 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
87 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
88 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
89 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
90 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
91 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
99 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
105 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
106 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
107 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
108 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
109 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
110 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
112 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
113 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
162 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
163 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
164 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
168 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
182 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
186 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
187 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
188 3300039145 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 Metagenome Unclassified
189 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
190 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
191 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
194 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
195 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
196 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
197 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
198 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
199 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
204 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
205 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
206 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
207 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
208 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
209 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
214 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
215 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
216 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
219 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
220 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
221 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
222 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
223 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
224 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
225 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
226 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
227 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
240 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
241 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
247 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
257 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
258 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
259 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
260 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
261 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
262 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
263 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
264 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
265 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
266 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
267 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
268 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
269 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
270 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
271 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
272 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
273 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
274 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
275 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
276 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
277 8057101203 Sphingomonas lycopersici MMSM20 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.35
Isolates 2.47

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.11
Nodule 0.18
Rhizoplane 1.94
Rhizosphere 74.25
Stem 0
Stem Tuber 0
Unclassified 6.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000019 3300001979 Bacteria 54662
2 JGI24739J22299_10006255 3300001989 Bacteria 4495
3 JGI25150J39212_1000044 3300002774 Bacteria 83125
4 JGI25406J46586_10003744 3300003203 Bacteria 7115
5 JGI25153J46596_10000043 3300003215 Bacteria 156407
6 Ga0055526_1005425 3300003771 Bacteria 7334
7 Ga0055537_1001605 3300003773 Bacteria 8512
8 Ga0055536_1000733 3300003781 Bacteria 22058
9 Ga0055536_1001202 3300003781 Bacteria 16081
10 Ga0055536_1001466 3300003781 Bacteria 14175
11 Ga0055536_1001810 3300003781 Bacteria 12568
12 Ga0055536_1003951 3300003781 Bacteria 7772
13 Ga0055536_1007638 3300003781 Bacteria 4796
14 Ga0055536_1015188 3300003781 Bacteria 2651
15 Ga0055530_10000106 3300003791 Bacteria 71921
16 Ga0055530_10000164 3300003791 Bacteria 60316
17 Ga0055530_10000181 3300003791 Bacteria 56843
18 Ga0055530_10000465 3300003791 Bacteria 35593
19 Ga0055530_10021805 3300003791 Bacteria 1879
20 Ga0055530_10023840 3300003791 Bacteria 1750
21 Ga0055530_10041273 3300003791 Bacteria 1127
22 Ga0055540_1006239 3300003792 Bacteria 4779
23 Ga0055531_10000012 3300003794 Bacteria 191187
24 Ga0055531_10001005 3300003794 Bacteria 22405
25 Ga0055531_10001314 3300003794 Bacteria 18656
26 Ga0055531_10004289 3300003794 Bacteria 8747
27 Ga0055531_10004380 3300003794 Bacteria 8625
28 Ga0055531_10005744 3300003794 Bacteria 7187
29 Ga0055531_10006349 3300003794 Bacteria 6727
30 Ga0055531_10024604 3300003794 Bacteria 2215
31 Ga0055531_10024606 3300003794 Bacteria 2215
32 Ga0065165_1007814 3300005262 Bacteria 5151
33 Ga0065715_10101304 3300005293 Bacteria 3218
34 Ga0070683_100221658 3300005329 Bacteria 1798
35 Ga0070690_100052877 3300005330 Bacteria 2597
36 Ga0070670_100148246 3300005331 Bacteria 2030
37 Ga0070670_100279037 3300005331 Bacteria 1459
38 Ga0070666_10001021 3300005335 Bacteria 17164
39 Ga0070682_100063474 3300005337 Bacteria 2342
40 Ga0068868_100038055 3300005338 Bacteria 3733
41 Ga0070689_100005710 3300005340 Bacteria 8527
42 Ga0070689_100143957 3300005340 Bacteria 1919
43 Ga0070691_10109888 3300005341 Bacteria 1378
44 Ga0070687_100020844 3300005343 Bacteria 3072
45 Ga0070661_100006044 3300005344 Bacteria 8327
46 Ga0070661_100087735 3300005344 Bacteria 2302
47 Ga0070661_100111003 3300005344 Bacteria 2048
48 Ga0070668_100045018 3300005347 Bacteria 3386
49 Ga0070669_100013818 3300005353 Bacteria 5739
50 Ga0070669_100144466 3300005353 Bacteria 1837
51 Ga0070675_100198646 3300005354 Bacteria 1740
52 Ga0070675_100288289 3300005354 Bacteria 1444
53 Ga0070667_100099738 3300005367 Bacteria 2507
54 Ga0070667_100165132 3300005367 Bacteria 1952
55 Ga0070667_100235003 3300005367 Bacteria 1635
56 Ga0070714_100230939 3300005435 Bacteria 1704
57 Ga0070705_100020633 3300005440 Bacteria 3491
58 Ga0070700_100020690 3300005441 Bacteria 3817
59 Ga0070663_100000022 3300005455 Bacteria 111612
60 Ga0070678_100006730 3300005456 Bacteria 6768
61 Ga0070678_100110169 3300005456 Bacteria 2153
62 Ga0070662_100002305 3300005457 Bacteria 11720
63 Ga0070662_100002608 3300005457 Bacteria 11121
64 Ga0070662_100004914 3300005457 Bacteria 8491
65 Ga0070662_100070678 3300005457 Bacteria 2572
66 Ga0070681_10003155 3300005458 Bacteria 15329
67 Ga0070681_10177753 3300005458 Bacteria 2050
68 Ga0068867_100016202 3300005459 Bacteria 5292
69 Ga0068867_100368207 3300005459 Bacteria 1204
70 Ga0070685_10000152 3300005466 Bacteria 45620
71 Ga0070685_10001858 3300005466 Bacteria 11018
72 Ga0070684_100008538 3300005535 Bacteria 8016
73 Ga0068853_100028737 3300005539 Bacteria 4679
74 Ga0068853_100032342 3300005539 Bacteria 4431
75 Ga0068853_100044493 3300005539 Bacteria 3800
76 Ga0068853_100068560 3300005539 Bacteria 3084
77 Ga0068853_100316742 3300005539 Bacteria 1445
78 Ga0070686_100002514 3300005544 Bacteria 10102
79 Ga0070665_100000928 3300005548 Bacteria 37485
80 Ga0070665_100004102 3300005548 Bacteria 15321
81 Ga0070665_100007710 3300005548 Bacteria 10930
82 Ga0070665_100008614 3300005548 Bacteria 10322
83 Ga0070665_100009713 3300005548 Bacteria 9725
84 Ga0070665_100030126 3300005548 Bacteria 5460
85 Ga0070665_100104488 3300005548 Bacteria 2835
86 Ga0070665_100105961 3300005548 Bacteria 2813
87 Ga0068855_100069899 3300005563 Unclassified 4085
88 Ga0070664_100220201 3300005564 Bacteria 1698
89 Ga0068857_100022630 3300005577 Bacteria 5528
90 Ga0068854_100006701 3300005578 Bacteria 7343
91 Ga0068856_100000041 3300005614 Bacteria 112613
92 Ga0068856_100015602 3300005614 Bacteria 7345
93 Ga0070702_100021737 3300005615 Bacteria 3382
94 Ga0068852_100290638 3300005616 Bacteria 1579
95 Ga0068859_100002362 3300005617 Bacteria 19216
96 Ga0068864_100029869 3300005618 Bacteria 4619
97 Ga0068866_10146072 3300005718 Bacteria 1364
98 Ga0068861_100000062 3300005719 Bacteria 51049
99 Ga0068861_100000366 3300005719 Bacteria 25904
100 Ga0068851_10007007 3300005834 Bacteria 5169
101 Ga0068870_10018123 3300005840 Bacteria 3395
102 Ga0068863_100030711 3300005841 Bacteria 5130
103 Ga0068863_100084928 3300005841 Bacteria 2999
104 Ga0068863_100246254 3300005841 Bacteria 1726
105 Ga0068858_100002262 3300005842 Bacteria 19472
106 Ga0068858_100049301 3300005842 Bacteria 3899
107 Ga0068860_100006757 3300005843 Bacteria 11505
108 Ga0068860_100448429 3300005843 Bacteria 1283
109 Ga0068862_100000722 3300005844 Bacteria 33471
110 Ga0068862_100276589 3300005844 Bacteria 1537
111 Ga0081539_10000004 3300005985 Bacteria 555600
112 Ga0070717_10282795 3300006028 Bacteria 1472
113 Ga0070716_100121766 3300006173 Bacteria 1634
114 Ga0070716_100209304 3300006173 Bacteria 1302
115 Ga0097621_100019694 3300006237 Bacteria 5186
116 Ga0097621_100024669 3300006237 Bacteria 4699
117 Ga0097621_100034130 3300006237 Bacteria 4056
118 Ga0097621_100137657 3300006237 Bacteria 2084
119 Ga0068871_100051777 3300006358 Bacteria 3324
120 Ga0075428_100000920 3300006844 Bacteria 31094
