F464530
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 567 | 277 | 550 | 344 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0119300|Ga0395901_0119300_1340_2497 |
| Length | 385 |
| Sequence | MAWGNDRERLGNMEYRTLTDPLPAEGSNGLTGDGSIRVQSDGIASRPSPLALPAPYLLFLGDVTEPSYAKTAFGLHDWASERCVGEFVSDPRAVRTGLPRLSPAEAAAKGARAMVIAVANSGGYIPESWHPSLLEALGAGLDLVAGMHVKLASIPAVAQAAQDLGRQLIDVRTPPRNIPVATGEKRSGKRLLTVGTDCALGKKYTALALAHAFARRGLKVDFRATGQTGIMIAGGGIPMDAVVSDFEAGAAELLSPDAAPDHWDVIEGQGSLLHPAYSAVSMGLLHGSQPDVFVVCHDPSRSTMLGHPNFPIPAIEEIISLTTELGRRTNPAIRCGGVAYNTSALRAEDAAALMERDSERLGLEIADPIRRGPAFDRLVNSCLEA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2512564014 | Sphingobium sp. AP49 | Isolate | Rhizosphere |
| 2 | 2643221560 | Sphingopyxis sp. Root1497 | Isolate | Unclassified |
| 3 | 2643221563 | Sphingopyxis sp. Root154 | Isolate | Unclassified |
| 4 | 2643221605 | Sphingomonas sp. Root710 | Isolate | Unclassified |
| 5 | 2643221608 | Sphingopyxis sp. Root214 | Isolate | Unclassified |
| 6 | 2643221622 | Sphingomonas sp. Root241 | Isolate | Unclassified |
| 7 | 2852653556 | Sphingopyxis sp. JAI108 | Isolate | Rhizosphere |
| 8 | 2852680915 | Sphingopyxis sp. JAI128 | Isolate | Rhizosphere |
| 9 | 2882806704 | Pelagerythrobacter rhizovicinus AY-3R | Isolate | Rhizosphere |
| 10 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 11 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 12 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 13 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 14 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 15 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 16 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 17 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 18 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 19 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 20 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 22 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 68 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 72 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 73 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 74 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 75 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 76 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 77 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 78 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 80 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 100 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 105 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 107 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 162 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 163 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 164 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 168 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 169 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 170 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 171 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 172 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 173 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 174 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 175 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 176 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 182 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 183 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 185 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 186 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 187 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 188 | 3300039145 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1 | Metagenome | Unclassified |
| 189 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 190 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 191 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 192 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 193 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 214 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 215 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 216 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 218 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 219 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 220 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 221 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 222 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 223 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 224 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 225 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 226 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 227 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 228 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 229 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 230 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 235 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 238 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 262 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 263 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 264 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 265 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 266 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 267 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 268 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 269 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 270 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 271 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 272 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 273 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 274 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 277 | 8057101203 | Sphingomonas lycopersici MMSM20 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.18 |
| Metatranscriptomes | 0.35 |
| Isolates | 2.47 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.11 |
| Nodule | 0.18 |
| Rhizoplane | 1.94 |
| Rhizosphere | 74.25 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.53 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10000019 | 3300001979 | Bacteria | 54662 |
| 2 | JGI24739J22299_10006255 | 3300001989 | Bacteria | 4495 |
| 3 | JGI25150J39212_1000044 | 3300002774 | Bacteria | 83125 |
| 4 | JGI25406J46586_10003744 | 3300003203 | Bacteria | 7115 |
| 5 | JGI25153J46596_10000043 | 3300003215 | Bacteria | 156407 |
| 6 | Ga0055526_1005425 | 3300003771 | Bacteria | 7334 |
| 7 | Ga0055537_1001605 | 3300003773 | Bacteria | 8512 |
| 8 | Ga0055536_1000733 | 3300003781 | Bacteria | 22058 |
| 9 | Ga0055536_1001202 | 3300003781 | Bacteria | 16081 |
| 10 | Ga0055536_1001466 | 3300003781 | Bacteria | 14175 |
| 11 | Ga0055536_1001810 | 3300003781 | Bacteria | 12568 |
| 12 | Ga0055536_1003951 | 3300003781 | Bacteria | 7772 |
| 13 | Ga0055536_1007638 | 3300003781 | Bacteria | 4796 |
| 14 | Ga0055536_1015188 | 3300003781 | Bacteria | 2651 |
| 15 | Ga0055530_10000106 | 3300003791 | Bacteria | 71921 |
| 16 | Ga0055530_10000164 | 3300003791 | Bacteria | 60316 |
| 17 | Ga0055530_10000181 | 3300003791 | Bacteria | 56843 |
| 18 | Ga0055530_10000465 | 3300003791 | Bacteria | 35593 |
| 19 | Ga0055530_10021805 | 3300003791 | Bacteria | 1879 |
| 20 | Ga0055530_10023840 | 3300003791 | Bacteria | 1750 |
| 21 | Ga0055530_10041273 | 3300003791 | Bacteria | 1127 |
| 22 | Ga0055540_1006239 | 3300003792 | Bacteria | 4779 |
| 23 | Ga0055531_10000012 | 3300003794 | Bacteria | 191187 |
| 24 | Ga0055531_10001005 | 3300003794 | Bacteria | 22405 |
| 25 | Ga0055531_10001314 | 3300003794 | Bacteria | 18656 |
| 26 | Ga0055531_10004289 | 3300003794 | Bacteria | 8747 |
| 27 | Ga0055531_10004380 | 3300003794 | Bacteria | 8625 |
| 28 | Ga0055531_10005744 | 3300003794 | Bacteria | 7187 |
| 29 | Ga0055531_10006349 | 3300003794 | Bacteria | 6727 |
| 30 | Ga0055531_10024604 | 3300003794 | Bacteria | 2215 |
| 31 | Ga0055531_10024606 | 3300003794 | Bacteria | 2215 |
| 32 | Ga0065165_1007814 | 3300005262 | Bacteria | 5151 |
| 33 | Ga0065715_10101304 | 3300005293 | Bacteria | 3218 |
| 34 | Ga0070683_100221658 | 3300005329 | Bacteria | 1798 |
| 35 | Ga0070690_100052877 | 3300005330 | Bacteria | 2597 |
| 36 | Ga0070670_100148246 | 3300005331 | Bacteria | 2030 |
| 37 | Ga0070670_100279037 | 3300005331 | Bacteria | 1459 |
| 38 | Ga0070666_10001021 | 3300005335 | Bacteria | 17164 |
| 39 | Ga0070682_100063474 | 3300005337 | Bacteria | 2342 |
| 40 | Ga0068868_100038055 | 3300005338 | Bacteria | 3733 |
| 41 | Ga0070689_100005710 | 3300005340 | Bacteria | 8527 |
| 42 | Ga0070689_100143957 | 3300005340 | Bacteria | 1919 |
| 43 | Ga0070691_10109888 | 3300005341 | Bacteria | 1378 |
| 44 | Ga0070687_100020844 | 3300005343 | Bacteria | 3072 |
| 45 | Ga0070661_100006044 | 3300005344 | Bacteria | 8327 |
| 46 | Ga0070661_100087735 | 3300005344 | Bacteria | 2302 |
| 47 | Ga0070661_100111003 | 3300005344 | Bacteria | 2048 |
| 48 | Ga0070668_100045018 | 3300005347 | Bacteria | 3386 |
| 49 | Ga0070669_100013818 | 3300005353 | Bacteria | 5739 |
| 50 | Ga0070669_100144466 | 3300005353 | Bacteria | 1837 |
| 51 | Ga0070675_100198646 | 3300005354 | Bacteria | 1740 |
| 52 | Ga0070675_100288289 | 3300005354 | Bacteria | 1444 |
| 53 | Ga0070667_100099738 | 3300005367 | Bacteria | 2507 |
| 54 | Ga0070667_100165132 | 3300005367 | Bacteria | 1952 |
| 55 | Ga0070667_100235003 | 3300005367 | Bacteria | 1635 |
| 56 | Ga0070714_100230939 | 3300005435 | Bacteria | 1704 |
| 57 | Ga0070705_100020633 | 3300005440 | Bacteria | 3491 |
| 58 | Ga0070700_100020690 | 3300005441 | Bacteria | 3817 |
| 59 | Ga0070663_100000022 | 3300005455 | Bacteria | 111612 |
| 60 | Ga0070678_100006730 | 3300005456 | Bacteria | 6768 |
| 61 | Ga0070678_100110169 | 3300005456 | Bacteria | 2153 |
| 62 | Ga0070662_100002305 | 3300005457 | Bacteria | 11720 |
| 63 | Ga0070662_100002608 | 3300005457 | Bacteria | 11121 |