121 Ga0075428_100282823 3300006844 Bacteria 1785
122 Ga0075430_100004783 3300006846 Bacteria 11391
123 Ga0075430_100008166 3300006846 Bacteria 8848
124 Ga0075430_100060288 3300006846 Bacteria 3189
125 Ga0075430_100141229 3300006846 Bacteria 2006
126 Ga0075431_100000221 3300006847 Bacteria 42473
127 Ga0075431_100000267 3300006847 Bacteria 40345
128 Ga0075431_100003861 3300006847 Bacteria 14570
129 Ga0075434_100213628 3300006871 Bacteria 1949
130 Ga0075429_100003103 3300006880 Bacteria 14111
131 Ga0068865_100023649 3300006881 Bacteria 4025
132 Ga0097620_100002362 3300006931 Bacteria 19216
133 Ga0079104_1018097 3300006946 Bacteria 2005
134 Ga0105240_10010664 3300009093 Bacteria 12896
135 Ga0105240_10016387 3300009093 Bacteria 10035
136 Ga0105240_10067374 3300009093 Bacteria 4437
137 Ga0105240_10069692 3300009093 Bacteria 4352
138 Ga0105240_10175389 3300009093 Bacteria 2535
139 Ga0111539_10000989 3300009094 Bacteria 37233
140 Ga0111539_10007571 3300009094 Bacteria 13881
141 Ga0111539_10025836 3300009094 Bacteria 7191
142 Ga0111539_10127795 3300009094 Bacteria 2977
143 Ga0111539_10401226 3300009094 Bacteria 1597
144 Ga0105245_10078920 3300009098 Bacteria 3004
145 Ga0105245_10153917 3300009098 Bacteria 2176
146 Ga0105247_10059784 3300009101 Bacteria 2360
147 Ga0114129_10003655 3300009147 Bacteria 21639
148 Ga0114129_10079198 3300009147 Bacteria 4569
149 Ga0114129_10247926 3300009147 Bacteria 2392
150 Ga0105242_10016940 3300009176 Bacteria 5671
151 Ga0105248_10037039 3300009177 Bacteria 5455
152 Ga0105237_10005186 3300009545 Bacteria 14738
153 Ga0105237_10037935 3300009545 Bacteria 4868
154 Ga0105237_10073498 3300009545 Bacteria 3411
155 Ga0105237_10109291 3300009545 Bacteria 2757
156 Ga0105237_10291681 3300009545 Bacteria 1634
157 Ga0105238_10000192 3300009551 Bacteria 67306
158 Ga0105238_10004676 3300009551 Bacteria 13548
159 Ga0105238_10025058 3300009551 Bacteria 6081
160 Ga0105238_10069026 3300009551 Bacteria 3535
161 Ga0105238_10085639 3300009551 Bacteria 3139
162 Ga0105238_10144200 3300009551 Bacteria 2358
163 Ga0105238_10179831 3300009551 Bacteria 2092
164 Ga0105238_10567708 3300009551 Bacteria 1140
165 Ga0105249_10001944 3300009553 Bacteria 17939
166 Ga0105249_10018875 3300009553 Bacteria 6145
167 Ga0105249_10029931 3300009553 Bacteria 4918
168 Ga0105249_10041664 3300009553 Bacteria 4175
169 Ga0105239_10029287 3300010375 Bacteria 6054
170 Ga0157373_10000046 3300013100 Bacteria 112179
171 Ga0157370_10000071 3300013104 Bacteria 111640
172 Ga0157369_10011583 3300013105 Bacteria 10011
173 Ga0163162_10000004 3300013306 Bacteria 505593
174 Ga0163162_10023244 3300013306 Bacteria 6115
175 Ga0163162_10298450 3300013306 Bacteria 1743
176 Ga0163162_10369090 3300013306 Bacteria 1568
177 Ga0157372_10529003 3300013307 Unclassified 1374
178 Ga0157375_10001172 3300013308 Bacteria 22634
179 Ga0157375_10030306 3300013308 Bacteria 5100
180 Ga0157375_10137437 3300013308 Bacteria 2569
181 Ga0157375_10206807 3300013308 Bacteria 2119
182 Ga0163163_10004078 3300014325 Bacteria 12454
183 Ga0157380_10053565 3300014326 Bacteria 3199
184 Ga0182008_10110260 3300014497 Bacteria 1364
185 Ga0157377_10003544 3300014745 Bacteria 7065
186 Ga0157379_10033075 3300014968 Bacteria 4610
187 Ga0157379_10100880 3300014968 Unclassified 2591
188 Ga0157379_10179162 3300014968 Bacteria 1915
189 Ga0157376_10032388 3300014969 Bacteria 4197
190 Ga0157376_10033821 3300014969 Bacteria 4120
191 Ga0163161_10064637 3300017792 Bacteria 2669
192 Ga0207425_1000047 3300025245 Bacteria 189158
193 Ga0209129_1000497 3300025258 Bacteria 28640
194 Ga0209565_1000089 3300025263 Bacteria 150511
195 Ga0209675_1000183 3300025291 Bacteria 70391
196 Ga0209675_1000202 3300025291 Bacteria 62955
197 Ga0209675_1000384 3300025291 Bacteria 36771
198 Ga0209676_1000155 3300025292 Bacteria 165151
199 Ga0209676_1000234 3300025292 Bacteria 119888
200 Ga0209676_1000384 3300025292 Bacteria 81053
201 Ga0209676_1000475 3300025292 Bacteria 66299
202 Ga0209676_1000693 3300025292 Bacteria 47361
203 Ga0209676_1004605 3300025292 Bacteria 7600
204 Ga0209676_1004674 3300025292 Bacteria 7513
205 Ga0209676_1007388 3300025292 Bacteria 5168
206 Ga0209025_1000150 3300025294 Bacteria 172834
207 Ga0209025_1007902 3300025294 Bacteria 7794
208 Ga0209025_1020691 3300025294 Bacteria 3582
209 Ga0209025_1054244 3300025294 Bacteria 1563
210 Ga0209564_1001696 3300025295 Bacteria 20847
211 Ga0209758_1000009 3300025297 Bacteria 1123483
212 Ga0209758_1023933 3300025297 Bacteria 2741
213 Ga0209050_1000005 3300025298 Bacteria 1557793
214 Ga0209050_1000039 3300025298 Bacteria 410069
215 Ga0209050_1000112 3300025298 Bacteria 210320
216 Ga0209050_1000132 3300025298 Bacteria 185906
217 Ga0209050_1000776 3300025298 Bacteria 45644
218 Ga0209050_1007994 3300025298 Bacteria 5770
219 Ga0209050_1008503 3300025298 Bacteria 5468
220 Ga0209050_1015174 3300025298 Bacteria 3257
221 Ga0209050_1032064 3300025298 Bacteria 1624
222 Ga0209051_1000396 3300025303 Bacteria 60690
223 Ga0209051_1004840 3300025303 Bacteria 8098
224 Ga0209257_1000051 3300025304 Bacteria 434166
225 Ga0209257_1000176 3300025304 Bacteria 161436
226 Ga0209257_1000337 3300025304 Bacteria 97941
227 Ga0209257_1000523 3300025304 Bacteria 66624
228 Ga0209257_1000600 3300025304 Bacteria 59824
229 Ga0209257_1001283 3300025304 Bacteria 30714
230 Ga0209257_1001567 3300025304 Bacteria 26417
231 Ga0209257_1001840 3300025304 Bacteria 23128
232 Ga0209257_1004585 3300025304 Bacteria 10546
233 Ga0209257_1015830 3300025304 Bacteria 3101
234 Ga0207656_10068433 3300025321 Bacteria 1573
235 Ga0207656_10090192 3300025321 Bacteria 1390
236 Ga0207688_10024861 3300025901 Bacteria 3286
237 Ga0207680_10098946 3300025903 Bacteria 1870
238 Ga0207647_10010944 3300025904 Bacteria 6381
239 Ga0207699_10077829 3300025906 Unclassified 2048
240 Ga0207705_10040583 3300025909 Bacteria 3339
241 Ga0207654_10000032 3300025911 Bacteria 120553
242 Ga0207654_10165274 3300025911 Bacteria 1432
243 Ga0207707_10160951 3300025912 Bacteria 1963
244 Ga0207707_10189494 3300025912 Bacteria 1794
245 Ga0207695_10000082 3300025913 Bacteria 284333
246 Ga0207695_10019407 3300025913 Bacteria 7831
247 Ga0207695_10022352 3300025913 Bacteria 7182
248 Ga0207695_10039411 3300025913 Bacteria 5079
249 Ga0207695_10041929 3300025913 Bacteria 4894
250 Ga0207695_10180159 3300025913 Bacteria 2034
251 Ga0207695_10206882 3300025913 Bacteria 1875
252 Ga0207671_10013633 3300025914 Bacteria 6464
253 Ga0207671_10102256 3300025914 Bacteria 2172
254 Ga0207671_10180622 3300025914 Bacteria 1642
255 Ga0207662_10006576 3300025918 Bacteria 6275
256 Ga0207649_10092171 3300025920 Bacteria 1986
257 Ga0207649_10097669 3300025920 Bacteria 1937
258 Ga0207681_10004757 3300025923 Bacteria 8355
259 Ga0207694_10000812 3300025924 Bacteria 27924
260 Ga0207694_10000832 3300025924 Bacteria 27463
261 Ga0207694_10003663 3300025924 Bacteria 12162
262 Ga0207694_10009691 3300025924 Bacteria 7263
263 Ga0207694_10148020 3300025924 Bacteria 1891
264 Ga0207659_10016381 3300025926 Bacteria 4823
265 Ga0207687_10207998 3300025927 Bacteria 1533
266 Ga0207644_10078015 3300025931 Bacteria 2441
267 Ga0207644_10178680 3300025931 Bacteria 1662
268 Ga0207690_10121698 3300025932 Bacteria 1897
269 Ga0207706_10001608 3300025933 Bacteria 22419
270 Ga0207706_10004158 3300025933 Bacteria 13642
271 Ga0207706_10004347 3300025933 Bacteria 13306
272 Ga0207706_10025788 3300025933 Bacteria 5266
273 Ga0207706_10097441 3300025933 Bacteria 2586
274 Ga0207686_10014243 3300025934 Bacteria 4422
275 Ga0207686_10209828 3300025934 Bacteria 1399
276 Ga0207709_10070099 3300025935 Bacteria 2222
277 Ga0207670_10030464 3300025936 Bacteria 3447
278 Ga0207670_10266101 3300025936 Bacteria 1331
279 Ga0207704_10012534 3300025938 Bacteria 4210
280 Ga0207704_10067079 3300025938 Bacteria 2256
281 Ga0207691_10057179 3300025940 Bacteria 3551
282 Ga0207691_10164062 3300025940 Bacteria 1948
283 Ga0207711_10073099 3300025941 Bacteria 2980
284 Ga0207689_10014175 3300025942 Bacteria 6781
285 Ga0207689_10321950 3300025942 Bacteria 1283
286 Ga0207679_10291434 3300025945 Bacteria 1403
287 Ga0207667_10447490 3300025949 Bacteria 1313
288 Ga0207651_10129805 3300025960 Bacteria 1927
289 Ga0207651_10137253 3300025960 Bacteria 1883
290 Ga0207712_10003759 3300025961 Bacteria 9584
291 Ga0207712_10062960 3300025961 Bacteria 2639
292 Ga0207668_10010127 3300025972 Bacteria 5683
293 Ga0207668_10241018 3300025972 Bacteria 1463
294 Ga0207668_10301709 3300025972 Bacteria 1322
295 Ga0207640_10002942 3300025981 Bacteria 9160
296 Ga0207658_10062115 3300025986 Bacteria 2794
297 Ga0207658_10138969 3300025986 Bacteria 1963
298 Ga0207677_10017144 3300026023 Bacteria 4310
299 Ga0207677_10054397 3300026023 Bacteria 2731
300 Ga0207703_10001706 3300026035 Bacteria 19722
301 Ga0207703_10139793 3300026035 Bacteria 2100
302 Ga0207703_10279642 3300026035 Bacteria 1515
303 Ga0207639_10000173 3300026041 Bacteria 50109
304 Ga0207639_10047697 3300026041 Bacteria 3239
305 Ga0207678_10000038 3300026067 Bacteria 101262
306 Ga0207678_10034501 3300026067 Bacteria 4406
307 Ga0207678_10040586 3300026067 Bacteria 4036
308 Ga0207708_10022675 3300026075 Bacteria 4741
309 Ga0207702_10000061 3300026078 Bacteria 125368
310 Ga0207641_10025983 3300026088 Bacteria 4831
311 Ga0207641_10057654 3300026088 Bacteria 3303
312 Ga0207641_10191196 3300026088 Bacteria 1881
313 Ga0207648_10019230 3300026089 Bacteria 6165
314 Ga0207648_10025282 3300026089 Bacteria 5291
315 Ga0207648_10148662 3300026089 Bacteria 2067
316 Ga0207676_10070454 3300026095 Bacteria 2804
317 Ga0207676_10111641 3300026095 Bacteria 2288
318 Ga0207674_10006655 3300026116 Bacteria 13575
319 Ga0207674_10013363 3300026116 Bacteria 9115
320 Ga0207674_10015160 3300026116 Bacteria 8481
321 Ga0207674_10022806 3300026116 Bacteria 6717
322 Ga0207674_10084276 3300026116 Bacteria 3177
323 Ga0207674_10127050 3300026116 Bacteria 2515
324 Ga0207675_100000614 3300026118 Bacteria 34802
325 Ga0207675_100000736 3300026118 Bacteria 32456
326 Ga0207675_100095114 3300026118 Bacteria 2803
327 Ga0207675_100106504 3300026118 Bacteria 2643
328 Ga0207675_100162179 3300026118 Bacteria 2133
329 Ga0207683_10161832 3300026121 Bacteria 2024
330 Ga0207683_10169408 3300026121 Bacteria 1977
331 Ga0207698_10055479 3300026142 Bacteria 3054
332 Ga0207428_10002156 3300027907 Bacteria 19753
333 Ga0207428_10018186 3300027907 Bacteria 6010
334 Ga0207428_10078567 3300027907 Bacteria 2582
335 Ga0265356_1002953 3300028017 Bacteria 2183
336 Ga0265355_1003744 3300028036 Bacteria 1125
337 Ga0268266_10000007 3300028379 Bacteria 1372921
338 Ga0268266_10000796 3300028379 Bacteria 41984
339 Ga0268266_10000890 3300028379 Bacteria 38685
340 Ga0268266_10001872 3300028379 Bacteria 23748
341 Ga0268266_10068644 3300028379 Bacteria 3070
342 Ga0268266_10158720 3300028379 Bacteria 2045
343 Ga0268266_10187776 3300028379 Bacteria 1886
344 Ga0268265_10000547 3300028380 Bacteria 38290
345 Ga0268265_10025331 3300028380 Bacteria 4208
346 Ga0268265_10045506 3300028380 Bacteria 3275
347 Ga0268264_10000176 3300028381 Bacteria 136166
348 Ga0268264_10004326 3300028381 Bacteria 12121
349 Ga0307515_10270587 3300028794 Bacteria 1421
350 Ga0265770_1011066 3300030878 Bacteria 1319
351 Ga0265760_10000405 3300031090 Bacteria 12088
352 Ga0307509_10000003 3300031507 Bacteria 577578
353 Ga0307509_10000021 3300031507 Bacteria 250589
354 Ga0307408_100019644 3300031548 Bacteria 4551
355 Ga0307408_100021968 3300031548 Bacteria 4328
356 Ga0307408_100051994 3300031548 Bacteria 2954
357 Ga0307508_10005849 3300031616 Bacteria 11614
358 Ga0307405_10005713 3300031731 Bacteria 6037
359 Ga0307413_10183726 3300031824 Bacteria 1494
360 Ga0307413_10336716 3300031824 Bacteria 1159
361 Ga0307406_10058025 3300031901 Bacteria 2486
362 Ga0307406_10104578 3300031901 Bacteria 1936
363 Ga0307406_10121945 3300031901 Bacteria 1814
364 Ga0307412_10041499 3300031911 Bacteria 2983
365 Ga0307416_100007495 3300032002 Bacteria 6946
366 Ga0307416_100041648 3300032002 Bacteria 3579
367 Ga0307414_10000242 3300032004 Bacteria 34787
368 Ga0307414_10022597 3300032004 Bacteria 3971
369 Ga0307414_10280657 3300032004 Bacteria 1399
370 Ga0307411_10140496 3300032005 Bacteria 1780
371 Ga0307415_100130236 3300032126 Bacteria 1903
372 Ga0307510_10000002 3300033180 Bacteria 801565
373 Ga0373944_0032432 3300035089 Bacteria 1578
374 Ga0373956_0040630 3300035119 Bacteria 2064
375 Ga0373937_0017549 3300036401 Bacteria 6379
376 Ga0373937_0281564 3300036401 Bacteria 1570
377 Ga0373937_0295818 3300036401 Bacteria 1530
378 Ga0395905_0022952 3300037471 Bacteria 5897
379 Ga0395901_0119300 3300038443 Bacteria 2772
380 Ga0237819_00302 3300038705 Bacteria 18159
381 Ga0237816_00554 3300039145 Bacteria 3167
382 Ga0436360_1257731 3300039438 Bacteria 1377
383 Ga0439448_0021987 3300042005 Bacteria 1979
384 Ga0466959_0018673 3300045049 Bacteria 5092
385 Ga0466959_0036457 3300045049 Bacteria 3634
386 Ga0451576_0606388 3300045051 Bacteria 1151
387 Ga0495627_000060 3300046453 Bacteria 140874
388 Ga0495627_045249 3300046453 Bacteria 1341
389 Ga0495638_0000123 3300046460 Bacteria 125420
390 Ga0495638_0018112 3300046460 Bacteria 4681
391 Ga0495651_0258507 3300046462 Bacteria 1186
392 Ga0495583_0000027 3300046506 Bacteria 256299
393 Ga0495583_0049273 3300046506 Bacteria 1930
394 Ga0495583_0053714 3300046506 Bacteria 1827
395 Ga0495643_0019082 3300046522 Bacteria 3970
396 Ga0495643_0040398 3300046522 Bacteria 2548
397 Ga0495648_0001235 3300046524 Bacteria 25568
398 Ga0495663_0004107 3300046525 Bacteria 4121
399 Ga0495587_0103931 3300046536 Bacteria 1635
400 Ga0495633_0070807 3300046558 Bacteria 1627
401 Ga0495668_0000013 3300046616 Bacteria 452938
402 Ga0495668_0000031 3300046616 Bacteria 256576
403 Ga0495625_0000351 3300046660 Bacteria 70408
404 Ga0495625_0000352 3300046660 Bacteria 70308
405 Ga0495625_0000842 3300046660 Bacteria 41902
406 Ga0495625_0004906 3300046660 Bacteria 12458
407 Ga0495657_0137951 3300046675 Bacteria 1522
408 Ga0495670_0000002 3300046691 Bacteria 601814
409 Ga0495670_0000005 3300046691 Bacteria 289725
410 Ga0495672_0017800 3300047320 Bacteria 4741
411 Ga0495672_0141557 3300047320 Bacteria 1256
412 Ga0495675_0104529 3300047444 Bacteria 1770
413 Ga0495677_0007618 3300047445 Bacteria 4040
414 Ga0495681_0036416 3300047470 Bacteria 2433
415 Ga0496101_0175749 3300048904 Bacteria 1647
416 Ga0496102_0100081 3300048905 Bacteria 2691
417 Ga0496102_0311198 3300048905 Bacteria 1484
418 Ga0496103_0028932 3300048906 Bacteria 3366
419 Ga0496105_0000016 3300048908 Bacteria 212909
420 Ga0496106_0048714 3300048909 Bacteria 3192
421 Ga0496108_0072223 3300048911 Bacteria 2913
422 Ga0496109_0084314 3300048912 Bacteria 2932
423 Ga0496113_0086252 3300048916 Bacteria 2412
424 Ga0496115_0000123 3300048918 Bacteria 70348
425 Ga0496115_0000127 3300048918 Bacteria 68926
426 Ga0496116_0000039 3300048919 Bacteria 349134
427 Ga0496117_0061865 3300048920 Bacteria 2570
428 Ga0496118_0005341 3300048921 Bacteria 14638
429 Ga0496118_0014069 3300048921 Bacteria 7511
430 Ga0496118_0027227 3300048921 Bacteria 4844
431 Ga0496118_0072201 3300048921 Bacteria 2480
432 Ga0496118_0136005 3300048921 Bacteria 1568
433 Ga0496121_0000147 3300048924 Bacteria 154342
434 Ga0496121_0000248 3300048924 Bacteria 114460
435 Ga0496122_0003069 3300048925 Bacteria 22525
436 Ga0496122_0035627 3300048925 Bacteria 4043
437 Ga0496123_0002020 3300048926 Bacteria 26197
438 Ga0496123_0007652 3300048926 Bacteria 10109
439 Ga0496124_0007676 3300048927 Bacteria 11412
440 Ga0496124_0096522 3300048927 Bacteria 2401
441 Ga0496125_0030423 3300048928 Bacteria 4831
442 Ga0496125_0063893 3300048928 Bacteria 2931
443 Ga0496125_0148461 3300048928 Bacteria 1615
444 Ga0496126_0000185 3300048929 Bacteria 140051
445 Ga0496126_0001292 3300048929 Bacteria 40032
446 Ga0496126_0166137 3300048929 Bacteria 1883
447 Ga0501032_0002816 3300049569 Bacteria 13525
448 Ga0501032_0010024 3300049569 Bacteria 6840
449 Ga0501033_0000329 3300049570 Bacteria 45324
450 Ga0501033_0023149 3300049570 Bacteria 4684
451 Ga0501034_0014426 3300049571 Bacteria 8136
452 Ga0501036_0014176 3300049572 Bacteria 6631
453 Ga0501037_0000815 3300049573 Bacteria 23310
454 Ga0501038_0003503 3300049574 Bacteria 14613
455 Ga0501038_0023794 3300049574 Bacteria 5472
456 Ga0501038_0047155 3300049574 Bacteria 3733
457 Ga0501039_0007089 3300049575 Bacteria 8538
458 Ga0501039_0069538 3300049575 Bacteria 2734
459 Ga0501041_0003593 3300049577 Bacteria 8922
460 Ga0501043_0004404 3300049579 Bacteria 11439
461 Ga0501043_0233302 3300049579 Bacteria 1421
462 Ga0501046_0069803 3300049580 Bacteria 2733
463 Ga0501047_0003926 3300049581 Bacteria 13971
464 Ga0501047_0018202 3300049581 Bacteria 6732
465 Ga0501067_0005300 3300049583 Bacteria 7163
466 Ga0501067_0047450 3300049583 Bacteria 2382
467 Ga0501068_0002075 3300049584 Bacteria 10681
468 Ga0501068_0028273 3300049584 Bacteria 3315
469 Ga0501069_0004652 3300049585 Bacteria 7093
470 Ga0501069_0098246 3300049585 Bacteria 1660
471 Ga0501071_0014415 3300049587 Bacteria 5407
472 Ga0501071_0020499 3300049587 Bacteria 4595
473 Ga0501072_0058773 3300049588 Bacteria 3030
474 Ga0501072_0094477 3300049588 Bacteria 2376
475 Ga0501073_0005069 3300049589 Bacteria 9879
476 Ga0501073_0006164 3300049589 Bacteria 8950
477 Ga0501074_0004513 3300049590 Bacteria 9965
478 Ga0501074_0012183 3300049590 Bacteria 6251
479 Ga0501074_0096077 3300049590 Bacteria 2122
480 Ga0501075_0002474 3300049591 Bacteria 12320
481 Ga0501076_0004871 3300049592 Bacteria 9594
482 Ga0501079_0014213 3300049741 Bacteria 6070
483 Ga0501079_0047389 3300049741 Bacteria 3316
484 Ga0501079_0075386 3300049741 Bacteria 2608
485 Ga0501080_0010166 3300049742 Bacteria 8604
486 Ga0501080_0040536 3300049742 Bacteria 4343
487 Ga0501080_0054204 3300049742 Bacteria 3734
488 Ga0501080_0069603 3300049742 Bacteria 3273
489 Ga0501080_0148241 3300049742 Bacteria 2169
490 Ga0501081_0009626 3300049743 Bacteria 6298
491 Ga0501083_0067366 3300049744 Bacteria 2383
492 Ga0501083_0074497 3300049744 Bacteria 2255
493 Ga0501035_0156314 3300049822 Bacteria 1976
494 Ga0501044_0016877 3300049823 Bacteria 7834
495 Ga0501044_0034372 3300049823 Bacteria 5316
496 Ga0501044_0131375 3300049823 Bacteria 2498
497 Ga0501044_0186366 3300049823 Bacteria 2039
498 Ga0501045_0048418 3300049824 Bacteria 3099
499 Ga0501045_0061914 3300049824 Bacteria 2746
500 Ga0501045_0086356 3300049824 Bacteria 2316
501 nmdc:mga05p37_1249_c1 3300050507 Bacteria 29520
502 nmdc:mga05p37_216945_c1 3300050507 Bacteria 2310
503 nmdc:mga05p37_72423_c1 3300050507 Bacteria 4240
504 nmdc:mga05p37_99156_c1 3300050507 Bacteria 3589
505 nmdc:mga09592_131875_c1 3300050508 Bacteria 2151
506 nmdc:mga09592_15383_c1 3300050508 Bacteria 6249
507 nmdc:mga09592_248690_c1 3300050508 Bacteria 1541
508 nmdc:mga09592_619_c1 3300050508 Bacteria 27079
509 nmdc:mga0qj67_2796_c1 3300050509 Bacteria 12520
510 nmdc:mga0qj67_444_c1 3300050509 Bacteria 28230
511 nmdc:mga06r32_155459_c1 3300050510 Bacteria 2268
512 nmdc:mga06r32_1942_c1 3300050510 Bacteria 18424
513 nmdc:mga06r32_233042_c1 3300050510 Bacteria 1829
514 nmdc:mga06r32_450_c1 3300050510 Bacteria 34949
515 nmdc:mga06r32_63_c1 3300050510 Bacteria 68165
516 nmdc:mga08y16_254_c1 3300050511 Bacteria 48008
517 nmdc:mga08y16_261384_c1 3300050511 Bacteria 1787
518 nmdc:mga08y16_381084_c1 3300050511 Bacteria 1446
519 nmdc:mga08y16_55406_c1 3300050511 Bacteria 4143
520 nmdc:mga0n895_331619_c1 3300050512 Bacteria 1541
521 Ga0500643_001692 3300053087 Bacteria 12255
522 Ga0500643_013071 3300053087 Bacteria 2947
523 Ga0500566_0004070 3300053094 Bacteria 8705
524 Ga0500566_0021562 3300053094 Bacteria 3785
525 Ga0500641_0039552 3300053096 Bacteria 1901
526 Ga0500555_000034 3300053103 Bacteria 82796
527 Ga0500555_012142 3300053103 Bacteria 2477
528 Ga0500569_007134 3300053109 Unclassified 2494
529 Ga0500592_006066 3300053116 Bacteria 1924
530 Ga0500626_101768 3300053128 Bacteria 1251
531 Ga0500658_0001214 3300053134 Bacteria 10475
532 Ga0500658_0001253 3300053134 Bacteria 10292
533 Ga0500658_0050600 3300053134 Bacteria 1696
534 Ga0500658_0071297 3300053134 Bacteria 1467
535 Ga0500568_0000179 3300053139 Bacteria 55301
536 Ga0500568_0000884 3300053139 Bacteria 20977
537 Ga0500568_0003290 3300053139 Bacteria 9115
538 Ga0500568_0016680 3300053139 Bacteria 3257
539 Ga0500573_0000010 3300053140 Bacteria 210704
540 Ga0500588_0002054 3300053146 Bacteria 4008
541 Ga0500590_053889 3300053148 Bacteria 2038
542 Ga0500627_0000001 3300053158 Bacteria 251552
543 Ga0500627_0002161 3300053158 Bacteria 5724
544 Ga0501084_0005608 3300054114 Bacteria 10307
545 Ga0501084_0062233 3300054114 Bacteria 3124
546 Ga0501084_0125449 3300054114 Bacteria 2160
547 Ga0501082_0002143 3300060353 Bacteria 17305
548 Ga0501082_0002981 3300060353 Bacteria 14786
549 Ga0501082_0177121 3300060353 Bacteria 1854
550 Ga0530510_0069565 3300061734 Bacteria 2554