| 64 | Ga0070662_100004914 | 3300005457 | Bacteria | 8491 |
| 65 | Ga0070662_100070678 | 3300005457 | Bacteria | 2572 |
| 66 | Ga0070681_10003155 | 3300005458 | Bacteria | 15329 |
| 67 | Ga0070681_10177753 | 3300005458 | Bacteria | 2050 |
| 68 | Ga0068867_100016202 | 3300005459 | Bacteria | 5292 |
| 69 | Ga0068867_100368207 | 3300005459 | Bacteria | 1204 |
| 70 | Ga0070685_10000152 | 3300005466 | Bacteria | 45620 |
| 71 | Ga0070685_10001858 | 3300005466 | Bacteria | 11018 |
| 72 | Ga0070684_100008538 | 3300005535 | Bacteria | 8016 |
| 73 | Ga0068853_100028737 | 3300005539 | Bacteria | 4679 |
| 74 | Ga0068853_100032342 | 3300005539 | Bacteria | 4431 |
| 75 | Ga0068853_100044493 | 3300005539 | Bacteria | 3800 |
| 76 | Ga0068853_100068560 | 3300005539 | Bacteria | 3084 |
| 77 | Ga0068853_100316742 | 3300005539 | Bacteria | 1445 |
| 78 | Ga0070686_100002514 | 3300005544 | Bacteria | 10102 |
| 79 | Ga0070665_100000928 | 3300005548 | Bacteria | 37485 |
| 80 | Ga0070665_100004102 | 3300005548 | Bacteria | 15321 |
| 81 | Ga0070665_100007710 | 3300005548 | Bacteria | 10930 |
| 82 | Ga0070665_100008614 | 3300005548 | Bacteria | 10322 |
| 83 | Ga0070665_100009713 | 3300005548 | Bacteria | 9725 |
| 84 | Ga0070665_100030126 | 3300005548 | Bacteria | 5460 |
| 85 | Ga0070665_100104488 | 3300005548 | Bacteria | 2835 |
| 86 | Ga0070665_100105961 | 3300005548 | Bacteria | 2813 |
| 87 | Ga0068855_100069899 | 3300005563 | Unclassified | 4085 |
| 88 | Ga0070664_100220201 | 3300005564 | Bacteria | 1698 |
| 89 | Ga0068857_100022630 | 3300005577 | Bacteria | 5528 |
| 90 | Ga0068854_100006701 | 3300005578 | Bacteria | 7343 |
| 91 | Ga0068856_100000041 | 3300005614 | Bacteria | 112613 |
| 92 | Ga0068856_100015602 | 3300005614 | Bacteria | 7345 |
| 93 | Ga0070702_100021737 | 3300005615 | Bacteria | 3382 |
| 94 | Ga0068852_100290638 | 3300005616 | Bacteria | 1579 |
| 95 | Ga0068859_100002362 | 3300005617 | Bacteria | 19216 |
| 96 | Ga0068864_100029869 | 3300005618 | Bacteria | 4619 |
| 97 | Ga0068866_10146072 | 3300005718 | Bacteria | 1364 |
| 98 | Ga0068861_100000062 | 3300005719 | Bacteria | 51049 |
| 99 | Ga0068861_100000366 | 3300005719 | Bacteria | 25904 |
| 100 | Ga0068851_10007007 | 3300005834 | Bacteria | 5169 |
| 101 | Ga0068870_10018123 | 3300005840 | Bacteria | 3395 |
| 102 | Ga0068863_100030711 | 3300005841 | Bacteria | 5130 |
| 103 | Ga0068863_100084928 | 3300005841 | Bacteria | 2999 |
| 104 | Ga0068863_100246254 | 3300005841 | Bacteria | 1726 |
| 105 | Ga0068858_100002262 | 3300005842 | Bacteria | 19472 |
| 106 | Ga0068858_100049301 | 3300005842 | Bacteria | 3899 |
| 107 | Ga0068860_100006757 | 3300005843 | Bacteria | 11505 |
| 108 | Ga0068860_100448429 | 3300005843 | Bacteria | 1283 |
| 109 | Ga0068862_100000722 | 3300005844 | Bacteria | 33471 |
| 110 | Ga0068862_100276589 | 3300005844 | Bacteria | 1537 |
| 111 | Ga0081539_10000004 | 3300005985 | Bacteria | 555600 |
| 112 | Ga0070717_10282795 | 3300006028 | Bacteria | 1472 |
| 113 | Ga0070716_100121766 | 3300006173 | Bacteria | 1634 |
| 114 | Ga0070716_100209304 | 3300006173 | Bacteria | 1302 |
| 115 | Ga0097621_100019694 | 3300006237 | Bacteria | 5186 |
| 116 | Ga0097621_100024669 | 3300006237 | Bacteria | 4699 |
| 117 | Ga0097621_100034130 | 3300006237 | Bacteria | 4056 |
| 118 | Ga0097621_100137657 | 3300006237 | Bacteria | 2084 |
| 119 | Ga0068871_100051777 | 3300006358 | Bacteria | 3324 |
| 120 | Ga0075428_100000920 | 3300006844 | Bacteria | 31094 |
| 121 | Ga0075428_100282823 | 3300006844 | Bacteria | 1785 |
| 122 | Ga0075430_100004783 | 3300006846 | Bacteria | 11391 |
| 123 | Ga0075430_100008166 | 3300006846 | Bacteria | 8848 |
| 124 | Ga0075430_100060288 | 3300006846 | Bacteria | 3189 |
| 125 | Ga0075430_100141229 | 3300006846 | Bacteria | 2006 |
| 126 | Ga0075431_100000221 | 3300006847 | Bacteria | 42473 |
| 127 | Ga0075431_100000267 | 3300006847 | Bacteria | 40345 |
| 128 | Ga0075431_100003861 | 3300006847 | Bacteria | 14570 |
| 129 | Ga0075434_100213628 | 3300006871 | Bacteria | 1949 |
| 130 | Ga0075429_100003103 | 3300006880 | Bacteria | 14111 |
| 131 | Ga0068865_100023649 | 3300006881 | Bacteria | 4025 |
| 132 | Ga0097620_100002362 | 3300006931 | Bacteria | 19216 |
| 133 | Ga0079104_1018097 | 3300006946 | Bacteria | 2005 |
| 134 | Ga0105240_10010664 | 3300009093 | Bacteria | 12896 |
| 135 | Ga0105240_10016387 | 3300009093 | Bacteria | 10035 |
| 136 | Ga0105240_10067374 | 3300009093 | Bacteria | 4437 |
| 137 | Ga0105240_10069692 | 3300009093 | Bacteria | 4352 |
| 138 | Ga0105240_10175389 | 3300009093 | Bacteria | 2535 |
| 139 | Ga0111539_10000989 | 3300009094 | Bacteria | 37233 |
| 140 | Ga0111539_10007571 | 3300009094 | Bacteria | 13881 |
| 141 | Ga0111539_10025836 | 3300009094 | Bacteria | 7191 |
| 142 | Ga0111539_10127795 | 3300009094 | Bacteria | 2977 |
| 143 | Ga0111539_10401226 | 3300009094 | Bacteria | 1597 |
| 144 | Ga0105245_10078920 | 3300009098 | Bacteria | 3004 |
| 145 | Ga0105245_10153917 | 3300009098 | Bacteria | 2176 |
| 146 | Ga0105247_10059784 | 3300009101 | Bacteria | 2360 |
| 147 | Ga0114129_10003655 | 3300009147 | Bacteria | 21639 |
| 148 | Ga0114129_10079198 | 3300009147 | Bacteria | 4569 |
| 149 | Ga0114129_10247926 | 3300009147 | Bacteria | 2392 |
| 150 | Ga0105242_10016940 | 3300009176 | Bacteria | 5671 |
| 151 | Ga0105248_10037039 | 3300009177 | Bacteria | 5455 |
| 152 | Ga0105237_10005186 | 3300009545 | Bacteria | 14738 |
| 153 | Ga0105237_10037935 | 3300009545 | Bacteria | 4868 |
| 154 | Ga0105237_10073498 | 3300009545 | Bacteria | 3411 |
| 155 | Ga0105237_10109291 | 3300009545 | Bacteria | 2757 |
| 156 | Ga0105237_10291681 | 3300009545 | Bacteria | 1634 |
| 157 | Ga0105238_10000192 | 3300009551 | Bacteria | 67306 |
| 158 | Ga0105238_10004676 | 3300009551 | Bacteria | 13548 |
| 159 | Ga0105238_10025058 | 3300009551 | Bacteria | 6081 |
| 160 | Ga0105238_10069026 | 3300009551 | Bacteria | 3535 |
| 161 | Ga0105238_10085639 | 3300009551 | Bacteria | 3139 |
| 162 | Ga0105238_10144200 | 3300009551 | Bacteria | 2358 |
| 163 | Ga0105238_10179831 | 3300009551 | Bacteria | 2092 |
| 164 | Ga0105238_10567708 | 3300009551 | Bacteria | 1140 |
| 165 | Ga0105249_10001944 | 3300009553 | Bacteria | 17939 |
| 166 | Ga0105249_10018875 | 3300009553 | Bacteria | 6145 |
| 167 | Ga0105249_10029931 | 3300009553 | Bacteria | 4918 |
| 168 | Ga0105249_10041664 | 3300009553 | Bacteria | 4175 |
| 169 | Ga0105239_10029287 | 3300010375 | Bacteria | 6054 |
| 170 | Ga0157373_10000046 | 3300013100 | Bacteria | 112179 |
| 171 | Ga0157370_10000071 | 3300013104 | Bacteria | 111640 |
| 172 | Ga0157369_10011583 | 3300013105 | Bacteria | 10011 |
| 173 | Ga0163162_10000004 | 3300013306 | Bacteria | 505593 |
| 174 | Ga0163162_10023244 | 3300013306 | Bacteria | 6115 |
| 175 | Ga0163162_10298450 | 3300013306 | Bacteria | 1743 |
| 176 | Ga0163162_10369090 | 3300013306 | Bacteria | 1568 |
| 177 | Ga0157372_10529003 | 3300013307 | Unclassified | 1374 |
| 178 | Ga0157375_10001172 | 3300013308 | Bacteria | 22634 |
| 179 | Ga0157375_10030306 | 3300013308 | Bacteria | 5100 |
| 180 | Ga0157375_10137437 | 3300013308 | Bacteria | 2569 |
| 181 | Ga0157375_10206807 | 3300013308 | Bacteria | 2119 |
| 182 | Ga0163163_10004078 | 3300014325 | Bacteria | 12454 |
| 183 | Ga0157380_10053565 | 3300014326 | Bacteria | 3199 |
| 184 | Ga0182008_10110260 | 3300014497 | Bacteria | 1364 |
| 185 | Ga0157377_10003544 | 3300014745 | Bacteria | 7065 |
| 186 | Ga0157379_10033075 | 3300014968 | Bacteria | 4610 |
| 187 | Ga0157379_10100880 | 3300014968 | Unclassified | 2591 |
| 188 | Ga0157379_10179162 | 3300014968 | Bacteria | 1915 |
| 189 | Ga0157376_10032388 | 3300014969 | Bacteria | 4197 |
| 190 | Ga0157376_10033821 | 3300014969 | Bacteria | 4120 |
| 191 | Ga0163161_10064637 | 3300017792 | Bacteria | 2669 |
| 192 | Ga0207425_1000047 | 3300025245 | Bacteria | 189158 |
| 193 | Ga0209129_1000497 | 3300025258 | Bacteria | 28640 |
| 194 | Ga0209565_1000089 | 3300025263 | Bacteria | 150511 |
| 195 | Ga0209675_1000183 | 3300025291 | Bacteria | 70391 |
| 196 | Ga0209675_1000202 | 3300025291 | Bacteria | 62955 |
| 197 | Ga0209675_1000384 | 3300025291 | Bacteria | 36771 |
| 198 | Ga0209676_1000155 | 3300025292 | Bacteria | 165151 |
| 199 | Ga0209676_1000234 | 3300025292 | Bacteria | 119888 |
| 200 | Ga0209676_1000384 | 3300025292 | Bacteria | 81053 |
| 201 | Ga0209676_1000475 | 3300025292 | Bacteria | 66299 |
| 202 | Ga0209676_1000693 | 3300025292 | Bacteria | 47361 |
| 203 | Ga0209676_1004605 | 3300025292 | Bacteria | 7600 |
| 204 | Ga0209676_1004674 | 3300025292 | Bacteria | 7513 |
| 205 | Ga0209676_1007388 | 3300025292 | Bacteria | 5168 |
| 206 | Ga0209025_1000150 | 3300025294 | Bacteria | 172834 |
| 207 | Ga0209025_1007902 | 3300025294 | Bacteria | 7794 |
| 208 | Ga0209025_1020691 | 3300025294 | Bacteria | 3582 |
| 209 | Ga0209025_1054244 | 3300025294 | Bacteria | 1563 |
| 210 | Ga0209564_1001696 | 3300025295 | Bacteria | 20847 |
| 211 | Ga0209758_1000009 | 3300025297 | Bacteria | 1123483 |
| 212 | Ga0209758_1023933 | 3300025297 | Bacteria | 2741 |
| 213 | Ga0209050_1000005 | 3300025298 | Bacteria | 1557793 |
| 214 | Ga0209050_1000039 | 3300025298 | Bacteria | 410069 |
| 215 | Ga0209050_1000112 | 3300025298 | Bacteria | 210320 |
| 216 | Ga0209050_1000132 | 3300025298 | Bacteria | 185906 |
| 217 | Ga0209050_1000776 | 3300025298 | Bacteria | 45644 |
| 218 | Ga0209050_1007994 | 3300025298 | Bacteria | 5770 |
| 219 | Ga0209050_1008503 | 3300025298 | Bacteria | 5468 |
| 220 | Ga0209050_1015174 | 3300025298 | Bacteria | 3257 |
| 221 | Ga0209050_1032064 | 3300025298 | Bacteria | 1624 |
| 222 | Ga0209051_1000396 | 3300025303 | Bacteria | 60690 |
| 223 | Ga0209051_1004840 | 3300025303 | Bacteria | 8098 |
| 224 | Ga0209257_1000051 | 3300025304 | Bacteria | 434166 |
| 225 | Ga0209257_1000176 | 3300025304 | Bacteria | 161436 |
| 226 | Ga0209257_1000337 | 3300025304 | Bacteria | 97941 |
| 227 | Ga0209257_1000523 | 3300025304 | Bacteria | 66624 |
| 228 | Ga0209257_1000600 | 3300025304 | Bacteria | 59824 |