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045049 Ga0466959_0018673 Ga0466959_0018673_598_1608 312
2 3300048912 Ga0496109_0084314 Ga0496109_0084314_245_1261 314
3 3300013308 Ga0157375_10137437 Ga0157375_101374372 315
4 3300005616 Ga0068852_100290638 Ga0068852_1002906382 316
5 3300005841 Ga0068863_100030711 Ga0068863_1000307112 316
6 3300006237 Ga0097621_100024669 Ga0097621_1000246692 316
7 3300006358 Ga0068871_100051777 Ga0068871_1000517772 316
8 3300014969 Ga0157376_10033821 Ga0157376_100338213 316
9 3300025931 Ga0207644_10078015 Ga0207644_100780152 316
10 3300026088 Ga0207641_10025983 Ga0207641_100259832 316
11 3300026121 Ga0207683_10161832 Ga0207683_101618322 316
12 3300048904 Ga0496101_0175749 Ga0496101_0175749_389_1429 316
13 3300048919 Ga0496116_0000039 Ga0496116_0000039_29249_30289 316
14 3300048920 Ga0496117_0061865 Ga0496117_0061865_1360_2400 316
15 3300048921 Ga0496118_0136005 Ga0496118_0136005_170_1210 316
16 3300048925 Ga0496122_0003069 Ga0496122_0003069_13150_14190 316
17 3300048926 Ga0496123_0002020 Ga0496123_0002020_8336_9376 316
18 3300048929 Ga0496126_0001292 Ga0496126_0001292_13647_14687 316
19 3300053134 Ga0500658_0071297 Ga0500658_0071297_148_1122 316
20 3300048927 Ga0496124_0007676 Ga0496124_0007676_9735_10775 317
21 3300048928 Ga0496125_0030423 Ga0496125_0030423_601_1641 317
22 3300049580 Ga0501046_0069803 Ga0501046_0069803_55_1095 320
23 3300049742 Ga0501080_0069603 Ga0501080_0069603_1347_2387 320
24 3300049823 Ga0501044_0131375 Ga0501044_0131375_1222_2262 320
25 3300054114 Ga0501084_0062233 Ga0501084_0062233_968_2008 320
26 3300060353 Ga0501082_0002143 Ga0501082_0002143_13975_15015 320
27 3300028379 Ga0268266_10158720 Ga0268266_101587202 322
28 3300049741 Ga0501079_0047389 Ga0501079_0047389_1779_2843 322
29 3300060353 Ga0501082_0177121 Ga0501082_0177121_26_1090 322
30 3300025942 Ga0207689_10321950 Ga0207689_103219502 325
31 3300028036 Ga0265355_1003744 Ga0265355_10037441 325
32 3300048906 Ga0496103_0028932 Ga0496103_0028932_2139_3194 326
33 3300048921 Ga0496118_0027227 Ga0496118_0027227_979_2034 326
34 3300053139 Ga0500568_0000179 Ga0500568_0000179_1316_2332 326
35 3300028017 Ga0265356_1002953 Ga0265356_10029532 327
36 3300030878 Ga0265770_1011066 Ga0265770_10110662 327
37 3300031090 Ga0265760_10000405 Ga0265760_100004058 327
38 3300053116 Ga0500592_006066 Ga0500592_006066_14_997 327
39 3300053158 Ga0500627_0000001 Ga0500627_0000001_199609_200649 327
40 3300053139 Ga0500568_0016680 Ga0500568_0016680_1617_2666 328
41 iso_pu_bacteria 2643221622 2644128922 329
42 3300031901 Ga0307406_10104578 Ga0307406_101045782 330
43 3300032004 Ga0307414_10022597 Ga0307414_100225973 330
44 3300049570 Ga0501033_0023149 Ga0501033_0023149_319_1374 331
45 3300049575 Ga0501039_0069538 Ga0501039_0069538_1463_2518 331
46 3300049822 Ga0501035_0156314 Ga0501035_0156314_391_1446 331
47 3300049823 Ga0501044_0186366 Ga0501044_0186366_389_1444 331
48 3300049824 Ga0501045_0061914 Ga0501045_0061914_1321_2376 331
49 3300053134 Ga0500658_0001214 Ga0500658_0001214_2564_3565 333
50 3300025906 Ga0207699_10077829 Ga0207699_100778292 334
51 3300031824 Ga0307413_10336716 Ga0307413_103367161 334
52 3300048929 Ga0496126_0166137 Ga0496126_0166137_56_1111 334
53 3300003781 Ga0055536_1001466 Ga0055536_10014668 335
54 3300003781 Ga0055536_1015188 Ga0055536_10151882 335
55 3300003791 Ga0055530_10023840 Ga0055530_100238402 335
56 3300005341 Ga0070691_10109888 Ga0070691_101098882 335
57 3300005347 Ga0070668_100045018 Ga0070668_1000450183 335
58 3300005353 Ga0070669_100013818 Ga0070669_1000138182 335
59 3300005457 Ga0070662_100004914 Ga0070662_1000049143 335
60 3300005458 Ga0070681_10177753 Ga0070681_101777532 335
61 3300005719 Ga0068861_100000366 Ga0068861_1000003663 335
62 3300005840 Ga0068870_10018123 Ga0068870_100181232 335
63 3300005844 Ga0068862_100000722 Ga0068862_10000072234 335
64 3300006844 Ga0075428_100000920 Ga0075428_1000009208 335
65 3300006844 Ga0075428_100282823 Ga0075428_1002828232 335
66 3300006846 Ga0075430_100004783 Ga0075430_1000047832 335
67 3300006846 Ga0075430_100060288 Ga0075430_1000602883 335
68 3300006846 Ga0075430_100141229 Ga0075430_1001412292 335
69 3300006847 Ga0075431_100000221 Ga0075431_1000002213 335
70 3300006847 Ga0075431_100000267 Ga0075431_10000026731 335
71 3300009094 Ga0111539_10000989 Ga0111539_1000098933 335
72 3300009094 Ga0111539_10007571 Ga0111539_100075719 335
73 3300009094 Ga0111539_10401226 Ga0111539_104012262 335
74 3300009098 Ga0105245_10153917 Ga0105245_101539172 335
75 3300009147 Ga0114129_10079198 Ga0114129_100791982 335
76 3300009545 Ga0105237_10073498 Ga0105237_100734982 335
77 3300009551 Ga0105238_10144200 Ga0105238_101442003 335
78 3300009553 Ga0105249_10001944 Ga0105249_100019442 335
79 3300013306 Ga0163162_10369090 Ga0163162_103690902 335
80 3300025912 Ga0207707_10160951 Ga0207707_101609512 335
81 3300025914 Ga0207671_10102256 Ga0207671_101022562 335
82 3300025923 Ga0207681_10004757 Ga0207681_100047572 335
83 3300025932 Ga0207690_10121698 Ga0207690_101216982 335
84 3300025933 Ga0207706_10004158 Ga0207706_100041583 335
85 3300025935 Ga0207709_10070099 Ga0207709_100700992 335
86 3300025972 Ga0207668_10241018 Ga0207668_102410182 335
87 3300026116 Ga0207674_10127050 Ga0207674_101270502 335
88 3300026118 Ga0207675_100000736 Ga0207675_1000007368 335
89 3300027907 Ga0207428_10002156 Ga0207428_1000215616 335
90 3300027907 Ga0207428_10018186 Ga0207428_100181861 335
91 3300028380 Ga0268265_10000547 Ga0268265_1000054734 335
92 3300031507 Ga0307509_10000003 Ga0307509_10000003418 335
93 3300031548 Ga0307408_100021968 Ga0307408_1000219683 335
94 3300031548 Ga0307408_100051994 Ga0307408_1000519942 335
95 3300031901 Ga0307406_10121945 Ga0307406_101219452 335
96 3300032002 Ga0307416_100041648 Ga0307416_1000416483 335
97 3300032126 Ga0307415_100130236 Ga0307415_1001302362 335
98 3300049588 Ga0501072_0094477 Ga0501072_0094477_1299_2318 335
99 3300050507 nmdc:mga05p37_72423_c1 nmdc:mga05p37_72423_c1_2578_3594 335
100 3300050507 nmdc:mga05p37_99156_c1 nmdc:mga05p37_99156_c1_949_1956 335
101 3300050508 nmdc:mga09592_131875_c1 nmdc:mga09592_131875_c1_448_1464 335
102 3300050508 nmdc:mga09592_15383_c1 nmdc:mga09592_15383_c1_503_1519 335
103 3300050509 nmdc:mga0qj67_2796_c1 nmdc:mga0qj67_2796_c1_11253_12272 335
104 3300050510 nmdc:mga06r32_1942_c1 nmdc:mga06r32_1942_c1_10269_11288 335
105 3300050510 nmdc:mga06r32_63_c1 nmdc:mga06r32_63_c1_26589_27605 335
106 3300050511 nmdc:mga08y16_254_c1 nmdc:mga08y16_254_c1_21719_22735 335
107 3300050511 nmdc:mga08y16_55406_c1 nmdc:mga08y16_55406_c1_2372_3391 335
108 3300005367 Ga0070667_100165132 Ga0070667_1001651322 336
109 3300005367 Ga0070667_100235003 Ga0070667_1002350032 336
110 3300005548 Ga0070665_100004102 Ga0070665_1000041028 336
111 3300005548 Ga0070665_100008614 Ga0070665_1000086142 336
112 3300005548 Ga0070665_100030126 Ga0070665_1000301262 336
113 3300005844 Ga0068862_100276589 Ga0068862_1002765892 336
114 3300009093 Ga0105240_10010664 Ga0105240_1001066410 336
115 3300025913 Ga0207695_10206882 Ga0207695_102068822 336
116 3300025924 Ga0207694_10148020 Ga0207694_101480202 336
117 3300025961 Ga0207712_10062960 Ga0207712_100629602 336
118 3300025972 Ga0207668_10301709 Ga0207668_103017091 336
119 3300025986 Ga0207658_10138969 Ga0207658_101389692 336
120 3300028379 Ga0268266_10000796 Ga0268266_100007967 336
121 3300028379 Ga0268266_10000890 Ga0268266_1000089028 336
122 3300028380 Ga0268265_10045506 Ga0268265_100455062 336
123 3300031507 Ga0307509_10000021 Ga0307509_10000021191 336
124 3300033180 Ga0307510_10000002 Ga0307510_1000000298 336
125 3300002774 JGI25150J39212_1000044 JGI25150J39212_100004431 337
126 3300003203 JGI25406J46586_10003744 JGI25406J46586_100037445 337
127 3300003215 JGI25153J46596_10000043 JGI25153J46596_1000004340 337
128 3300003771 Ga0055526_1005425 Ga0055526_10054253 337
129 3300003773 Ga0055537_1001605 Ga0055537_10016056 337
130 3300003791 Ga0055530_10021805 Ga0055530_100218051 337
131 3300003791 Ga0055530_10041273 Ga0055530_100412731 337
132 3300003792 Ga0055540_1006239 Ga0055540_10062391 337
133 3300003794 Ga0055531_10024604 Ga0055531_100246042 337
134 3300003794 Ga0055531_10024606 Ga0055531_100246062 337
135 3300005262 Ga0065165_1007814 Ga0065165_10078142 337
136 3300005330 Ga0070690_100052877 Ga0070690_1000528772 337
137 3300005331 Ga0070670_100148246 Ga0070670_1001482462 337
138 3300005331 Ga0070670_100279037 Ga0070670_1002790372 337
139 3300005335 Ga0070666_10001021 Ga0070666_1000102111 337
140 3300005337 Ga0070682_100063474 Ga0070682_1000634742 337
141 3300005338 Ga0068868_100038055 Ga0068868_1000380552 337