| 229 | Ga0209257_1001283 | 3300025304 | Bacteria | 30714 |
| 230 | Ga0209257_1001567 | 3300025304 | Bacteria | 26417 |
| 231 | Ga0209257_1001840 | 3300025304 | Bacteria | 23128 |
| 232 | Ga0209257_1004585 | 3300025304 | Bacteria | 10546 |
| 233 | Ga0209257_1015830 | 3300025304 | Bacteria | 3101 |
| 234 | Ga0207656_10068433 | 3300025321 | Bacteria | 1573 |
| 235 | Ga0207656_10090192 | 3300025321 | Bacteria | 1390 |
| 236 | Ga0207688_10024861 | 3300025901 | Bacteria | 3286 |
| 237 | Ga0207680_10098946 | 3300025903 | Bacteria | 1870 |
| 238 | Ga0207647_10010944 | 3300025904 | Bacteria | 6381 |
| 239 | Ga0207699_10077829 | 3300025906 | Unclassified | 2048 |
| 240 | Ga0207705_10040583 | 3300025909 | Bacteria | 3339 |
| 241 | Ga0207654_10000032 | 3300025911 | Bacteria | 120553 |
| 242 | Ga0207654_10165274 | 3300025911 | Bacteria | 1432 |
| 243 | Ga0207707_10160951 | 3300025912 | Bacteria | 1963 |
| 244 | Ga0207707_10189494 | 3300025912 | Bacteria | 1794 |
| 245 | Ga0207695_10000082 | 3300025913 | Bacteria | 284333 |
| 246 | Ga0207695_10019407 | 3300025913 | Bacteria | 7831 |
| 247 | Ga0207695_10022352 | 3300025913 | Bacteria | 7182 |
| 248 | Ga0207695_10039411 | 3300025913 | Bacteria | 5079 |
| 249 | Ga0207695_10041929 | 3300025913 | Bacteria | 4894 |
| 250 | Ga0207695_10180159 | 3300025913 | Bacteria | 2034 |
| 251 | Ga0207695_10206882 | 3300025913 | Bacteria | 1875 |
| 252 | Ga0207671_10013633 | 3300025914 | Bacteria | 6464 |
| 253 | Ga0207671_10102256 | 3300025914 | Bacteria | 2172 |
| 254 | Ga0207671_10180622 | 3300025914 | Bacteria | 1642 |
| 255 | Ga0207662_10006576 | 3300025918 | Bacteria | 6275 |
| 256 | Ga0207649_10092171 | 3300025920 | Bacteria | 1986 |
| 257 | Ga0207649_10097669 | 3300025920 | Bacteria | 1937 |
| 258 | Ga0207681_10004757 | 3300025923 | Bacteria | 8355 |
| 259 | Ga0207694_10000812 | 3300025924 | Bacteria | 27924 |
| 260 | Ga0207694_10000832 | 3300025924 | Bacteria | 27463 |
| 261 | Ga0207694_10003663 | 3300025924 | Bacteria | 12162 |
| 262 | Ga0207694_10009691 | 3300025924 | Bacteria | 7263 |
| 263 | Ga0207694_10148020 | 3300025924 | Bacteria | 1891 |
| 264 | Ga0207659_10016381 | 3300025926 | Bacteria | 4823 |
| 265 | Ga0207687_10207998 | 3300025927 | Bacteria | 1533 |
| 266 | Ga0207644_10078015 | 3300025931 | Bacteria | 2441 |
| 267 | Ga0207644_10178680 | 3300025931 | Bacteria | 1662 |
| 268 | Ga0207690_10121698 | 3300025932 | Bacteria | 1897 |
| 269 | Ga0207706_10001608 | 3300025933 | Bacteria | 22419 |
| 270 | Ga0207706_10004158 | 3300025933 | Bacteria | 13642 |
| 271 | Ga0207706_10004347 | 3300025933 | Bacteria | 13306 |
| 272 | Ga0207706_10025788 | 3300025933 | Bacteria | 5266 |
| 273 | Ga0207706_10097441 | 3300025933 | Bacteria | 2586 |
| 274 | Ga0207686_10014243 | 3300025934 | Bacteria | 4422 |
| 275 | Ga0207686_10209828 | 3300025934 | Bacteria | 1399 |
| 276 | Ga0207709_10070099 | 3300025935 | Bacteria | 2222 |
| 277 | Ga0207670_10030464 | 3300025936 | Bacteria | 3447 |
| 278 | Ga0207670_10266101 | 3300025936 | Bacteria | 1331 |
| 279 | Ga0207704_10012534 | 3300025938 | Bacteria | 4210 |
| 280 | Ga0207704_10067079 | 3300025938 | Bacteria | 2256 |
| 281 | Ga0207691_10057179 | 3300025940 | Bacteria | 3551 |
| 282 | Ga0207691_10164062 | 3300025940 | Bacteria | 1948 |
| 283 | Ga0207711_10073099 | 3300025941 | Bacteria | 2980 |
| 284 | Ga0207689_10014175 | 3300025942 | Bacteria | 6781 |
| 285 | Ga0207689_10321950 | 3300025942 | Bacteria | 1283 |
| 286 | Ga0207679_10291434 | 3300025945 | Bacteria | 1403 |
| 287 | Ga0207667_10447490 | 3300025949 | Bacteria | 1313 |
| 288 | Ga0207651_10129805 | 3300025960 | Bacteria | 1927 |
| 289 | Ga0207651_10137253 | 3300025960 | Bacteria | 1883 |
| 290 | Ga0207712_10003759 | 3300025961 | Bacteria | 9584 |
| 291 | Ga0207712_10062960 | 3300025961 | Bacteria | 2639 |
| 292 | Ga0207668_10010127 | 3300025972 | Bacteria | 5683 |
| 293 | Ga0207668_10241018 | 3300025972 | Bacteria | 1463 |
| 294 | Ga0207668_10301709 | 3300025972 | Bacteria | 1322 |
| 295 | Ga0207640_10002942 | 3300025981 | Bacteria | 9160 |
| 296 | Ga0207658_10062115 | 3300025986 | Bacteria | 2794 |
| 297 | Ga0207658_10138969 | 3300025986 | Bacteria | 1963 |
| 298 | Ga0207677_10017144 | 3300026023 | Bacteria | 4310 |
| 299 | Ga0207677_10054397 | 3300026023 | Bacteria | 2731 |
| 300 | Ga0207703_10001706 | 3300026035 | Bacteria | 19722 |
| 301 | Ga0207703_10139793 | 3300026035 | Bacteria | 2100 |
| 302 | Ga0207703_10279642 | 3300026035 | Bacteria | 1515 |
| 303 | Ga0207639_10000173 | 3300026041 | Bacteria | 50109 |
| 304 | Ga0207639_10047697 | 3300026041 | Bacteria | 3239 |
| 305 | Ga0207678_10000038 | 3300026067 | Bacteria | 101262 |
| 306 | Ga0207678_10034501 | 3300026067 | Bacteria | 4406 |
| 307 | Ga0207678_10040586 | 3300026067 | Bacteria | 4036 |
| 308 | Ga0207708_10022675 | 3300026075 | Bacteria | 4741 |
| 309 | Ga0207702_10000061 | 3300026078 | Bacteria | 125368 |
| 310 | Ga0207641_10025983 | 3300026088 | Bacteria | 4831 |
| 311 | Ga0207641_10057654 | 3300026088 | Bacteria | 3303 |
| 312 | Ga0207641_10191196 | 3300026088 | Bacteria | 1881 |
| 313 | Ga0207648_10019230 | 3300026089 | Bacteria | 6165 |
| 314 | Ga0207648_10025282 | 3300026089 | Bacteria | 5291 |
| 315 | Ga0207648_10148662 | 3300026089 | Bacteria | 2067 |
| 316 | Ga0207676_10070454 | 3300026095 | Bacteria | 2804 |
| 317 | Ga0207676_10111641 | 3300026095 | Bacteria | 2288 |
| 318 | Ga0207674_10006655 | 3300026116 | Bacteria | 13575 |
| 319 | Ga0207674_10013363 | 3300026116 | Bacteria | 9115 |
| 320 | Ga0207674_10015160 | 3300026116 | Bacteria | 8481 |
| 321 | Ga0207674_10022806 | 3300026116 | Bacteria | 6717 |
| 322 | Ga0207674_10084276 | 3300026116 | Bacteria | 3177 |
| 323 | Ga0207674_10127050 | 3300026116 | Bacteria | 2515 |
| 324 | Ga0207675_100000614 | 3300026118 | Bacteria | 34802 |
| 325 | Ga0207675_100000736 | 3300026118 | Bacteria | 32456 |
| 326 | Ga0207675_100095114 | 3300026118 | Bacteria | 2803 |
| 327 | Ga0207675_100106504 | 3300026118 | Bacteria | 2643 |
| 328 | Ga0207675_100162179 | 3300026118 | Bacteria | 2133 |
| 329 | Ga0207683_10161832 | 3300026121 | Bacteria | 2024 |
| 330 | Ga0207683_10169408 | 3300026121 | Bacteria | 1977 |
| 331 | Ga0207698_10055479 | 3300026142 | Bacteria | 3054 |
| 332 | Ga0207428_10002156 | 3300027907 | Bacteria | 19753 |
| 333 | Ga0207428_10018186 | 3300027907 | Bacteria | 6010 |
| 334 | Ga0207428_10078567 | 3300027907 | Bacteria | 2582 |
| 335 | Ga0265356_1002953 | 3300028017 | Bacteria | 2183 |
| 336 | Ga0265355_1003744 | 3300028036 | Bacteria | 1125 |
| 337 | Ga0268266_10000007 | 3300028379 | Bacteria | 1372921 |
| 338 | Ga0268266_10000796 | 3300028379 | Bacteria | 41984 |
| 339 | Ga0268266_10000890 | 3300028379 | Bacteria | 38685 |
| 340 | Ga0268266_10001872 | 3300028379 | Bacteria | 23748 |
| 341 | Ga0268266_10068644 | 3300028379 | Bacteria | 3070 |
| 342 | Ga0268266_10158720 | 3300028379 | Bacteria | 2045 |
| 343 | Ga0268266_10187776 | 3300028379 | Bacteria | 1886 |
| 344 | Ga0268265_10000547 | 3300028380 | Bacteria | 38290 |
| 345 | Ga0268265_10025331 | 3300028380 | Bacteria | 4208 |
| 346 | Ga0268265_10045506 | 3300028380 | Bacteria | 3275 |
| 347 | Ga0268264_10000176 | 3300028381 | Bacteria | 136166 |
| 348 | Ga0268264_10004326 | 3300028381 | Bacteria | 12121 |
| 349 | Ga0307515_10270587 | 3300028794 | Bacteria | 1421 |
| 350 | Ga0265770_1011066 | 3300030878 | Bacteria | 1319 |
| 351 | Ga0265760_10000405 | 3300031090 | Bacteria | 12088 |
| 352 | Ga0307509_10000003 | 3300031507 | Bacteria | 577578 |
| 353 | Ga0307509_10000021 | 3300031507 | Bacteria | 250589 |
| 354 | Ga0307408_100019644 | 3300031548 | Bacteria | 4551 |
| 355 | Ga0307408_100021968 | 3300031548 | Bacteria | 4328 |
| 356 | Ga0307408_100051994 | 3300031548 | Bacteria | 2954 |
| 357 | Ga0307508_10005849 | 3300031616 | Bacteria | 11614 |
| 358 | Ga0307405_10005713 | 3300031731 | Bacteria | 6037 |
| 359 | Ga0307413_10183726 | 3300031824 | Bacteria | 1494 |
| 360 | Ga0307413_10336716 | 3300031824 | Bacteria | 1159 |
| 361 | Ga0307406_10058025 | 3300031901 | Bacteria | 2486 |
| 362 | Ga0307406_10104578 | 3300031901 | Bacteria | 1936 |
| 363 | Ga0307406_10121945 | 3300031901 | Bacteria | 1814 |
| 364 | Ga0307412_10041499 | 3300031911 | Bacteria | 2983 |
| 365 | Ga0307416_100007495 | 3300032002 | Bacteria | 6946 |
| 366 | Ga0307416_100041648 | 3300032002 | Bacteria | 3579 |
| 367 | Ga0307414_10000242 | 3300032004 | Bacteria | 34787 |
| 368 | Ga0307414_10022597 | 3300032004 | Bacteria | 3971 |
| 369 | Ga0307414_10280657 | 3300032004 | Bacteria | 1399 |
| 370 | Ga0307411_10140496 | 3300032005 | Bacteria | 1780 |
| 371 | Ga0307415_100130236 | 3300032126 | Bacteria | 1903 |
| 372 | Ga0307510_10000002 | 3300033180 | Bacteria | 801565 |
| 373 | Ga0373944_0032432 | 3300035089 | Bacteria | 1578 |
| 374 | Ga0373956_0040630 | 3300035119 | Bacteria | 2064 |
| 375 | Ga0373937_0017549 | 3300036401 | Bacteria | 6379 |
| 376 | Ga0373937_0281564 | 3300036401 | Bacteria | 1570 |
| 377 | Ga0373937_0295818 | 3300036401 | Bacteria | 1530 |
| 378 | Ga0395905_0022952 | 3300037471 | Bacteria | 5897 |
| 379 | Ga0395901_0119300 | 3300038443 | Bacteria | 2772 |
| 380 | Ga0237819_00302 | 3300038705 | Bacteria | 18159 |
| 381 | Ga0237816_00554 | 3300039145 | Bacteria | 3167 |
| 382 | Ga0436360_1257731 | 3300039438 | Bacteria | 1377 |
| 383 | Ga0439448_0021987 | 3300042005 | Bacteria | 1979 |
| 384 | Ga0466959_0018673 | 3300045049 | Bacteria | 5092 |
| 385 | Ga0466959_0036457 | 3300045049 | Bacteria | 3634 |
| 386 | Ga0451576_0606388 | 3300045051 | Bacteria | 1151 |
| 387 | Ga0495627_000060 | 3300046453 | Bacteria | 140874 |
| 388 | Ga0495627_045249 | 3300046453 | Bacteria | 1341 |
| 389 | Ga0495638_0000123 | 3300046460 | Bacteria | 125420 |
| 390 | Ga0495638_0018112 | 3300046460 | Bacteria | 4681 |
| 391 | Ga0495651_0258507 | 3300046462 | Bacteria | 1186 |
| 392 | Ga0495583_0000027 | 3300046506 | Bacteria | 256299 |
| 393 | Ga0495583_0049273 | 3300046506 | Bacteria | 1930 |
| 394 | Ga0495583_0053714 | 3300046506 | Bacteria | 1827 |
| 395 | Ga0495643_0019082 | 3300046522 | Bacteria | 3970 |
| 396 | Ga0495643_0040398 | 3300046522 | Bacteria | 2548 |
| 397 | Ga0495648_0001235 | 3300046524 | Bacteria | 25568 |
| 398 | Ga0495663_0004107 | 3300046525 | Bacteria | 4121 |
| 399 | Ga0495587_0103931 | 3300046536 | Bacteria | 1635 |
| 400 | Ga0495633_0070807 | 3300046558 | Bacteria | 1627 |
| 401 | Ga0495668_0000013 | 3300046616 | Bacteria | 452938 |
| 402 | Ga0495668_0000031 | 3300046616 | Bacteria | 256576 |
| 403 | Ga0495625_0000351 | 3300046660 | Bacteria | 70408 |
| 404 | Ga0495625_0000352 | 3300046660 | Bacteria | 70308 |
| 405 | Ga0495625_0000842 | 3300046660 | Bacteria | 41902 |
| 406 | Ga0495625_0004906 | 3300046660 | Bacteria | 12458 |
| 407 | Ga0495657_0137951 | 3300046675 | Bacteria | 1522 |
| 408 | Ga0495670_0000002 | 3300046691 | Bacteria | 601814 |
| 409 | Ga0495670_0000005 | 3300046691 | Bacteria | 289725 |
| 410 | Ga0495672_0017800 | 3300047320 | Bacteria | 4741 |
| 411 | Ga0495672_0141557 | 3300047320 | Bacteria | 1256 |
| 412 | Ga0495675_0104529 | 3300047444 | Bacteria | 1770 |
| 413 | Ga0495677_0007618 | 3300047445 | Bacteria | 4040 |
| 414 | Ga0495681_0036416 | 3300047470 | Bacteria | 2433 |
| 415 | Ga0496101_0175749 | 3300048904 | Bacteria | 1647 |
| 416 | Ga0496102_0100081 | 3300048905 | Bacteria | 2691 |
| 417 | Ga0496102_0311198 | 3300048905 | Bacteria | 1484 |
| 418 | Ga0496103_0028932 | 3300048906 | Bacteria | 3366 |
| 419 | Ga0496105_0000016 | 3300048908 | Bacteria | 212909 |
| 420 | Ga0496106_0048714 | 3300048909 | Bacteria | 3192 |
| 421 | Ga0496108_0072223 | 3300048911 | Bacteria | 2913 |
| 422 | Ga0496109_0084314 | 3300048912 | Bacteria | 2932 |
| 423 | Ga0496113_0086252 | 3300048916 | Bacteria | 2412 |
| 424 | Ga0496115_0000123 | 3300048918 | Bacteria | 70348 |
| 425 | Ga0496115_0000127 | 3300048918 | Bacteria | 68926 |
| 426 | Ga0496116_0000039 | 3300048919 | Bacteria | 349134 |
| 427 | Ga0496117_0061865 | 3300048920 | Bacteria | 2570 |
| 428 | Ga0496118_0005341 | 3300048921 | Bacteria | 14638 |
| 429 | Ga0496118_0014069 | 3300048921 | Bacteria | 7511 |
| 430 | Ga0496118_0027227 | 3300048921 | Bacteria | 4844 |
| 431 | Ga0496118_0072201 | 3300048921 | Bacteria | 2480 |
| 432 | Ga0496118_0136005 | 3300048921 | Bacteria | 1568 |
| 433 | Ga0496121_0000147 | 3300048924 | Bacteria | 154342 |
| 434 | Ga0496121_0000248 | 3300048924 | Bacteria | 114460 |
| 435 | Ga0496122_0003069 | 3300048925 | Bacteria | 22525 |
| 436 | Ga0496122_0035627 | 3300048925 | Bacteria | 4043 |
| 437 | Ga0496123_0002020 | 3300048926 | Bacteria | 26197 |
| 438 | Ga0496123_0007652 | 3300048926 | Bacteria | 10109 |
| 439 | Ga0496124_0007676 | 3300048927 | Bacteria | 11412 |
| 440 | Ga0496124_0096522 | 3300048927 | Bacteria | 2401 |
| 441 | Ga0496125_0030423 | 3300048928 | Bacteria | 4831 |
| 442 | Ga0496125_0063893 | 3300048928 | Bacteria | 2931 |
| 443 | Ga0496125_0148461 | 3300048928 | Bacteria | 1615 |
| 444 | Ga0496126_0000185 | 3300048929 | Bacteria | 140051 |
| 445 | Ga0496126_0001292 | 3300048929 | Bacteria | 40032 |
| 446 | Ga0496126_0166137 | 3300048929 | Bacteria | 1883 |
| 447 | Ga0501032_0002816 | 3300049569 | Bacteria | 13525 |
| 448 | Ga0501032_0010024 | 3300049569 | Bacteria | 6840 |
| 449 | Ga0501033_0000329 | 3300049570 | Bacteria | 45324 |
| 450 | Ga0501033_0023149 | 3300049570 | Bacteria | 4684 |
| 451 | Ga0501034_0014426 | 3300049571 | Bacteria | 8136 |
| 452 | Ga0501036_0014176 | 3300049572 | Bacteria | 6631 |
| 453 | Ga0501037_0000815 | 3300049573 | Bacteria | 23310 |
| 454 | Ga0501038_0003503 | 3300049574 | Bacteria | 14613 |
| 455 | Ga0501038_0023794 | 3300049574 | Bacteria | 5472 |
| 456 | Ga0501038_0047155 | 3300049574 | Bacteria | 3733 |
| 457 | Ga0501039_0007089 | 3300049575 | Bacteria | 8538 |
| 458 | Ga0501039_0069538 | 3300049575 | Bacteria | 2734 |
| 459 | Ga0501041_0003593 | 3300049577 | Bacteria | 8922 |
| 460 | Ga0501043_0004404 | 3300049579 | Bacteria | 11439 |
| 461 | Ga0501043_0233302 | 3300049579 | Bacteria | 1421 |
| 462 | Ga0501046_0069803 | 3300049580 | Bacteria | 2733 |
| 463 | Ga0501047_0003926 | 3300049581 | Bacteria | 13971 |
| 464 | Ga0501047_0018202 | 3300049581 | Bacteria | 6732 |
| 465 | Ga0501067_0005300 | 3300049583 | Bacteria | 7163 |
| 466 | Ga0501067_0047450 | 3300049583 | Bacteria | 2382 |
| 467 | Ga0501068_0002075 | 3300049584 | Bacteria | 10681 |
| 468 | Ga0501068_0028273 | 3300049584 | Bacteria | 3315 |
| 469 | Ga0501069_0004652 | 3300049585 | Bacteria | 7093 |
| 470 | Ga0501069_0098246 | 3300049585 | Bacteria | 1660 |
| 471 | Ga0501071_0014415 | 3300049587 | Bacteria | 5407 |
| 472 | Ga0501071_0020499 | 3300049587 | Bacteria | 4595 |
| 473 | Ga0501072_0058773 | 3300049588 | Bacteria | 3030 |
| 474 | Ga0501072_0094477 | 3300049588 | Bacteria | 2376 |
| 475 | Ga0501073_0005069 | 3300049589 | Bacteria | 9879 |
| 476 | Ga0501073_0006164 | 3300049589 | Bacteria | 8950 |
| 477 | Ga0501074_0004513 | 3300049590 | Bacteria | 9965 |
| 478 | Ga0501074_0012183 | 3300049590 | Bacteria | 6251 |
| 479 | Ga0501074_0096077 | 3300049590 | Bacteria | 2122 |
| 480 | Ga0501075_0002474 | 3300049591 | Bacteria | 12320 |
| 481 | Ga0501076_0004871 | 3300049592 | Bacteria | 9594 |
| 482 | Ga0501079_0014213 | 3300049741 | Bacteria | 6070 |
| 483 | Ga0501079_0047389 | 3300049741 | Bacteria | 3316 |
| 484 | Ga0501079_0075386 | 3300049741 | Bacteria | 2608 |
| 485 | Ga0501080_0010166 | 3300049742 | Bacteria | 8604 |
| 486 | Ga0501080_0040536 | 3300049742 | Bacteria | 4343 |
| 487 | Ga0501080_0054204 | 3300049742 | Bacteria | 3734 |
| 488 | Ga0501080_0069603 | 3300049742 | Bacteria | 3273 |
| 489 | Ga0501080_0148241 | 3300049742 | Bacteria | 2169 |
| 490 | Ga0501081_0009626 | 3300049743 | Bacteria | 6298 |
| 491 | Ga0501083_0067366 | 3300049744 | Bacteria | 2383 |
| 492 | Ga0501083_0074497 | 3300049744 | Bacteria | 2255 |
| 493 | Ga0501035_0156314 | 3300049822 | Bacteria | 1976 |
| 494 | Ga0501044_0016877 | 3300049823 | Bacteria | 7834 |
| 495 | Ga0501044_0034372 | 3300049823 | Bacteria | 5316 |
| 496 | Ga0501044_0131375 | 3300049823 | Bacteria | 2498 |
| 497 | Ga0501044_0186366 | 3300049823 | Bacteria | 2039 |
| 498 | Ga0501045_0048418 | 3300049824 | Bacteria | 3099 |
| 499 | Ga0501045_0061914 | 3300049824 | Bacteria | 2746 |
| 500 | Ga0501045_0086356 | 3300049824 | Bacteria | 2316 |
| 501 | nmdc:mga05p37_1249_c1 | 3300050507 | Bacteria | 29520 |
| 502 | nmdc:mga05p37_216945_c1 | 3300050507 | Bacteria | 2310 |
| 503 | nmdc:mga05p37_72423_c1 | 3300050507 | Bacteria | 4240 |
| 504 | nmdc:mga05p37_99156_c1 | 3300050507 | Bacteria | 3589 |
| 505 | nmdc:mga09592_131875_c1 | 3300050508 | Bacteria | 2151 |
| 506 | nmdc:mga09592_15383_c1 | 3300050508 | Bacteria | 6249 |
| 507 | nmdc:mga09592_248690_c1 | 3300050508 | Bacteria | 1541 |
| 508 | nmdc:mga09592_619_c1 | 3300050508 | Bacteria | 27079 |
| 509 | nmdc:mga0qj67_2796_c1 | 3300050509 | Bacteria | 12520 |
| 510 | nmdc:mga0qj67_444_c1 | 3300050509 | Bacteria | 28230 |
| 511 | nmdc:mga06r32_155459_c1 | 3300050510 | Bacteria | 2268 |
| 512 | nmdc:mga06r32_1942_c1 | 3300050510 | Bacteria | 18424 |
| 513 | nmdc:mga06r32_233042_c1 | 3300050510 | Bacteria | 1829 |
| 514 | nmdc:mga06r32_450_c1 | 3300050510 | Bacteria | 34949 |
| 515 | nmdc:mga06r32_63_c1 | 3300050510 | Bacteria | 68165 |
| 516 | nmdc:mga08y16_254_c1 | 3300050511 | Bacteria | 48008 |
| 517 | nmdc:mga08y16_261384_c1 | 3300050511 | Bacteria | 1787 |
| 518 | nmdc:mga08y16_381084_c1 | 3300050511 | Bacteria | 1446 |
| 519 | nmdc:mga08y16_55406_c1 | 3300050511 | Bacteria | 4143 |
| 520 | nmdc:mga0n895_331619_c1 | 3300050512 | Bacteria | 1541 |
| 521 | Ga0500643_001692 | 3300053087 | Bacteria | 12255 |
| 522 | Ga0500643_013071 | 3300053087 | Bacteria | 2947 |
| 523 | Ga0500566_0004070 | 3300053094 | Bacteria | 8705 |
| 524 | Ga0500566_0021562 | 3300053094 | Bacteria | 3785 |
| 525 | Ga0500641_0039552 | 3300053096 | Bacteria | 1901 |
| 526 | Ga0500555_000034 | 3300053103 | Bacteria | 82796 |
| 527 | Ga0500555_012142 | 3300053103 | Bacteria | 2477 |
| 528 | Ga0500569_007134 | 3300053109 | Unclassified | 2494 |
| 529 | Ga0500592_006066 | 3300053116 | Bacteria | 1924 |
| 530 | Ga0500626_101768 | 3300053128 | Bacteria | 1251 |
| 531 | Ga0500658_0001214 | 3300053134 | Bacteria | 10475 |
| 532 | Ga0500658_0001253 | 3300053134 | Bacteria | 10292 |
| 533 | Ga0500658_0050600 | 3300053134 | Bacteria | 1696 |
| 534 | Ga0500658_0071297 | 3300053134 | Bacteria | 1467 |
| 535 | Ga0500568_0000179 | 3300053139 | Bacteria | 55301 |
| 536 | Ga0500568_0000884 | 3300053139 | Bacteria | 20977 |
| 537 | Ga0500568_0003290 | 3300053139 | Bacteria | 9115 |
| 538 | Ga0500568_0016680 | 3300053139 | Bacteria | 3257 |
| 539 | Ga0500573_0000010 | 3300053140 | Bacteria | 210704 |
| 540 | Ga0500588_0002054 | 3300053146 | Bacteria | 4008 |
| 541 | Ga0500590_053889 | 3300053148 | Bacteria | 2038 |
| 542 | Ga0500627_0000001 | 3300053158 | Bacteria | 251552 |
| 543 | Ga0500627_0002161 | 3300053158 | Bacteria | 5724 |
| 544 | Ga0501084_0005608 | 3300054114 | Bacteria | 10307 |
| 545 | Ga0501084_0062233 | 3300054114 | Bacteria | 3124 |
| 546 | Ga0501084_0125449 | 3300054114 | Bacteria | 2160 |
| 547 | Ga0501082_0002143 | 3300060353 | Bacteria | 17305 |
| 548 | Ga0501082_0002981 | 3300060353 | Bacteria | 14786 |
| 549 | Ga0501082_0177121 | 3300060353 | Bacteria | 1854 |
| 550 | Ga0530510_0069565 | 3300061734 | Bacteria | 2554 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045049 | Ga0466959_0018673 | Ga0466959_0018673_598_1608 | 312 |
| 2 | 3300048912 | Ga0496109_0084314 | Ga0496109_0084314_245_1261 | 314 |
| 3 | 3300013308 | Ga0157375_10137437 | Ga0157375_101374372 | 315 |
| 4 | 3300005616 | Ga0068852_100290638 | Ga0068852_1002906382 | 316 |
| 5 | 3300005841 | Ga0068863_100030711 | Ga0068863_1000307112 | 316 |
| 6 | 3300006237 | Ga0097621_100024669 | Ga0097621_1000246692 | 316 |
| 7 | 3300006358 | Ga0068871_100051777 | Ga0068871_1000517772 | 316 |