142 3300005340 Ga0070689_100005710 Ga0070689_1000057102 337
143 3300005343 Ga0070687_100020844 Ga0070687_1000208442 337
144 3300005344 Ga0070661_100006044 Ga0070661_1000060445 337
145 3300005344 Ga0070661_100087735 Ga0070661_1000877352 337
146 3300005344 Ga0070661_100111003 Ga0070661_1001110032 337
147 3300005353 Ga0070669_100144466 Ga0070669_1001444662 337
148 3300005354 Ga0070675_100198646 Ga0070675_1001986462 337
149 3300005354 Ga0070675_100288289 Ga0070675_1002882892 337
150 3300005367 Ga0070667_100099738 Ga0070667_1000997382 337
151 3300005440 Ga0070705_100020633 Ga0070705_1000206332 337
152 3300005441 Ga0070700_100020690 Ga0070700_1000206902 337
153 3300005456 Ga0070678_100110169 Ga0070678_1001101692 337
154 3300005457 Ga0070662_100002305 Ga0070662_1000023057 337
155 3300005457 Ga0070662_100070678 Ga0070662_1000706782 337
156 3300005458 Ga0070681_10003155 Ga0070681_1000315515 337
157 3300005459 Ga0068867_100368207 Ga0068867_1003682071 337
158 3300005466 Ga0070685_10000152 Ga0070685_1000015223 337
159 3300005466 Ga0070685_10001858 Ga0070685_100018583 337
160 3300005539 Ga0068853_100032342 Ga0068853_1000323423 337
161 3300005539 Ga0068853_100044493 Ga0068853_1000444932 337
162 3300005539 Ga0068853_100068560 Ga0068853_1000685602 337
163 3300005539 Ga0068853_100316742 Ga0068853_1003167422 337
164 3300005544 Ga0070686_100002514 Ga0070686_1000025146 337
165 3300005548 Ga0070665_100000928 Ga0070665_1000009287 337
166 3300005548 Ga0070665_100007710 Ga0070665_1000077105 337
167 3300005548 Ga0070665_100009713 Ga0070665_1000097132 337
168 3300005548 Ga0070665_100104488 Ga0070665_1001044882 337
169 3300005563 Ga0068855_100069899 Ga0068855_1000698992 337
170 3300005578 Ga0068854_100006701 Ga0068854_1000067012 337
171 3300005615 Ga0070702_100021737 Ga0070702_1000217372 337
172 3300005617 Ga0068859_100002362 Ga0068859_1000023622 337
173 3300005618 Ga0068864_100029869 Ga0068864_1000298692 337
174 3300005718 Ga0068866_10146072 Ga0068866_101460722 337
175 3300005719 Ga0068861_100000062 Ga0068861_10000006229 337
176 3300005834 Ga0068851_10007007 Ga0068851_100070072 337
177 3300005841 Ga0068863_100246254 Ga0068863_1002462542 337
178 3300005842 Ga0068858_100002262 Ga0068858_1000022622 337
179 3300005843 Ga0068860_100006757 Ga0068860_1000067575 337
180 3300005985 Ga0081539_10000004 Ga0081539_10000004119 337
181 3300006237 Ga0097621_100019694 Ga0097621_1000196942 337
182 3300006237 Ga0097621_100137657 Ga0097621_1001376571 337
183 3300006846 Ga0075430_100008166 Ga0075430_1000081665 337
184 3300006847 Ga0075431_100003861 Ga0075431_1000038614 337
185 3300006871 Ga0075434_100213628 Ga0075434_1002136282 337
186 3300006880 Ga0075429_100003103 Ga0075429_1000031033 337
187 3300006881 Ga0068865_100023649 Ga0068865_1000236492 337
188 3300006931 Ga0097620_100002362 Ga0097620_1000023622 337
189 3300009093 Ga0105240_10016387 Ga0105240_100163879 337
190 3300009094 Ga0111539_10025836 Ga0111539_100258362 337
191 3300009094 Ga0111539_10127795 Ga0111539_101277952 337
192 3300009098 Ga0105245_10078920 Ga0105245_100789202 337
193 3300009101 Ga0105247_10059784 Ga0105247_100597842 337
194 3300009147 Ga0114129_10003655 Ga0114129_100036554 337
195 3300009147 Ga0114129_10247926 Ga0114129_102479262 337
196 3300009177 Ga0105248_10037039 Ga0105248_100370392 337
197 3300009545 Ga0105237_10037935 Ga0105237_100379352 337
198 3300009545 Ga0105237_10291681 Ga0105237_102916811 337
199 3300009551 Ga0105238_10004676 Ga0105238_100046766 337
200 3300009551 Ga0105238_10025058 Ga0105238_100250582 337
201 3300009551 Ga0105238_10069026 Ga0105238_100690262 337
202 3300009551 Ga0105238_10179831 Ga0105238_101798312 337
203 3300009553 Ga0105249_10018875 Ga0105249_100188752 337
204 3300009553 Ga0105249_10029931 Ga0105249_100299312 337
205 3300009553 Ga0105249_10041664 Ga0105249_100416642 337
206 3300010375 Ga0105239_10029287 Ga0105239_100292872 337
207 3300013105 Ga0157369_10011583 Ga0157369_100115834 337
208 3300013306 Ga0163162_10000004 Ga0163162_10000004386 337
209 3300013306 Ga0163162_10298450 Ga0163162_102984502 337
210 3300013308 Ga0157375_10001172 Ga0157375_1000117213 337
211 3300013308 Ga0157375_10206807 Ga0157375_102068072 337
212 3300014325 Ga0163163_10004078 Ga0163163_100040784 337
213 3300014497 Ga0182008_10110260 Ga0182008_101102601 337
214 3300014745 Ga0157377_10003544 Ga0157377_100035446 337
215 3300014968 Ga0157379_10033075 Ga0157379_100330752 337
216 3300014968 Ga0157379_10179162 Ga0157379_101791622 337
217 3300014969 Ga0157376_10032388 Ga0157376_100323882 337
218 3300025245 Ga0207425_1000047 Ga0207425_1000047110 337
219 3300025258 Ga0209129_1000497 Ga0209129_10004972 337
220 3300025263 Ga0209565_1000089 Ga0209565_100008968 337
221 3300025292 Ga0209676_1004605 Ga0209676_10046052 337
222 3300025292 Ga0209676_1007388 Ga0209676_10073883 337
223 3300025294 Ga0209025_1000150 Ga0209025_100015040 337
224 3300025295 Ga0209564_1001696 Ga0209564_10016967 337
225 3300025297 Ga0209758_1000009 Ga0209758_1000009838 337
226 3300025298 Ga0209050_1000005 Ga0209050_1000005329 337
227 3300025298 Ga0209050_1008503 Ga0209050_10085033 337
228 3300025303 Ga0209051_1000396 Ga0209051_10003964 337
229 3300025303 Ga0209051_1004840 Ga0209051_10048406 337
230 3300025304 Ga0209257_1000337 Ga0209257_100033782 337
231 3300025304 Ga0209257_1001283 Ga0209257_100128319 337
232 3300025321 Ga0207656_10068433 Ga0207656_100684331 337
233 3300025321 Ga0207656_10090192 Ga0207656_100901922 337
234 3300025901 Ga0207688_10024861 Ga0207688_100248612 337
235 3300025903 Ga0207680_10098946 Ga0207680_100989462 337
236 3300025904 Ga0207647_10010944 Ga0207647_100109445 337
237 3300025911 Ga0207654_10165274 Ga0207654_101652741 337
238 3300025912 Ga0207707_10189494 Ga0207707_101894941 337
239 3300025913 Ga0207695_10000082 Ga0207695_1000008253 337
240 3300025913 Ga0207695_10019407 Ga0207695_100194072 337
241 3300025913 Ga0207695_10022352 Ga0207695_100223522 337
242 3300025913 Ga0207695_10180159 Ga0207695_101801592 337
243 3300025914 Ga0207671_10013633 Ga0207671_100136335 337
244 3300025914 Ga0207671_10180622 Ga0207671_101806221 337
245 3300025918 Ga0207662_10006576 Ga0207662_100065762 337
246 3300025920 Ga0207649_10092171 Ga0207649_100921711 337
247 3300025920 Ga0207649_10097669 Ga0207649_100976691 337
248 3300025924 Ga0207694_10000832 Ga0207694_100008325 337
249 3300025924 Ga0207694_10003663 Ga0207694_100036635 337
250 3300025924 Ga0207694_10009691 Ga0207694_100096916 337
251 3300025926 Ga0207659_10016381 Ga0207659_100163812 337
252 3300025927 Ga0207687_10207998 Ga0207687_102079982 337
253 3300025931 Ga0207644_10178680 Ga0207644_101786802 337
254 3300025933 Ga0207706_10001608 Ga0207706_100016086 337
255 3300025933 Ga0207706_10025788 Ga0207706_100257882 337
256 3300025933 Ga0207706_10097441 Ga0207706_100974412 337
257 3300025934 Ga0207686_10014243 Ga0207686_100142433 337
258 3300025936 Ga0207670_10030464 Ga0207670_100304642 337
259 3300025938 Ga0207704_10067079 Ga0207704_100670792 337
260 3300025940 Ga0207691_10164062 Ga0207691_101640622 337
261 3300025941 Ga0207711_10073099 Ga0207711_100730992 337
262 3300025942 Ga0207689_10014175 Ga0207689_100141752 337
263 3300025945 Ga0207679_10291434 Ga0207679_102914341 337
264 3300025949 Ga0207667_10447490 Ga0207667_104474901 337
265 3300025960 Ga0207651_10129805 Ga0207651_101298052 337
266 3300025960 Ga0207651_10137253 Ga0207651_101372531 337
267 3300025961 Ga0207712_10003759 Ga0207712_100037593 337
268 3300025972 Ga0207668_10010127 Ga0207668_100101274 337
269 3300025981 Ga0207640_10002942 Ga0207640_100029426 337
270 3300025986 Ga0207658_10062115 Ga0207658_100621152 337
271 3300026023 Ga0207677_10017144 Ga0207677_100171443 337
272 3300026023 Ga0207677_10054397 Ga0207677_100543972 337
273 3300026035 Ga0207703_10001706 Ga0207703_1000170614 337
274 3300026035 Ga0207703_10279642 Ga0207703_102796422 337
275 3300026041 Ga0207639_10000173 Ga0207639_1000017317 337
276 3300026041 Ga0207639_10047697 Ga0207639_100476971 337
277 3300026067 Ga0207678_10034501 Ga0207678_100345012 337
278 3300026075 Ga0207708_10022675 Ga0207708_100226752 337
279 3300026088 Ga0207641_10057654 Ga0207641_100576542 337
280 3300026089 Ga0207648_10025282 Ga0207648_100252825 337
281 3300026089 Ga0207648_10148662 Ga0207648_101486622 337
282 3300026095 Ga0207676_10070454 Ga0207676_100704542 337
283 3300026116 Ga0207674_10006655 Ga0207674_100066552 337
284 3300026116 Ga0207674_10015160 Ga0207674_100151602 337
285 3300026116 Ga0207674_10022806 Ga0207674_100228064 337
286 3300026116 Ga0207674_10084276 Ga0207674_100842761 337
287 3300026118 Ga0207675_100000614 Ga0207675_10000061429 337