| 8 | 3300014969 | Ga0157376_10033821 | Ga0157376_100338213 | 316 |
| 9 | 3300025931 | Ga0207644_10078015 | Ga0207644_100780152 | 316 |
| 10 | 3300026088 | Ga0207641_10025983 | Ga0207641_100259832 | 316 |
| 11 | 3300026121 | Ga0207683_10161832 | Ga0207683_101618322 | 316 |
| 12 | 3300048904 | Ga0496101_0175749 | Ga0496101_0175749_389_1429 | 316 |
| 13 | 3300048919 | Ga0496116_0000039 | Ga0496116_0000039_29249_30289 | 316 |
| 14 | 3300048920 | Ga0496117_0061865 | Ga0496117_0061865_1360_2400 | 316 |
| 15 | 3300048921 | Ga0496118_0136005 | Ga0496118_0136005_170_1210 | 316 |
| 16 | 3300048925 | Ga0496122_0003069 | Ga0496122_0003069_13150_14190 | 316 |
| 17 | 3300048926 | Ga0496123_0002020 | Ga0496123_0002020_8336_9376 | 316 |
| 18 | 3300048929 | Ga0496126_0001292 | Ga0496126_0001292_13647_14687 | 316 |
| 19 | 3300053134 | Ga0500658_0071297 | Ga0500658_0071297_148_1122 | 316 |
| 20 | 3300048927 | Ga0496124_0007676 | Ga0496124_0007676_9735_10775 | 317 |
| 21 | 3300048928 | Ga0496125_0030423 | Ga0496125_0030423_601_1641 | 317 |
| 22 | 3300049580 | Ga0501046_0069803 | Ga0501046_0069803_55_1095 | 320 |
| 23 | 3300049742 | Ga0501080_0069603 | Ga0501080_0069603_1347_2387 | 320 |
| 24 | 3300049823 | Ga0501044_0131375 | Ga0501044_0131375_1222_2262 | 320 |
| 25 | 3300054114 | Ga0501084_0062233 | Ga0501084_0062233_968_2008 | 320 |
| 26 | 3300060353 | Ga0501082_0002143 | Ga0501082_0002143_13975_15015 | 320 |
| 27 | 3300028379 | Ga0268266_10158720 | Ga0268266_101587202 | 322 |
| 28 | 3300049741 | Ga0501079_0047389 | Ga0501079_0047389_1779_2843 | 322 |
| 29 | 3300060353 | Ga0501082_0177121 | Ga0501082_0177121_26_1090 | 322 |
| 30 | 3300025942 | Ga0207689_10321950 | Ga0207689_103219502 | 325 |
| 31 | 3300028036 | Ga0265355_1003744 | Ga0265355_10037441 | 325 |
| 32 | 3300048906 | Ga0496103_0028932 | Ga0496103_0028932_2139_3194 | 326 |
| 33 | 3300048921 | Ga0496118_0027227 | Ga0496118_0027227_979_2034 | 326 |
| 34 | 3300053139 | Ga0500568_0000179 | Ga0500568_0000179_1316_2332 | 326 |
| 35 | 3300028017 | Ga0265356_1002953 | Ga0265356_10029532 | 327 |
| 36 | 3300030878 | Ga0265770_1011066 | Ga0265770_10110662 | 327 |
| 37 | 3300031090 | Ga0265760_10000405 | Ga0265760_100004058 | 327 |
| 38 | 3300053116 | Ga0500592_006066 | Ga0500592_006066_14_997 | 327 |
| 39 | 3300053158 | Ga0500627_0000001 | Ga0500627_0000001_199609_200649 | 327 |
| 40 | 3300053139 | Ga0500568_0016680 | Ga0500568_0016680_1617_2666 | 328 |
| 41 | iso_pu_bacteria | 2643221622 | 2644128922 | 329 |
| 42 | 3300031901 | Ga0307406_10104578 | Ga0307406_101045782 | 330 |
| 43 | 3300032004 | Ga0307414_10022597 | Ga0307414_100225973 | 330 |
| 44 | 3300049570 | Ga0501033_0023149 | Ga0501033_0023149_319_1374 | 331 |
| 45 | 3300049575 | Ga0501039_0069538 | Ga0501039_0069538_1463_2518 | 331 |
| 46 | 3300049822 | Ga0501035_0156314 | Ga0501035_0156314_391_1446 | 331 |
| 47 | 3300049823 | Ga0501044_0186366 | Ga0501044_0186366_389_1444 | 331 |
| 48 | 3300049824 | Ga0501045_0061914 | Ga0501045_0061914_1321_2376 | 331 |
| 49 | 3300053134 | Ga0500658_0001214 | Ga0500658_0001214_2564_3565 | 333 |
| 50 | 3300025906 | Ga0207699_10077829 | Ga0207699_100778292 | 334 |
| 51 | 3300031824 | Ga0307413_10336716 | Ga0307413_103367161 | 334 |
| 52 | 3300048929 | Ga0496126_0166137 | Ga0496126_0166137_56_1111 | 334 |
| 53 | 3300003781 | Ga0055536_1001466 | Ga0055536_10014668 | 335 |
| 54 | 3300003781 | Ga0055536_1015188 | Ga0055536_10151882 | 335 |
| 55 | 3300003791 | Ga0055530_10023840 | Ga0055530_100238402 | 335 |
| 56 | 3300005341 | Ga0070691_10109888 | Ga0070691_101098882 | 335 |
| 57 | 3300005347 | Ga0070668_100045018 | Ga0070668_1000450183 | 335 |
| 58 | 3300005353 | Ga0070669_100013818 | Ga0070669_1000138182 | 335 |
| 59 | 3300005457 | Ga0070662_100004914 | Ga0070662_1000049143 | 335 |
| 60 | 3300005458 | Ga0070681_10177753 | Ga0070681_101777532 | 335 |
| 61 | 3300005719 | Ga0068861_100000366 | Ga0068861_1000003663 | 335 |
| 62 | 3300005840 | Ga0068870_10018123 | Ga0068870_100181232 | 335 |
| 63 | 3300005844 | Ga0068862_100000722 | Ga0068862_10000072234 | 335 |
| 64 | 3300006844 | Ga0075428_100000920 | Ga0075428_1000009208 | 335 |
| 65 | 3300006844 | Ga0075428_100282823 | Ga0075428_1002828232 | 335 |
| 66 | 3300006846 | Ga0075430_100004783 | Ga0075430_1000047832 | 335 |
| 67 | 3300006846 | Ga0075430_100060288 | Ga0075430_1000602883 | 335 |
| 68 | 3300006846 | Ga0075430_100141229 | Ga0075430_1001412292 | 335 |
| 69 | 3300006847 | Ga0075431_100000221 | Ga0075431_1000002213 | 335 |
| 70 | 3300006847 | Ga0075431_100000267 | Ga0075431_10000026731 | 335 |
| 71 | 3300009094 | Ga0111539_10000989 | Ga0111539_1000098933 | 335 |
| 72 | 3300009094 | Ga0111539_10007571 | Ga0111539_100075719 | 335 |
| 73 | 3300009094 | Ga0111539_10401226 | Ga0111539_104012262 | 335 |
| 74 | 3300009098 | Ga0105245_10153917 | Ga0105245_101539172 | 335 |
| 75 | 3300009147 | Ga0114129_10079198 | Ga0114129_100791982 | 335 |
| 76 | 3300009545 | Ga0105237_10073498 | Ga0105237_100734982 | 335 |
| 77 | 3300009551 | Ga0105238_10144200 | Ga0105238_101442003 | 335 |
| 78 | 3300009553 | Ga0105249_10001944 | Ga0105249_100019442 | 335 |
| 79 | 3300013306 | Ga0163162_10369090 | Ga0163162_103690902 | 335 |
| 80 | 3300025912 | Ga0207707_10160951 | Ga0207707_101609512 | 335 |
| 81 | 3300025914 | Ga0207671_10102256 | Ga0207671_101022562 | 335 |
| 82 | 3300025923 | Ga0207681_10004757 | Ga0207681_100047572 | 335 |
| 83 | 3300025932 | Ga0207690_10121698 | Ga0207690_101216982 | 335 |
| 84 | 3300025933 | Ga0207706_10004158 | Ga0207706_100041583 | 335 |
| 85 | 3300025935 | Ga0207709_10070099 | Ga0207709_100700992 | 335 |
| 86 | 3300025972 | Ga0207668_10241018 | Ga0207668_102410182 | 335 |
| 87 | 3300026116 | Ga0207674_10127050 | Ga0207674_101270502 | 335 |
| 88 | 3300026118 | Ga0207675_100000736 | Ga0207675_1000007368 | 335 |
| 89 | 3300027907 | Ga0207428_10002156 | Ga0207428_1000215616 | 335 |
| 90 | 3300027907 | Ga0207428_10018186 | Ga0207428_100181861 | 335 |
| 91 | 3300028380 | Ga0268265_10000547 | Ga0268265_1000054734 | 335 |
| 92 | 3300031507 | Ga0307509_10000003 | Ga0307509_10000003418 | 335 |
| 93 | 3300031548 | Ga0307408_100021968 | Ga0307408_1000219683 | 335 |
| 94 | 3300031548 | Ga0307408_100051994 | Ga0307408_1000519942 | 335 |
| 95 | 3300031901 | Ga0307406_10121945 | Ga0307406_101219452 | 335 |
| 96 | 3300032002 | Ga0307416_100041648 | Ga0307416_1000416483 | 335 |
| 97 | 3300032126 | Ga0307415_100130236 | Ga0307415_1001302362 | 335 |
| 98 | 3300049588 | Ga0501072_0094477 | Ga0501072_0094477_1299_2318 | 335 |
| 99 | 3300050507 | nmdc:mga05p37_72423_c1 | nmdc:mga05p37_72423_c1_2578_3594 | 335 |
| 100 | 3300050507 | nmdc:mga05p37_99156_c1 | nmdc:mga05p37_99156_c1_949_1956 | 335 |
| 101 | 3300050508 | nmdc:mga09592_131875_c1 | nmdc:mga09592_131875_c1_448_1464 | 335 |
| 102 | 3300050508 | nmdc:mga09592_15383_c1 | nmdc:mga09592_15383_c1_503_1519 | 335 |
| 103 | 3300050509 | nmdc:mga0qj67_2796_c1 | nmdc:mga0qj67_2796_c1_11253_12272 | 335 |
| 104 | 3300050510 | nmdc:mga06r32_1942_c1 | nmdc:mga06r32_1942_c1_10269_11288 | 335 |
| 105 | 3300050510 | nmdc:mga06r32_63_c1 | nmdc:mga06r32_63_c1_26589_27605 | 335 |
| 106 | 3300050511 | nmdc:mga08y16_254_c1 | nmdc:mga08y16_254_c1_21719_22735 | 335 |
| 107 | 3300050511 | nmdc:mga08y16_55406_c1 | nmdc:mga08y16_55406_c1_2372_3391 | 335 |
| 108 | 3300005367 | Ga0070667_100165132 | Ga0070667_1001651322 | 336 |
| 109 | 3300005367 | Ga0070667_100235003 | Ga0070667_1002350032 | 336 |
| 110 | 3300005548 | Ga0070665_100004102 | Ga0070665_1000041028 | 336 |
| 111 | 3300005548 | Ga0070665_100008614 | Ga0070665_1000086142 | 336 |
| 112 | 3300005548 | Ga0070665_100030126 | Ga0070665_1000301262 | 336 |
| 113 | 3300005844 | Ga0068862_100276589 | Ga0068862_1002765892 | 336 |
| 114 | 3300009093 | Ga0105240_10010664 | Ga0105240_1001066410 | 336 |
| 115 | 3300025913 | Ga0207695_10206882 | Ga0207695_102068822 | 336 |
| 116 | 3300025924 | Ga0207694_10148020 | Ga0207694_101480202 | 336 |
| 117 | 3300025961 | Ga0207712_10062960 | Ga0207712_100629602 | 336 |
| 118 | 3300025972 | Ga0207668_10301709 | Ga0207668_103017091 | 336 |
| 119 | 3300025986 | Ga0207658_10138969 | Ga0207658_101389692 | 336 |
| 120 | 3300028379 | Ga0268266_10000796 | Ga0268266_100007967 | 336 |
| 121 | 3300028379 | Ga0268266_10000890 | Ga0268266_1000089028 | 336 |
| 122 | 3300028380 | Ga0268265_10045506 | Ga0268265_100455062 | 336 |
| 123 | 3300031507 | Ga0307509_10000021 | Ga0307509_10000021191 | 336 |
| 124 | 3300033180 | Ga0307510_10000002 | Ga0307510_1000000298 | 336 |
| 125 | 3300002774 | JGI25150J39212_1000044 | JGI25150J39212_100004431 | 337 |
| 126 | 3300003203 | JGI25406J46586_10003744 | JGI25406J46586_100037445 | 337 |
| 127 | 3300003215 | JGI25153J46596_10000043 | JGI25153J46596_1000004340 | 337 |
| 128 | 3300003771 | Ga0055526_1005425 | Ga0055526_10054253 | 337 |
| 129 | 3300003773 | Ga0055537_1001605 | Ga0055537_10016056 | 337 |
| 130 | 3300003791 | Ga0055530_10021805 | Ga0055530_100218051 | 337 |
| 131 | 3300003791 | Ga0055530_10041273 | Ga0055530_100412731 | 337 |
| 132 | 3300003792 | Ga0055540_1006239 | Ga0055540_10062391 | 337 |
| 133 | 3300003794 | Ga0055531_10024604 | Ga0055531_100246042 | 337 |
| 134 | 3300003794 | Ga0055531_10024606 | Ga0055531_100246062 | 337 |
| 135 | 3300005262 | Ga0065165_1007814 | Ga0065165_10078142 | 337 |
| 136 | 3300005330 | Ga0070690_100052877 | Ga0070690_1000528772 | 337 |
| 137 | 3300005331 | Ga0070670_100148246 | Ga0070670_1001482462 | 337 |
| 138 | 3300005331 | Ga0070670_100279037 | Ga0070670_1002790372 | 337 |
| 139 | 3300005335 | Ga0070666_10001021 | Ga0070666_1000102111 | 337 |
| 140 | 3300005337 | Ga0070682_100063474 | Ga0070682_1000634742 | 337 |
| 141 | 3300005338 | Ga0068868_100038055 | Ga0068868_1000380552 | 337 |
| 142 | 3300005340 | Ga0070689_100005710 | Ga0070689_1000057102 | 337 |
| 143 | 3300005343 | Ga0070687_100020844 | Ga0070687_1000208442 | 337 |
| 144 | 3300005344 | Ga0070661_100006044 | Ga0070661_1000060445 | 337 |
| 145 | 3300005344 | Ga0070661_100087735 | Ga0070661_1000877352 | 337 |
| 146 | 3300005344 | Ga0070661_100111003 | Ga0070661_1001110032 | 337 |
| 147 | 3300005353 | Ga0070669_100144466 | Ga0070669_1001444662 | 337 |
| 148 | 3300005354 | Ga0070675_100198646 | Ga0070675_1001986462 | 337 |
| 149 | 3300005354 | Ga0070675_100288289 | Ga0070675_1002882892 | 337 |
| 150 | 3300005367 | Ga0070667_100099738 | Ga0070667_1000997382 | 337 |
| 151 | 3300005440 | Ga0070705_100020633 | Ga0070705_1000206332 | 337 |
| 152 | 3300005441 | Ga0070700_100020690 | Ga0070700_1000206902 | 337 |
| 153 | 3300005456 | Ga0070678_100110169 | Ga0070678_1001101692 | 337 |
| 154 | 3300005457 | Ga0070662_100002305 | Ga0070662_1000023057 | 337 |
| 155 | 3300005457 | Ga0070662_100070678 | Ga0070662_1000706782 | 337 |
| 156 | 3300005458 | Ga0070681_10003155 | Ga0070681_1000315515 | 337 |
| 157 | 3300005459 | Ga0068867_100368207 | Ga0068867_1003682071 | 337 |
| 158 | 3300005466 | Ga0070685_10000152 | Ga0070685_1000015223 | 337 |
| 159 | 3300005466 | Ga0070685_10001858 | Ga0070685_100018583 | 337 |
| 160 | 3300005539 | Ga0068853_100032342 | Ga0068853_1000323423 | 337 |
| 161 | 3300005539 | Ga0068853_100044493 | Ga0068853_1000444932 | 337 |
| 162 | 3300005539 | Ga0068853_100068560 | Ga0068853_1000685602 | 337 |
| 163 | 3300005539 | Ga0068853_100316742 | Ga0068853_1003167422 | 337 |
| 164 | 3300005544 | Ga0070686_100002514 | Ga0070686_1000025146 | 337 |
| 165 | 3300005548 | Ga0070665_100000928 | Ga0070665_1000009287 | 337 |
| 166 | 3300005548 | Ga0070665_100007710 | Ga0070665_1000077105 | 337 |
| 167 | 3300005548 | Ga0070665_100009713 | Ga0070665_1000097132 | 337 |
| 168 | 3300005548 | Ga0070665_100104488 | Ga0070665_1001044882 | 337 |
| 169 | 3300005563 | Ga0068855_100069899 | Ga0068855_1000698992 | 337 |
| 170 | 3300005578 | Ga0068854_100006701 | Ga0068854_1000067012 | 337 |
| 171 | 3300005615 | Ga0070702_100021737 | Ga0070702_1000217372 | 337 |
| 172 | 3300005617 | Ga0068859_100002362 | Ga0068859_1000023622 | 337 |
| 173 | 3300005618 | Ga0068864_100029869 | Ga0068864_1000298692 | 337 |
| 174 | 3300005718 | Ga0068866_10146072 | Ga0068866_101460722 | 337 |
| 175 | 3300005719 | Ga0068861_100000062 | Ga0068861_10000006229 | 337 |
| 176 | 3300005834 | Ga0068851_10007007 | Ga0068851_100070072 | 337 |
| 177 | 3300005841 | Ga0068863_100246254 | Ga0068863_1002462542 | 337 |
| 178 | 3300005842 | Ga0068858_100002262 | Ga0068858_1000022622 | 337 |
| 179 | 3300005843 | Ga0068860_100006757 | Ga0068860_1000067575 | 337 |
| 180 | 3300005985 | Ga0081539_10000004 | Ga0081539_10000004119 | 337 |
| 181 | 3300006237 | Ga0097621_100019694 | Ga0097621_1000196942 | 337 |
| 182 | 3300006237 | Ga0097621_100137657 | Ga0097621_1001376571 | 337 |
| 183 | 3300006846 | Ga0075430_100008166 | Ga0075430_1000081665 | 337 |
| 184 | 3300006847 | Ga0075431_100003861 | Ga0075431_1000038614 | 337 |
| 185 | 3300006871 | Ga0075434_100213628 | Ga0075434_1002136282 | 337 |
| 186 | 3300006880 | Ga0075429_100003103 | Ga0075429_1000031033 | 337 |
| 187 | 3300006881 | Ga0068865_100023649 | Ga0068865_1000236492 | 337 |
| 188 | 3300006931 | Ga0097620_100002362 | Ga0097620_1000023622 | 337 |
| 189 | 3300009093 | Ga0105240_10016387 | Ga0105240_100163879 | 337 |
| 190 | 3300009094 | Ga0111539_10025836 | Ga0111539_100258362 | 337 |
| 191 | 3300009094 | Ga0111539_10127795 | Ga0111539_101277952 | 337 |
| 192 | 3300009098 | Ga0105245_10078920 | Ga0105245_100789202 | 337 |
| 193 | 3300009101 | Ga0105247_10059784 | Ga0105247_100597842 | 337 |
| 194 | 3300009147 | Ga0114129_10003655 | Ga0114129_100036554 | 337 |
| 195 | 3300009147 | Ga0114129_10247926 | Ga0114129_102479262 | 337 |
| 196 | 3300009177 | Ga0105248_10037039 | Ga0105248_100370392 | 337 |
| 197 | 3300009545 | Ga0105237_10037935 | Ga0105237_100379352 | 337 |
| 198 | 3300009545 | Ga0105237_10291681 | Ga0105237_102916811 | 337 |
| 199 | 3300009551 | Ga0105238_10004676 | Ga0105238_100046766 | 337 |
| 200 | 3300009551 | Ga0105238_10025058 | Ga0105238_100250582 | 337 |
| 201 | 3300009551 | Ga0105238_10069026 | Ga0105238_100690262 | 337 |
| 202 | 3300009551 | Ga0105238_10179831 | Ga0105238_101798312 | 337 |
| 203 | 3300009553 | Ga0105249_10018875 | Ga0105249_100188752 | 337 |
| 204 | 3300009553 | Ga0105249_10029931 | Ga0105249_100299312 | 337 |
| 205 | 3300009553 | Ga0105249_10041664 | Ga0105249_100416642 | 337 |
| 206 | 3300010375 | Ga0105239_10029287 | Ga0105239_100292872 | 337 |
| 207 | 3300013105 | Ga0157369_10011583 | Ga0157369_100115834 | 337 |
| 208 | 3300013306 | Ga0163162_10000004 | Ga0163162_10000004386 | 337 |
| 209 | 3300013306 | Ga0163162_10298450 | Ga0163162_102984502 | 337 |
| 210 | 3300013308 | Ga0157375_10001172 | Ga0157375_1000117213 | 337 |
| 211 | 3300013308 | Ga0157375_10206807 | Ga0157375_102068072 | 337 |
| 212 | 3300014325 | Ga0163163_10004078 | Ga0163163_100040784 | 337 |
| 213 | 3300014497 | Ga0182008_10110260 | Ga0182008_101102601 | 337 |
| 214 | 3300014745 | Ga0157377_10003544 | Ga0157377_100035446 | 337 |
| 215 | 3300014968 | Ga0157379_10033075 | Ga0157379_100330752 | 337 |
| 216 | 3300014968 | Ga0157379_10179162 | Ga0157379_101791622 | 337 |
| 217 | 3300014969 | Ga0157376_10032388 | Ga0157376_100323882 | 337 |
| 218 | 3300025245 | Ga0207425_1000047 | Ga0207425_1000047110 | 337 |
| 219 | 3300025258 | Ga0209129_1000497 | Ga0209129_10004972 | 337 |
| 220 | 3300025263 | Ga0209565_1000089 | Ga0209565_100008968 | 337 |
| 221 | 3300025292 | Ga0209676_1004605 | Ga0209676_10046052 | 337 |
| 222 | 3300025292 | Ga0209676_1007388 | Ga0209676_10073883 | 337 |
| 223 | 3300025294 | Ga0209025_1000150 | Ga0209025_100015040 | 337 |
| 224 | 3300025295 | Ga0209564_1001696 | Ga0209564_10016967 | 337 |
| 225 | 3300025297 | Ga0209758_1000009 | Ga0209758_1000009838 | 337 |
| 226 | 3300025298 | Ga0209050_1000005 | Ga0209050_1000005329 | 337 |
| 227 | 3300025298 | Ga0209050_1008503 | Ga0209050_10085033 | 337 |
| 228 | 3300025303 | Ga0209051_1000396 | Ga0209051_10003964 | 337 |
| 229 | 3300025303 | Ga0209051_1004840 | Ga0209051_10048406 | 337 |
| 230 | 3300025304 | Ga0209257_1000337 | Ga0209257_100033782 | 337 |
| 231 | 3300025304 | Ga0209257_1001283 | Ga0209257_100128319 | 337 |
| 232 | 3300025321 | Ga0207656_10068433 | Ga0207656_100684331 | 337 |
| 233 | 3300025321 | Ga0207656_10090192 | Ga0207656_100901922 | 337 |
| 234 | 3300025901 | Ga0207688_10024861 | Ga0207688_100248612 | 337 |
| 235 | 3300025903 | Ga0207680_10098946 | Ga0207680_100989462 | 337 |
| 236 | 3300025904 | Ga0207647_10010944 | Ga0207647_100109445 | 337 |
| 237 | 3300025911 | Ga0207654_10165274 | Ga0207654_101652741 | 337 |
| 238 | 3300025912 | Ga0207707_10189494 | Ga0207707_101894941 | 337 |
| 239 | 3300025913 | Ga0207695_10000082 | Ga0207695_1000008253 | 337 |
| 240 | 3300025913 | Ga0207695_10019407 | Ga0207695_100194072 | 337 |
| 241 | 3300025913 | Ga0207695_10022352 | Ga0207695_100223522 | 337 |
| 242 | 3300025913 | Ga0207695_10180159 | Ga0207695_101801592 | 337 |
| 243 | 3300025914 | Ga0207671_10013633 | Ga0207671_100136335 | 337 |
| 244 | 3300025914 | Ga0207671_10180622 | Ga0207671_101806221 | 337 |
| 245 | 3300025918 | Ga0207662_10006576 | Ga0207662_100065762 | 337 |
| 246 | 3300025920 | Ga0207649_10092171 | Ga0207649_100921711 | 337 |
| 247 | 3300025920 | Ga0207649_10097669 | Ga0207649_100976691 | 337 |
| 248 | 3300025924 | Ga0207694_10000832 | Ga0207694_100008325 | 337 |
| 249 | 3300025924 | Ga0207694_10003663 | Ga0207694_100036635 | 337 |
| 250 | 3300025924 | Ga0207694_10009691 | Ga0207694_100096916 | 337 |
| 251 | 3300025926 | Ga0207659_10016381 | Ga0207659_100163812 | 337 |
| 252 | 3300025927 | Ga0207687_10207998 | Ga0207687_102079982 | 337 |
| 253 | 3300025931 | Ga0207644_10178680 | Ga0207644_101786802 | 337 |
| 254 | 3300025933 | Ga0207706_10001608 | Ga0207706_100016086 | 337 |
| 255 | 3300025933 | Ga0207706_10025788 | Ga0207706_100257882 | 337 |
| 256 | 3300025933 | Ga0207706_10097441 | Ga0207706_100974412 | 337 |
| 257 | 3300025934 | Ga0207686_10014243 | Ga0207686_100142433 | 337 |
| 258 | 3300025936 | Ga0207670_10030464 | Ga0207670_100304642 | 337 |
| 259 | 3300025938 | Ga0207704_10067079 | Ga0207704_100670792 | 337 |
| 260 | 3300025940 | Ga0207691_10164062 | Ga0207691_101640622 | 337 |
| 261 | 3300025941 | Ga0207711_10073099 | Ga0207711_100730992 | 337 |
| 262 | 3300025942 | Ga0207689_10014175 | Ga0207689_100141752 | 337 |
| 263 | 3300025945 | Ga0207679_10291434 | Ga0207679_102914341 | 337 |
| 264 | 3300025949 | Ga0207667_10447490 | Ga0207667_104474901 | 337 |
| 265 | 3300025960 | Ga0207651_10129805 | Ga0207651_101298052 | 337 |
| 266 | 3300025960 | Ga0207651_10137253 | Ga0207651_101372531 | 337 |
| 267 | 3300025961 | Ga0207712_10003759 | Ga0207712_100037593 | 337 |
| 268 | 3300025972 | Ga0207668_10010127 | Ga0207668_100101274 | 337 |
| 269 | 3300025981 | Ga0207640_10002942 | Ga0207640_100029426 | 337 |
| 270 | 3300025986 | Ga0207658_10062115 | Ga0207658_100621152 | 337 |
| 271 | 3300026023 | Ga0207677_10017144 | Ga0207677_100171443 | 337 |
| 272 | 3300026023 | Ga0207677_10054397 | Ga0207677_100543972 | 337 |
| 273 | 3300026035 | Ga0207703_10001706 | Ga0207703_1000170614 | 337 |
| 274 | 3300026035 | Ga0207703_10279642 | Ga0207703_102796422 | 337 |
| 275 | 3300026041 | Ga0207639_10000173 | Ga0207639_1000017317 | 337 |
| 276 | 3300026041 | Ga0207639_10047697 | Ga0207639_100476971 | 337 |
| 277 | 3300026067 | Ga0207678_10034501 | Ga0207678_100345012 | 337 |
| 278 | 3300026075 | Ga0207708_10022675 | Ga0207708_100226752 | 337 |
| 279 | 3300026088 | Ga0207641_10057654 | Ga0207641_100576542 | 337 |
| 280 | 3300026089 | Ga0207648_10025282 | Ga0207648_100252825 | 337 |
| 281 | 3300026089 | Ga0207648_10148662 | Ga0207648_101486622 | 337 |
| 282 | 3300026095 | Ga0207676_10070454 | Ga0207676_100704542 | 337 |
| 283 | 3300026116 | Ga0207674_10006655 | Ga0207674_100066552 | 337 |
| 284 | 3300026116 | Ga0207674_10015160 | Ga0207674_100151602 | 337 |
| 285 | 3300026116 | Ga0207674_10022806 | Ga0207674_100228064 | 337 |
| 286 | 3300026116 | Ga0207674_10084276 | Ga0207674_100842761 | 337 |