288 3300026118 Ga0207675_100095114 Ga0207675_1000951142 337
289 3300026118 Ga0207675_100106504 Ga0207675_1001065042 337
290 3300026121 Ga0207683_10169408 Ga0207683_101694082 337
291 3300026142 Ga0207698_10055479 Ga0207698_100554792 337
292 3300027907 Ga0207428_10078567 Ga0207428_100785672 337
293 3300028379 Ga0268266_10000007 Ga0268266_10000007320 337
294 3300028379 Ga0268266_10001872 Ga0268266_100018727 337
295 3300028379 Ga0268266_10068644 Ga0268266_100686442 337
296 3300028379 Ga0268266_10187776 Ga0268266_101877762 337
297 3300028380 Ga0268265_10025331 Ga0268265_100253313 337
298 3300028381 Ga0268264_10000176 Ga0268264_1000017684 337
299 3300028381 Ga0268264_10004326 Ga0268264_100043267 337
300 3300031548 Ga0307408_100019644 Ga0307408_1000196442 337
301 3300031616 Ga0307508_10005849 Ga0307508_100058494 337
302 3300031824 Ga0307413_10183726 Ga0307413_101837262 337
303 3300031901 Ga0307406_10058025 Ga0307406_100580252 337
304 3300032002 Ga0307416_100007495 Ga0307416_1000074953 337
305 3300035089 Ga0373944_0032432 Ga0373944_0032432_50_1099 337
306 3300036401 Ga0373937_0281564 Ga0373937_0281564_346_1389 337
307 3300038705 Ga0237819_00302 Ga0237819_00302_12105_13145 337
308 3300039145 Ga0237816_00554 Ga0237816_00554_731_1771 337
309 3300042005 Ga0439448_0021987 Ga0439448_0021987_196_1236 337
310 3300045049 Ga0466959_0036457 Ga0466959_0036457_1844_2857 337
311 3300046453 Ga0495627_045249 Ga0495627_045249_67_1104 337
312 3300046691 Ga0495670_0000005 Ga0495670_0000005_94000_95037 337
313 3300047470 Ga0495681_0036416 Ga0495681_0036416_1262_2299 337
314 3300048905 Ga0496102_0100081 Ga0496102_0100081_224_1261 337
315 3300048905 Ga0496102_0311198 Ga0496102_0311198_88_1125 337
316 3300048908 Ga0496105_0000016 Ga0496105_0000016_108214_109287 337
317 3300048909 Ga0496106_0048714 Ga0496106_0048714_549_1595 337
318 3300048911 Ga0496108_0072223 Ga0496108_0072223_1647_2693 337
319 3300048916 Ga0496113_0086252 Ga0496113_0086252_121_1167 337
320 3300048918 Ga0496115_0000123 Ga0496115_0000123_55009_56046 337
321 3300048918 Ga0496115_0000127 Ga0496115_0000127_44681_45718 337
322 3300048921 Ga0496118_0014069 Ga0496118_0014069_4089_5126 337
323 3300048921 Ga0496118_0072201 Ga0496118_0072201_50_1084 337
324 3300048924 Ga0496121_0000147 Ga0496121_0000147_2741_3787 337
325 3300048928 Ga0496125_0063893 Ga0496125_0063893_1307_2350 337
326 3300048929 Ga0496126_0000185 Ga0496126_0000185_22841_23878 337
327 3300049569 Ga0501032_0002816 Ga0501032_0002816_3202_4242 337
328 3300049569 Ga0501032_0010024 Ga0501032_0010024_2339_3364 337
329 3300049570 Ga0501033_0000329 Ga0501033_0000329_36061_37101 337
330 3300049571 Ga0501034_0014426 Ga0501034_0014426_4818_5852 337
331 3300049572 Ga0501036_0014176 Ga0501036_0014176_2454_3494 337
332 3300049573 Ga0501037_0000815 Ga0501037_0000815_14047_15087 337
333 3300049574 Ga0501038_0003503 Ga0501038_0003503_8646_9686 337
334 3300049574 Ga0501038_0023794 Ga0501038_0023794_707_1741 337
335 3300049574 Ga0501038_0047155 Ga0501038_0047155_2024_3064 337
336 3300049575 Ga0501039_0007089 Ga0501039_0007089_4928_5968 337
337 3300049579 Ga0501043_0004404 Ga0501043_0004404_2863_3903 337
338 3300049581 Ga0501047_0003926 Ga0501047_0003926_4738_5772 337
339 3300049581 Ga0501047_0018202 Ga0501047_0018202_2536_3576 337
340 3300049583 Ga0501067_0005300 Ga0501067_0005300_2109_3143 337
341 3300049583 Ga0501067_0047450 Ga0501067_0047450_764_1804 337
342 3300049584 Ga0501068_0002075 Ga0501068_0002075_7459_8499 337
343 3300049584 Ga0501068_0028273 Ga0501068_0028273_838_1872 337
344 3300049585 Ga0501069_0004652 Ga0501069_0004652_5945_6970 337
345 3300049585 Ga0501069_0098246 Ga0501069_0098246_408_1448 337
346 3300049587 Ga0501071_0014415 Ga0501071_0014415_2092_3132 337
347 3300049589 Ga0501073_0005069 Ga0501073_0005069_4643_5677 337
348 3300049589 Ga0501073_0006164 Ga0501073_0006164_7003_8043 337
349 3300049590 Ga0501074_0004513 Ga0501074_0004513_3264_4298 337
350 3300049590 Ga0501074_0012183 Ga0501074_0012183_333_1373 337
351 3300049741 Ga0501079_0014213 Ga0501079_0014213_2535_3575 337
352 3300049742 Ga0501080_0010166 Ga0501080_0010166_6611_7645 337
353 3300049742 Ga0501080_0040536 Ga0501080_0040536_114_1154 337
354 3300049742 Ga0501080_0054204 Ga0501080_0054204_2120_3160 337
355 3300049744 Ga0501083_0067366 Ga0501083_0067366_504_1538 337
356 3300049823 Ga0501044_0016877 Ga0501044_0016877_2010_3044 337
357 3300049823 Ga0501044_0034372 Ga0501044_0034372_867_1907 337
358 3300049824 Ga0501045_0086356 Ga0501045_0086356_1071_2111 337
359 3300050507 nmdc:mga05p37_1249_c1 nmdc:mga05p37_1249_c1_4732_5778 337
360 3300050507 nmdc:mga05p37_216945_c1 nmdc:mga05p37_216945_c1_1059_2105 337
361 3300050508 nmdc:mga09592_248690_c1 nmdc:mga09592_248690_c1_440_1486 337
362 3300050508 nmdc:mga09592_619_c1 nmdc:mga09592_619_c1_8486_9532 337
363 3300050509 nmdc:mga0qj67_444_c1 nmdc:mga0qj67_444_c1_25506_26552 337
364 3300050510 nmdc:mga06r32_233042_c1 nmdc:mga06r32_233042_c1_580_1626 337
365 3300050510 nmdc:mga06r32_450_c1 nmdc:mga06r32_450_c1_27977_29023 337
366 3300050511 nmdc:mga08y16_261384_c1 nmdc:mga08y16_261384_c1_457_1497 337
367 3300050511 nmdc:mga08y16_381084_c1 nmdc:mga08y16_381084_c1_72_1118 337
368 3300050512 nmdc:mga0n895_331619_c1 nmdc:mga0n895_331619_c1_119_1165 337
369 3300053087 Ga0500643_013071 Ga0500643_013071_1509_2546 337
370 3300053096 Ga0500641_0039552 Ga0500641_0039552_250_1263 337
371 3300053103 Ga0500555_012142 Ga0500555_012142_1370_2407 337
372 3300053109 Ga0500569_007134 Ga0500569_007134_249_1262 337
373 3300053134 Ga0500658_0050600 Ga0500658_0050600_231_1268 337
374 3300054114 Ga0501084_0125449 Ga0501084_0125449_136_1170 337
375 iso_pu_bacteria 2512564014 2512642818 337
376 3300003781 Ga0055536_1000733 Ga0055536_10007339 338
377 3300003781 Ga0055536_1001202 Ga0055536_10012024 338
378 3300003781 Ga0055536_1001810 Ga0055536_10018106 338
379 3300003781 Ga0055536_1003951 Ga0055536_10039512 338
380 3300003781 Ga0055536_1007638 Ga0055536_10076384 338
381 3300003791 Ga0055530_10000106 Ga0055530_1000010617 338
382 3300003791 Ga0055530_10000164 Ga0055530_1000016412 338
383 3300003791 Ga0055530_10000181 Ga0055530_1000018140 338
384 3300003791 Ga0055530_10000465 Ga0055530_1000046516 338
385 3300003794 Ga0055531_10000012 Ga0055531_10000012119 338
386 3300003794 Ga0055531_10001005 Ga0055531_1000100516 338
387 3300003794 Ga0055531_10001314 Ga0055531_1000131411 338
388 3300003794 Ga0055531_10004289 Ga0055531_100042894 338
389 3300003794 Ga0055531_10004380 Ga0055531_100043803 338
390 3300003794 Ga0055531_10005744 Ga0055531_100057444 338
391 3300003794 Ga0055531_10006349 Ga0055531_100063493 338
392 3300005293 Ga0065715_10101304 Ga0065715_101013042 338
393 3300005340 Ga0070689_100143957 Ga0070689_1001439572 338
394 3300005435 Ga0070714_100230939 Ga0070714_1002309392 338
395 3300005456 Ga0070678_100006730 Ga0070678_1000067301 338
396 3300005459 Ga0068867_100016202 Ga0068867_1000162022 338
397 3300005539 Ga0068853_100028737 Ga0068853_1000287373 338
398 3300005548 Ga0070665_100105961 Ga0070665_1001059612 338
399 3300005614 Ga0068856_100015602 Ga0068856_1000156023 338
400 3300005841 Ga0068863_100084928 Ga0068863_1000849282 338
401 3300005842 Ga0068858_100049301 Ga0068858_1000493012 338
402 3300006028 Ga0070717_10282795 Ga0070717_102827952 338
403 3300006173 Ga0070716_100121766 Ga0070716_1001217662 338
404 3300006173 Ga0070716_100209304 Ga0070716_1002093042 338
405 3300006237 Ga0097621_100034130 Ga0097621_1000341302 338
406 3300006946 Ga0079104_1018097 Ga0079104_10180972 338
407 3300009093 Ga0105240_10067374 Ga0105240_100673744 338
408 3300009093 Ga0105240_10069692 Ga0105240_100696922 338
409 3300009176 Ga0105242_10016940 Ga0105242_100169403 338
410 3300009551 Ga0105238_10085639 Ga0105238_100856392 338
411 3300009551 Ga0105238_10567708 Ga0105238_105677081 338
412 3300013306 Ga0163162_10023244 Ga0163162_100232443 338
413 3300013307 Ga0157372_10529003 Ga0157372_105290032 338
414 3300013308 Ga0157375_10030306 Ga0157375_100303062 338
415 3300014326 Ga0157380_10053565 Ga0157380_100535653 338
416 3300014968 Ga0157379_10100880 Ga0157379_101008802 338
417 3300025291 Ga0209675_1000183 Ga0209675_10001832 338
418 3300025291 Ga0209675_1000202 Ga0209675_100020240 338
419 3300025291 Ga0209675_1000384 Ga0209675_100038416 338
420 3300025292 Ga0209676_1000155 Ga0209676_100015569 338
421 3300025292 Ga0209676_1000234 Ga0209676_100023410 338
422 3300025292 Ga0209676_1000234 Ga0209676_100023469 338
423 3300025292 Ga0209676_1000384 Ga0209676_100038434 338
424 3300025292 Ga0209676_1000475 Ga0209676_100047529 338
425 3300025292 Ga0209676_1000693 Ga0209676_100069335 338