| 287 | 3300026118 | Ga0207675_100000614 | Ga0207675_10000061429 | 337 |
| 288 | 3300026118 | Ga0207675_100095114 | Ga0207675_1000951142 | 337 |
| 289 | 3300026118 | Ga0207675_100106504 | Ga0207675_1001065042 | 337 |
| 290 | 3300026121 | Ga0207683_10169408 | Ga0207683_101694082 | 337 |
| 291 | 3300026142 | Ga0207698_10055479 | Ga0207698_100554792 | 337 |
| 292 | 3300027907 | Ga0207428_10078567 | Ga0207428_100785672 | 337 |
| 293 | 3300028379 | Ga0268266_10000007 | Ga0268266_10000007320 | 337 |
| 294 | 3300028379 | Ga0268266_10001872 | Ga0268266_100018727 | 337 |
| 295 | 3300028379 | Ga0268266_10068644 | Ga0268266_100686442 | 337 |
| 296 | 3300028379 | Ga0268266_10187776 | Ga0268266_101877762 | 337 |
| 297 | 3300028380 | Ga0268265_10025331 | Ga0268265_100253313 | 337 |
| 298 | 3300028381 | Ga0268264_10000176 | Ga0268264_1000017684 | 337 |
| 299 | 3300028381 | Ga0268264_10004326 | Ga0268264_100043267 | 337 |
| 300 | 3300031548 | Ga0307408_100019644 | Ga0307408_1000196442 | 337 |
| 301 | 3300031616 | Ga0307508_10005849 | Ga0307508_100058494 | 337 |
| 302 | 3300031824 | Ga0307413_10183726 | Ga0307413_101837262 | 337 |
| 303 | 3300031901 | Ga0307406_10058025 | Ga0307406_100580252 | 337 |
| 304 | 3300032002 | Ga0307416_100007495 | Ga0307416_1000074953 | 337 |
| 305 | 3300035089 | Ga0373944_0032432 | Ga0373944_0032432_50_1099 | 337 |
| 306 | 3300036401 | Ga0373937_0281564 | Ga0373937_0281564_346_1389 | 337 |
| 307 | 3300038705 | Ga0237819_00302 | Ga0237819_00302_12105_13145 | 337 |
| 308 | 3300039145 | Ga0237816_00554 | Ga0237816_00554_731_1771 | 337 |
| 309 | 3300042005 | Ga0439448_0021987 | Ga0439448_0021987_196_1236 | 337 |
| 310 | 3300045049 | Ga0466959_0036457 | Ga0466959_0036457_1844_2857 | 337 |
| 311 | 3300046453 | Ga0495627_045249 | Ga0495627_045249_67_1104 | 337 |
| 312 | 3300046691 | Ga0495670_0000005 | Ga0495670_0000005_94000_95037 | 337 |
| 313 | 3300047470 | Ga0495681_0036416 | Ga0495681_0036416_1262_2299 | 337 |
| 314 | 3300048905 | Ga0496102_0100081 | Ga0496102_0100081_224_1261 | 337 |
| 315 | 3300048905 | Ga0496102_0311198 | Ga0496102_0311198_88_1125 | 337 |
| 316 | 3300048908 | Ga0496105_0000016 | Ga0496105_0000016_108214_109287 | 337 |
| 317 | 3300048909 | Ga0496106_0048714 | Ga0496106_0048714_549_1595 | 337 |
| 318 | 3300048911 | Ga0496108_0072223 | Ga0496108_0072223_1647_2693 | 337 |
| 319 | 3300048916 | Ga0496113_0086252 | Ga0496113_0086252_121_1167 | 337 |
| 320 | 3300048918 | Ga0496115_0000123 | Ga0496115_0000123_55009_56046 | 337 |
| 321 | 3300048918 | Ga0496115_0000127 | Ga0496115_0000127_44681_45718 | 337 |
| 322 | 3300048921 | Ga0496118_0014069 | Ga0496118_0014069_4089_5126 | 337 |
| 323 | 3300048921 | Ga0496118_0072201 | Ga0496118_0072201_50_1084 | 337 |
| 324 | 3300048924 | Ga0496121_0000147 | Ga0496121_0000147_2741_3787 | 337 |
| 325 | 3300048928 | Ga0496125_0063893 | Ga0496125_0063893_1307_2350 | 337 |
| 326 | 3300048929 | Ga0496126_0000185 | Ga0496126_0000185_22841_23878 | 337 |
| 327 | 3300049569 | Ga0501032_0002816 | Ga0501032_0002816_3202_4242 | 337 |
| 328 | 3300049569 | Ga0501032_0010024 | Ga0501032_0010024_2339_3364 | 337 |
| 329 | 3300049570 | Ga0501033_0000329 | Ga0501033_0000329_36061_37101 | 337 |
| 330 | 3300049571 | Ga0501034_0014426 | Ga0501034_0014426_4818_5852 | 337 |
| 331 | 3300049572 | Ga0501036_0014176 | Ga0501036_0014176_2454_3494 | 337 |
| 332 | 3300049573 | Ga0501037_0000815 | Ga0501037_0000815_14047_15087 | 337 |
| 333 | 3300049574 | Ga0501038_0003503 | Ga0501038_0003503_8646_9686 | 337 |
| 334 | 3300049574 | Ga0501038_0023794 | Ga0501038_0023794_707_1741 | 337 |
| 335 | 3300049574 | Ga0501038_0047155 | Ga0501038_0047155_2024_3064 | 337 |
| 336 | 3300049575 | Ga0501039_0007089 | Ga0501039_0007089_4928_5968 | 337 |
| 337 | 3300049579 | Ga0501043_0004404 | Ga0501043_0004404_2863_3903 | 337 |
| 338 | 3300049581 | Ga0501047_0003926 | Ga0501047_0003926_4738_5772 | 337 |
| 339 | 3300049581 | Ga0501047_0018202 | Ga0501047_0018202_2536_3576 | 337 |
| 340 | 3300049583 | Ga0501067_0005300 | Ga0501067_0005300_2109_3143 | 337 |
| 341 | 3300049583 | Ga0501067_0047450 | Ga0501067_0047450_764_1804 | 337 |
| 342 | 3300049584 | Ga0501068_0002075 | Ga0501068_0002075_7459_8499 | 337 |
| 343 | 3300049584 | Ga0501068_0028273 | Ga0501068_0028273_838_1872 | 337 |
| 344 | 3300049585 | Ga0501069_0004652 | Ga0501069_0004652_5945_6970 | 337 |
| 345 | 3300049585 | Ga0501069_0098246 | Ga0501069_0098246_408_1448 | 337 |
| 346 | 3300049587 | Ga0501071_0014415 | Ga0501071_0014415_2092_3132 | 337 |
| 347 | 3300049589 | Ga0501073_0005069 | Ga0501073_0005069_4643_5677 | 337 |
| 348 | 3300049589 | Ga0501073_0006164 | Ga0501073_0006164_7003_8043 | 337 |
| 349 | 3300049590 | Ga0501074_0004513 | Ga0501074_0004513_3264_4298 | 337 |
| 350 | 3300049590 | Ga0501074_0012183 | Ga0501074_0012183_333_1373 | 337 |
| 351 | 3300049741 | Ga0501079_0014213 | Ga0501079_0014213_2535_3575 | 337 |
| 352 | 3300049742 | Ga0501080_0010166 | Ga0501080_0010166_6611_7645 | 337 |
| 353 | 3300049742 | Ga0501080_0040536 | Ga0501080_0040536_114_1154 | 337 |
| 354 | 3300049742 | Ga0501080_0054204 | Ga0501080_0054204_2120_3160 | 337 |
| 355 | 3300049744 | Ga0501083_0067366 | Ga0501083_0067366_504_1538 | 337 |
| 356 | 3300049823 | Ga0501044_0016877 | Ga0501044_0016877_2010_3044 | 337 |
| 357 | 3300049823 | Ga0501044_0034372 | Ga0501044_0034372_867_1907 | 337 |
| 358 | 3300049824 | Ga0501045_0086356 | Ga0501045_0086356_1071_2111 | 337 |
| 359 | 3300050507 | nmdc:mga05p37_1249_c1 | nmdc:mga05p37_1249_c1_4732_5778 | 337 |
| 360 | 3300050507 | nmdc:mga05p37_216945_c1 | nmdc:mga05p37_216945_c1_1059_2105 | 337 |
| 361 | 3300050508 | nmdc:mga09592_248690_c1 | nmdc:mga09592_248690_c1_440_1486 | 337 |
| 362 | 3300050508 | nmdc:mga09592_619_c1 | nmdc:mga09592_619_c1_8486_9532 | 337 |
| 363 | 3300050509 | nmdc:mga0qj67_444_c1 | nmdc:mga0qj67_444_c1_25506_26552 | 337 |
| 364 | 3300050510 | nmdc:mga06r32_233042_c1 | nmdc:mga06r32_233042_c1_580_1626 | 337 |
| 365 | 3300050510 | nmdc:mga06r32_450_c1 | nmdc:mga06r32_450_c1_27977_29023 | 337 |
| 366 | 3300050511 | nmdc:mga08y16_261384_c1 | nmdc:mga08y16_261384_c1_457_1497 | 337 |
| 367 | 3300050511 | nmdc:mga08y16_381084_c1 | nmdc:mga08y16_381084_c1_72_1118 | 337 |
| 368 | 3300050512 | nmdc:mga0n895_331619_c1 | nmdc:mga0n895_331619_c1_119_1165 | 337 |
| 369 | 3300053087 | Ga0500643_013071 | Ga0500643_013071_1509_2546 | 337 |
| 370 | 3300053096 | Ga0500641_0039552 | Ga0500641_0039552_250_1263 | 337 |
| 371 | 3300053103 | Ga0500555_012142 | Ga0500555_012142_1370_2407 | 337 |
| 372 | 3300053109 | Ga0500569_007134 | Ga0500569_007134_249_1262 | 337 |
| 373 | 3300053134 | Ga0500658_0050600 | Ga0500658_0050600_231_1268 | 337 |
| 374 | 3300054114 | Ga0501084_0125449 | Ga0501084_0125449_136_1170 | 337 |
| 375 | iso_pu_bacteria | 2512564014 | 2512642818 | 337 |
| 376 | 3300003781 | Ga0055536_1000733 | Ga0055536_10007339 | 338 |
| 377 | 3300003781 | Ga0055536_1001202 | Ga0055536_10012024 | 338 |
| 378 | 3300003781 | Ga0055536_1001810 | Ga0055536_10018106 | 338 |
| 379 | 3300003781 | Ga0055536_1003951 | Ga0055536_10039512 | 338 |
| 380 | 3300003781 | Ga0055536_1007638 | Ga0055536_10076384 | 338 |
| 381 | 3300003791 | Ga0055530_10000106 | Ga0055530_1000010617 | 338 |
| 382 | 3300003791 | Ga0055530_10000164 | Ga0055530_1000016412 | 338 |
| 383 | 3300003791 | Ga0055530_10000181 | Ga0055530_1000018140 | 338 |
| 384 | 3300003791 | Ga0055530_10000465 | Ga0055530_1000046516 | 338 |
| 385 | 3300003794 | Ga0055531_10000012 | Ga0055531_10000012119 | 338 |
| 386 | 3300003794 | Ga0055531_10001005 | Ga0055531_1000100516 | 338 |
| 387 | 3300003794 | Ga0055531_10001314 | Ga0055531_1000131411 | 338 |
| 388 | 3300003794 | Ga0055531_10004289 | Ga0055531_100042894 | 338 |
| 389 | 3300003794 | Ga0055531_10004380 | Ga0055531_100043803 | 338 |
| 390 | 3300003794 | Ga0055531_10005744 | Ga0055531_100057444 | 338 |
| 391 | 3300003794 | Ga0055531_10006349 | Ga0055531_100063493 | 338 |
| 392 | 3300005293 | Ga0065715_10101304 | Ga0065715_101013042 | 338 |
| 393 | 3300005340 | Ga0070689_100143957 | Ga0070689_1001439572 | 338 |
| 394 | 3300005435 | Ga0070714_100230939 | Ga0070714_1002309392 | 338 |
| 395 | 3300005456 | Ga0070678_100006730 | Ga0070678_1000067301 | 338 |
| 396 | 3300005459 | Ga0068867_100016202 | Ga0068867_1000162022 | 338 |
| 397 | 3300005539 | Ga0068853_100028737 | Ga0068853_1000287373 | 338 |
| 398 | 3300005548 | Ga0070665_100105961 | Ga0070665_1001059612 | 338 |
| 399 | 3300005614 | Ga0068856_100015602 | Ga0068856_1000156023 | 338 |
| 400 | 3300005841 | Ga0068863_100084928 | Ga0068863_1000849282 | 338 |
| 401 | 3300005842 | Ga0068858_100049301 | Ga0068858_1000493012 | 338 |
| 402 | 3300006028 | Ga0070717_10282795 | Ga0070717_102827952 | 338 |
| 403 | 3300006173 | Ga0070716_100121766 | Ga0070716_1001217662 | 338 |
| 404 | 3300006173 | Ga0070716_100209304 | Ga0070716_1002093042 | 338 |
| 405 | 3300006237 | Ga0097621_100034130 | Ga0097621_1000341302 | 338 |
| 406 | 3300006946 | Ga0079104_1018097 | Ga0079104_10180972 | 338 |
| 407 | 3300009093 | Ga0105240_10067374 | Ga0105240_100673744 | 338 |
| 408 | 3300009093 | Ga0105240_10069692 | Ga0105240_100696922 | 338 |
| 409 | 3300009176 | Ga0105242_10016940 | Ga0105242_100169403 | 338 |
| 410 | 3300009551 | Ga0105238_10085639 | Ga0105238_100856392 | 338 |
| 411 | 3300009551 | Ga0105238_10567708 | Ga0105238_105677081 | 338 |
| 412 | 3300013306 | Ga0163162_10023244 | Ga0163162_100232443 | 338 |
| 413 | 3300013307 | Ga0157372_10529003 | Ga0157372_105290032 | 338 |
| 414 | 3300013308 | Ga0157375_10030306 | Ga0157375_100303062 | 338 |
| 415 | 3300014326 | Ga0157380_10053565 | Ga0157380_100535653 | 338 |
| 416 | 3300014968 | Ga0157379_10100880 | Ga0157379_101008802 | 338 |
| 417 | 3300025291 | Ga0209675_1000183 | Ga0209675_10001832 | 338 |
| 418 | 3300025291 | Ga0209675_1000202 | Ga0209675_100020240 | 338 |
| 419 | 3300025291 | Ga0209675_1000384 | Ga0209675_100038416 | 338 |
| 420 | 3300025292 | Ga0209676_1000155 | Ga0209676_100015569 | 338 |