426 3300025292 Ga0209676_1004674 Ga0209676_10046743 338
427 3300025294 Ga0209025_1007902 Ga0209025_10079022 338
428 3300025294 Ga0209025_1020691 Ga0209025_10206912 338
429 3300025297 Ga0209758_1023933 Ga0209758_10239332 338
430 3300025298 Ga0209050_1000039 Ga0209050_1000039319 338
431 3300025298 Ga0209050_1000112 Ga0209050_100011220 338
432 3300025298 Ga0209050_1000132 Ga0209050_1000132110 338
433 3300025298 Ga0209050_1000132 Ga0209050_100013241 338
434 3300025298 Ga0209050_1000776 Ga0209050_100077633 338
435 3300025298 Ga0209050_1007994 Ga0209050_10079943 338
436 3300025298 Ga0209050_1015174 Ga0209050_10151742 338
437 3300025298 Ga0209050_1032064 Ga0209050_10320642 338
438 3300025304 Ga0209257_1000051 Ga0209257_1000051319 338
439 3300025304 Ga0209257_1000176 Ga0209257_100017634 338
440 3300025304 Ga0209257_1000176 Ga0209257_100017692 338
441 3300025304 Ga0209257_1000523 Ga0209257_100052312 338
442 3300025304 Ga0209257_1000600 Ga0209257_100060042 338
443 3300025304 Ga0209257_1001567 Ga0209257_100156715 338
444 3300025304 Ga0209257_1001840 Ga0209257_10018406 338
445 3300025304 Ga0209257_1015830 Ga0209257_10158302 338
446 3300025913 Ga0207695_10041929 Ga0207695_100419292 338
447 3300025934 Ga0207686_10209828 Ga0207686_102098282 338
448 3300025936 Ga0207670_10266101 Ga0207670_102661011 338
449 3300025938 Ga0207704_10012534 Ga0207704_100125342 338
450 3300025940 Ga0207691_10057179 Ga0207691_100571792 338
451 3300026035 Ga0207703_10139793 Ga0207703_101397932 338
452 3300026067 Ga0207678_10040586 Ga0207678_100405862 338
453 3300026088 Ga0207641_10191196 Ga0207641_101911962 338
454 3300026089 Ga0207648_10019230 Ga0207648_100192303 338
455 3300026095 Ga0207676_10111641 Ga0207676_101116412 338
456 3300026118 Ga0207675_100162179 Ga0207675_1001621792 338
457 3300028794 Ga0307515_10270587 Ga0307515_102705872 338
458 3300031731 Ga0307405_10005713 Ga0307405_100057133 338
459 3300031911 Ga0307412_10041499 Ga0307412_100414992 338
460 3300032004 Ga0307414_10000242 Ga0307414_1000024222 338
461 3300032004 Ga0307414_10280657 Ga0307414_102806572 338
462 3300032005 Ga0307411_10140496 Ga0307411_101404962 338
463 3300035119 Ga0373956_0040630 Ga0373956_0040630_830_1882 338
464 3300036401 Ga0373937_0017549 Ga0373937_0017549_2271_3323 338
465 3300036401 Ga0373937_0295818 Ga0373937_0295818_468_1514 338
466 3300039438 Ga0436360_1257731 Ga0436360_1257731_260_1345 338
467 3300045051 Ga0451576_0606388 Ga0451576_0606388_36_1082 338
468 3300046453 Ga0495627_000060 Ga0495627_000060_18248_19300 338
469 3300046460 Ga0495638_0000123 Ga0495638_0000123_61783_62823 338
470 3300046462 Ga0495651_0258507 Ga0495651_0258507_50_1102 338
471 3300046506 Ga0495583_0053714 Ga0495583_0053714_86_1123 338
472 3300046522 Ga0495643_0040398 Ga0495643_0040398_433_1473 338
473 3300046524 Ga0495648_0001235 Ga0495648_0001235_24375_25427 338
474 3300046525 Ga0495663_0004107 Ga0495663_0004107_723_1763 338
475 3300046536 Ga0495587_0103931 Ga0495587_0103931_283_1335 338
476 3300046558 Ga0495633_0070807 Ga0495633_0070807_329_1381 338
477 3300046616 Ga0495668_0000031 Ga0495668_0000031_241258_242298 338
478 3300046660 Ga0495625_0000351 Ga0495625_0000351_43921_44961 338
479 3300046660 Ga0495625_0000352 Ga0495625_0000352_5469_6509 338
480 3300046660 Ga0495625_0000842 Ga0495625_0000842_29210_30256 338
481 3300046660 Ga0495625_0004906 Ga0495625_0004906_10488_11525 338
482 3300046675 Ga0495657_0137951 Ga0495657_0137951_74_1126 338
483 3300046691 Ga0495670_0000002 Ga0495670_0000002_430277_431365 338
484 3300047320 Ga0495672_0017800 Ga0495672_0017800_2551_3630 338
485 3300047320 Ga0495672_0141557 Ga0495672_0141557_121_1173 338
486 3300047444 Ga0495675_0104529 Ga0495675_0104529_654_1706 338
487 3300047445 Ga0495677_0007618 Ga0495677_0007618_560_1597 338
488 3300048921 Ga0496118_0005341 Ga0496118_0005341_12029_13102 338
489 3300048924 Ga0496121_0000248 Ga0496121_0000248_109438_110511 338
490 3300048925 Ga0496122_0035627 Ga0496122_0035627_1509_2552 338
491 3300048926 Ga0496123_0007652 Ga0496123_0007652_4547_5590 338
492 3300048927 Ga0496124_0096522 Ga0496124_0096522_831_1874 338
493 3300048928 Ga0496125_0148461 Ga0496125_0148461_142_1188 338
494 3300050510 nmdc:mga06r32_155459_c1 nmdc:mga06r32_155459_c1_218_1267 338
495 3300053087 Ga0500643_001692 Ga0500643_001692_556_1593 338
496 3300053094 Ga0500566_0021562 Ga0500566_0021562_981_2021 338
497 3300053128 Ga0500626_101768 Ga0500626_101768_80_1120 338
498 3300053134 Ga0500658_0001253 Ga0500658_0001253_9109_10149 338
499 3300053139 Ga0500568_0000884 Ga0500568_0000884_4818_5858 338
500 3300053139 Ga0500568_0003290 Ga0500568_0003290_1473_2531 338
501 3300053140 Ga0500573_0000010 Ga0500573_0000010_74619_75680 338
502 3300053148 Ga0500590_053889 Ga0500590_053889_459_1475 338
503 3300053158 Ga0500627_0002161 Ga0500627_0002161_4040_5092 338
504 iso_pu_bacteria 2643221563 2643832733 338
505 iso_pu_bacteria 2643221563 2643835254 338
506 iso_pu_bacteria 2643221563 2643836496 338
507 iso_pu_bacteria 2643221605 2644038602 338
508 iso_pu_bacteria 2643221608 2644052973 338
509 iso_pu_bacteria 2643221608 2644053472 338
510 iso_pu_bacteria 2643221608 2644056180 338
511 iso_pu_bacteria 2852653556 2852654768 338
512 iso_pu_bacteria 2852680915 2852683938 338
513 iso_pu_bacteria 2882806704 2882808734 338
514 3300005329 Ga0070683_100221658 Ga0070683_1002216582 339
515 3300005535 Ga0070684_100008538 Ga0070684_1000085387 339
516 3300005564 Ga0070664_100220201 Ga0070664_1002202012 339
517 3300005843 Ga0068860_100448429 Ga0068860_1004484291 339
518 3300009093 Ga0105240_10175389 Ga0105240_101753892 339
519 3300009545 Ga0105237_10005186 Ga0105237_100051869 339
520 3300025294 Ga0209025_1054244 Ga0209025_10542442 339
521 3300025304 Ga0209257_1004585 Ga0209257_10045852 339
522 3300025913 Ga0207695_10039411 Ga0207695_100394112 339
523 3300046460 Ga0495638_0018112 Ga0495638_0018112_2101_3150 339
524 3300046506 Ga0495583_0000027 Ga0495583_0000027_106012_107061 339
525 3300049577 Ga0501041_0003593 Ga0501041_0003593_6209_7273 339
526 3300049579 Ga0501043_0233302 Ga0501043_0233302_245_1309 339
527 3300049587 Ga0501071_0020499 Ga0501071_0020499_583_1647 339
528 3300049588 Ga0501072_0058773 Ga0501072_0058773_1065_2129 339
529 3300049590 Ga0501074_0096077 Ga0501074_0096077_740_1804 339
530 3300049591 Ga0501075_0002474 Ga0501075_0002474_9631_10695 339
531 3300049592 Ga0501076_0004871 Ga0501076_0004871_6540_7604 339
532 3300049741 Ga0501079_0075386 Ga0501079_0075386_618_1682 339
533 3300049742 Ga0501080_0148241 Ga0501080_0148241_210_1274 339
534 3300049743 Ga0501081_0009626 Ga0501081_0009626_2762_3826 339
535 3300049744 Ga0501083_0074497 Ga0501083_0074497_489_1553 339
536 3300049824 Ga0501045_0048418 Ga0501045_0048418_832_1896 339
537 3300053103 Ga0500555_000034 Ga0500555_000034_74217_75266 339
538 3300053146 Ga0500588_0002054 Ga0500588_0002054_214_1275 339
539 3300054114 Ga0501084_0005608 Ga0501084_0005608_6644_7708 339
540 3300060353 Ga0501082_0002981 Ga0501082_0002981_5357_6421 339
541 3300061734 Ga0530510_0069565 Ga0530510_0069565_816_1880 339
542 iso_pu_bacteria 2643221560 2643822570 339
543 iso_pu_bacteria 8057101203 8057104913 339
544 3300037471 Ga0395905_0022952 Ga0395905_0022952_315_1436 340
545 3300038443 Ga0395901_0119300 Ga0395901_0119300_1340_2497 340
546 3300053094 Ga0500566_0004070 Ga0500566_0004070_6898_7965 340
547 3300001979 JGI24740J21852_10000019 JGI24740J21852_1000001932 341
548 3300001989 JGI24739J22299_10006255 JGI24739J22299_100062552 341
549 3300005455 Ga0070663_100000022 Ga0070663_10000002231 341
550 3300005457 Ga0070662_100002608 Ga0070662_1000026083 341
551 3300005577 Ga0068857_100022630 Ga0068857_1000226302 341
552 3300005614 Ga0068856_100000041 Ga0068856_10000004131 341
553 3300009545 Ga0105237_10109291 Ga0105237_101092912 341
554 3300009551 Ga0105238_10000192 Ga0105238_1000019220 341
555 3300013100 Ga0157373_10000046 Ga0157373_1000004669 341
556 3300013104 Ga0157370_10000071 Ga0157370_1000007169 341
557 3300017792 Ga0163161_10064637 Ga0163161_100646372 341
558 3300025909 Ga0207705_10040583 Ga0207705_100405833 341
559 3300025911 Ga0207654_10000032 Ga0207654_1000003280 341
560 3300025924 Ga0207694_10000812 Ga0207694_1000081222 341
561 3300025933 Ga0207706_10004347 Ga0207706_100043475 341
562 3300026067 Ga0207678_10000038 Ga0207678_1000003821 341
563 3300026078 Ga0207702_10000061 Ga0207702_1000006134 341
564 3300026116 Ga0207674_10013363 Ga0207674_100133638 341
565 3300046506 Ga0495583_0049273 Ga0495583_0049273_479_1549 341
566 3300046522 Ga0495643_0019082 Ga0495643_0019082_1752_2822 341
567 3300046616 Ga0495668_0000013 Ga0495668_0000013_139492_140562 341

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07755

DUF1611

Domain of unknown function (DUF1611_C) P-loop domain

179

379

0.97

PF17396

DUF1611_N

Domain of unknown function (DUF1611_N) Rossmann-like domain

81

174

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7xrj-assembly1.cif.gz_A crystal structure of n-acetyltransferase dgcn-25328 0.9588 11 341
7xrj-assembly1.cif.gz_A crystal structure of n-acetyltransferase dgcn-25328 0.9504 11 341
2obn-assembly1.cif.gz_B crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution 0.839 12 339
2obn-assembly1.cif.gz_A crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution 0.8213 12 339
2obn-assembly2.cif.gz_C crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution 0.8157 11 339
ID Description Score Start End Superfamily
2obnD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.906 132 341 3.40.50.300
2obnD02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.8977 132 341 3.40.50.300
2g0tB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.824 136 338 3.40.50.300
2g0tB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.812 136 338 3.40.50.300
af_Q4DA36_188_506_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.7659 145 179 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A258BV82-F1-model_v4 EBNA-1 nuclear protein 0.9935 206 341
AF-A0A4V2BKK6-F1-model_v4 DUF1611 domain-containing protein 0.9917 118 341
AF-A0A1H1BVK5-F1-model_v4 Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase family 0.9912 7 341
AF-A0A349Z5P4-F1-model_v4 DUF1611 domain-containing protein 0.9896 151 266
AF-A0A4V1SCZ4-F1-model_v4 TonB-dependent receptor 0.9889 5 341 GO:0006826
GO:0009279

Feature Viewer

pLDDT pTM Quality
94.15 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map