| 421 | 3300025292 | Ga0209676_1000234 | Ga0209676_100023410 | 338 |
| 422 | 3300025292 | Ga0209676_1000234 | Ga0209676_100023469 | 338 |
| 423 | 3300025292 | Ga0209676_1000384 | Ga0209676_100038434 | 338 |
| 424 | 3300025292 | Ga0209676_1000475 | Ga0209676_100047529 | 338 |
| 425 | 3300025292 | Ga0209676_1000693 | Ga0209676_100069335 | 338 |
| 426 | 3300025292 | Ga0209676_1004674 | Ga0209676_10046743 | 338 |
| 427 | 3300025294 | Ga0209025_1007902 | Ga0209025_10079022 | 338 |
| 428 | 3300025294 | Ga0209025_1020691 | Ga0209025_10206912 | 338 |
| 429 | 3300025297 | Ga0209758_1023933 | Ga0209758_10239332 | 338 |
| 430 | 3300025298 | Ga0209050_1000039 | Ga0209050_1000039319 | 338 |
| 431 | 3300025298 | Ga0209050_1000112 | Ga0209050_100011220 | 338 |
| 432 | 3300025298 | Ga0209050_1000132 | Ga0209050_1000132110 | 338 |
| 433 | 3300025298 | Ga0209050_1000132 | Ga0209050_100013241 | 338 |
| 434 | 3300025298 | Ga0209050_1000776 | Ga0209050_100077633 | 338 |
| 435 | 3300025298 | Ga0209050_1007994 | Ga0209050_10079943 | 338 |
| 436 | 3300025298 | Ga0209050_1015174 | Ga0209050_10151742 | 338 |
| 437 | 3300025298 | Ga0209050_1032064 | Ga0209050_10320642 | 338 |
| 438 | 3300025304 | Ga0209257_1000051 | Ga0209257_1000051319 | 338 |
| 439 | 3300025304 | Ga0209257_1000176 | Ga0209257_100017634 | 338 |
| 440 | 3300025304 | Ga0209257_1000176 | Ga0209257_100017692 | 338 |
| 441 | 3300025304 | Ga0209257_1000523 | Ga0209257_100052312 | 338 |
| 442 | 3300025304 | Ga0209257_1000600 | Ga0209257_100060042 | 338 |
| 443 | 3300025304 | Ga0209257_1001567 | Ga0209257_100156715 | 338 |
| 444 | 3300025304 | Ga0209257_1001840 | Ga0209257_10018406 | 338 |
| 445 | 3300025304 | Ga0209257_1015830 | Ga0209257_10158302 | 338 |
| 446 | 3300025913 | Ga0207695_10041929 | Ga0207695_100419292 | 338 |
| 447 | 3300025934 | Ga0207686_10209828 | Ga0207686_102098282 | 338 |
| 448 | 3300025936 | Ga0207670_10266101 | Ga0207670_102661011 | 338 |
| 449 | 3300025938 | Ga0207704_10012534 | Ga0207704_100125342 | 338 |
| 450 | 3300025940 | Ga0207691_10057179 | Ga0207691_100571792 | 338 |
| 451 | 3300026035 | Ga0207703_10139793 | Ga0207703_101397932 | 338 |
| 452 | 3300026067 | Ga0207678_10040586 | Ga0207678_100405862 | 338 |
| 453 | 3300026088 | Ga0207641_10191196 | Ga0207641_101911962 | 338 |
| 454 | 3300026089 | Ga0207648_10019230 | Ga0207648_100192303 | 338 |
| 455 | 3300026095 | Ga0207676_10111641 | Ga0207676_101116412 | 338 |
| 456 | 3300026118 | Ga0207675_100162179 | Ga0207675_1001621792 | 338 |
| 457 | 3300028794 | Ga0307515_10270587 | Ga0307515_102705872 | 338 |
| 458 | 3300031731 | Ga0307405_10005713 | Ga0307405_100057133 | 338 |
| 459 | 3300031911 | Ga0307412_10041499 | Ga0307412_100414992 | 338 |
| 460 | 3300032004 | Ga0307414_10000242 | Ga0307414_1000024222 | 338 |
| 461 | 3300032004 | Ga0307414_10280657 | Ga0307414_102806572 | 338 |
| 462 | 3300032005 | Ga0307411_10140496 | Ga0307411_101404962 | 338 |
| 463 | 3300035119 | Ga0373956_0040630 | Ga0373956_0040630_830_1882 | 338 |
| 464 | 3300036401 | Ga0373937_0017549 | Ga0373937_0017549_2271_3323 | 338 |
| 465 | 3300036401 | Ga0373937_0295818 | Ga0373937_0295818_468_1514 | 338 |
| 466 | 3300039438 | Ga0436360_1257731 | Ga0436360_1257731_260_1345 | 338 |
| 467 | 3300045051 | Ga0451576_0606388 | Ga0451576_0606388_36_1082 | 338 |
| 468 | 3300046453 | Ga0495627_000060 | Ga0495627_000060_18248_19300 | 338 |
| 469 | 3300046460 | Ga0495638_0000123 | Ga0495638_0000123_61783_62823 | 338 |
| 470 | 3300046462 | Ga0495651_0258507 | Ga0495651_0258507_50_1102 | 338 |
| 471 | 3300046506 | Ga0495583_0053714 | Ga0495583_0053714_86_1123 | 338 |
| 472 | 3300046522 | Ga0495643_0040398 | Ga0495643_0040398_433_1473 | 338 |
| 473 | 3300046524 | Ga0495648_0001235 | Ga0495648_0001235_24375_25427 | 338 |
| 474 | 3300046525 | Ga0495663_0004107 | Ga0495663_0004107_723_1763 | 338 |
| 475 | 3300046536 | Ga0495587_0103931 | Ga0495587_0103931_283_1335 | 338 |
| 476 | 3300046558 | Ga0495633_0070807 | Ga0495633_0070807_329_1381 | 338 |
| 477 | 3300046616 | Ga0495668_0000031 | Ga0495668_0000031_241258_242298 | 338 |
| 478 | 3300046660 | Ga0495625_0000351 | Ga0495625_0000351_43921_44961 | 338 |
| 479 | 3300046660 | Ga0495625_0000352 | Ga0495625_0000352_5469_6509 | 338 |
| 480 | 3300046660 | Ga0495625_0000842 | Ga0495625_0000842_29210_30256 | 338 |
| 481 | 3300046660 | Ga0495625_0004906 | Ga0495625_0004906_10488_11525 | 338 |
| 482 | 3300046675 | Ga0495657_0137951 | Ga0495657_0137951_74_1126 | 338 |
| 483 | 3300046691 | Ga0495670_0000002 | Ga0495670_0000002_430277_431365 | 338 |
| 484 | 3300047320 | Ga0495672_0017800 | Ga0495672_0017800_2551_3630 | 338 |
| 485 | 3300047320 | Ga0495672_0141557 | Ga0495672_0141557_121_1173 | 338 |
| 486 | 3300047444 | Ga0495675_0104529 | Ga0495675_0104529_654_1706 | 338 |
| 487 | 3300047445 | Ga0495677_0007618 | Ga0495677_0007618_560_1597 | 338 |
| 488 | 3300048921 | Ga0496118_0005341 | Ga0496118_0005341_12029_13102 | 338 |
| 489 | 3300048924 | Ga0496121_0000248 | Ga0496121_0000248_109438_110511 | 338 |
| 490 | 3300048925 | Ga0496122_0035627 | Ga0496122_0035627_1509_2552 | 338 |
| 491 | 3300048926 | Ga0496123_0007652 | Ga0496123_0007652_4547_5590 | 338 |
| 492 | 3300048927 | Ga0496124_0096522 | Ga0496124_0096522_831_1874 | 338 |
| 493 | 3300048928 | Ga0496125_0148461 | Ga0496125_0148461_142_1188 | 338 |
| 494 | 3300050510 | nmdc:mga06r32_155459_c1 | nmdc:mga06r32_155459_c1_218_1267 | 338 |
| 495 | 3300053087 | Ga0500643_001692 | Ga0500643_001692_556_1593 | 338 |
| 496 | 3300053094 | Ga0500566_0021562 | Ga0500566_0021562_981_2021 | 338 |
| 497 | 3300053128 | Ga0500626_101768 | Ga0500626_101768_80_1120 | 338 |
| 498 | 3300053134 | Ga0500658_0001253 | Ga0500658_0001253_9109_10149 | 338 |
| 499 | 3300053139 | Ga0500568_0000884 | Ga0500568_0000884_4818_5858 | 338 |
| 500 | 3300053139 | Ga0500568_0003290 | Ga0500568_0003290_1473_2531 | 338 |
| 501 | 3300053140 | Ga0500573_0000010 | Ga0500573_0000010_74619_75680 | 338 |
| 502 | 3300053148 | Ga0500590_053889 | Ga0500590_053889_459_1475 | 338 |
| 503 | 3300053158 | Ga0500627_0002161 | Ga0500627_0002161_4040_5092 | 338 |
| 504 | iso_pu_bacteria | 2643221563 | 2643832733 | 338 |
| 505 | iso_pu_bacteria | 2643221563 | 2643835254 | 338 |
| 506 | iso_pu_bacteria | 2643221563 | 2643836496 | 338 |
| 507 | iso_pu_bacteria | 2643221605 | 2644038602 | 338 |
| 508 | iso_pu_bacteria | 2643221608 | 2644052973 | 338 |
| 509 | iso_pu_bacteria | 2643221608 | 2644053472 | 338 |
| 510 | iso_pu_bacteria | 2643221608 | 2644056180 | 338 |
| 511 | iso_pu_bacteria | 2852653556 | 2852654768 | 338 |
| 512 | iso_pu_bacteria | 2852680915 | 2852683938 | 338 |
| 513 | iso_pu_bacteria | 2882806704 | 2882808734 | 338 |
| 514 | 3300005329 | Ga0070683_100221658 | Ga0070683_1002216582 | 339 |
| 515 | 3300005535 | Ga0070684_100008538 | Ga0070684_1000085387 | 339 |
| 516 | 3300005564 | Ga0070664_100220201 | Ga0070664_1002202012 | 339 |
| 517 | 3300005843 | Ga0068860_100448429 | Ga0068860_1004484291 | 339 |
| 518 | 3300009093 | Ga0105240_10175389 | Ga0105240_101753892 | 339 |
| 519 | 3300009545 | Ga0105237_10005186 | Ga0105237_100051869 | 339 |
| 520 | 3300025294 | Ga0209025_1054244 | Ga0209025_10542442 | 339 |
| 521 | 3300025304 | Ga0209257_1004585 | Ga0209257_10045852 | 339 |
| 522 | 3300025913 | Ga0207695_10039411 | Ga0207695_100394112 | 339 |
| 523 | 3300046460 | Ga0495638_0018112 | Ga0495638_0018112_2101_3150 | 339 |
| 524 | 3300046506 | Ga0495583_0000027 | Ga0495583_0000027_106012_107061 | 339 |
| 525 | 3300049577 | Ga0501041_0003593 | Ga0501041_0003593_6209_7273 | 339 |
| 526 | 3300049579 | Ga0501043_0233302 | Ga0501043_0233302_245_1309 | 339 |
| 527 | 3300049587 | Ga0501071_0020499 | Ga0501071_0020499_583_1647 | 339 |
| 528 | 3300049588 | Ga0501072_0058773 | Ga0501072_0058773_1065_2129 | 339 |
| 529 | 3300049590 | Ga0501074_0096077 | Ga0501074_0096077_740_1804 | 339 |
| 530 | 3300049591 | Ga0501075_0002474 | Ga0501075_0002474_9631_10695 | 339 |
| 531 | 3300049592 | Ga0501076_0004871 | Ga0501076_0004871_6540_7604 | 339 |
| 532 | 3300049741 | Ga0501079_0075386 | Ga0501079_0075386_618_1682 | 339 |
| 533 | 3300049742 | Ga0501080_0148241 | Ga0501080_0148241_210_1274 | 339 |
| 534 | 3300049743 | Ga0501081_0009626 | Ga0501081_0009626_2762_3826 | 339 |
| 535 | 3300049744 | Ga0501083_0074497 | Ga0501083_0074497_489_1553 | 339 |
| 536 | 3300049824 | Ga0501045_0048418 | Ga0501045_0048418_832_1896 | 339 |
| 537 | 3300053103 | Ga0500555_000034 | Ga0500555_000034_74217_75266 | 339 |
| 538 | 3300053146 | Ga0500588_0002054 | Ga0500588_0002054_214_1275 | 339 |
| 539 | 3300054114 | Ga0501084_0005608 | Ga0501084_0005608_6644_7708 | 339 |
| 540 | 3300060353 | Ga0501082_0002981 | Ga0501082_0002981_5357_6421 | 339 |
| 541 | 3300061734 | Ga0530510_0069565 | Ga0530510_0069565_816_1880 | 339 |
| 542 | iso_pu_bacteria | 2643221560 | 2643822570 | 339 |
| 543 | iso_pu_bacteria | 8057101203 | 8057104913 | 339 |
| 544 | 3300037471 | Ga0395905_0022952 | Ga0395905_0022952_315_1436 | 340 |
| 545 | 3300038443 | Ga0395901_0119300 | Ga0395901_0119300_1340_2497 | 340 |
| 546 | 3300053094 | Ga0500566_0004070 | Ga0500566_0004070_6898_7965 | 340 |
| 547 | 3300001979 | JGI24740J21852_10000019 | JGI24740J21852_1000001932 | 341 |
| 548 | 3300001989 | JGI24739J22299_10006255 | JGI24739J22299_100062552 | 341 |
| 549 | 3300005455 | Ga0070663_100000022 | Ga0070663_10000002231 | 341 |
| 550 | 3300005457 | Ga0070662_100002608 | Ga0070662_1000026083 | 341 |
| 551 | 3300005577 | Ga0068857_100022630 | Ga0068857_1000226302 | 341 |
| 552 | 3300005614 | Ga0068856_100000041 | Ga0068856_10000004131 | 341 |
| 553 | 3300009545 | Ga0105237_10109291 | Ga0105237_101092912 | 341 |
| 554 | 3300009551 | Ga0105238_10000192 | Ga0105238_1000019220 | 341 |
| 555 | 3300013100 | Ga0157373_10000046 | Ga0157373_1000004669 | 341 |
| 556 | 3300013104 | Ga0157370_10000071 | Ga0157370_1000007169 | 341 |
| 557 | 3300017792 | Ga0163161_10064637 | Ga0163161_100646372 | 341 |
| 558 | 3300025909 | Ga0207705_10040583 | Ga0207705_100405833 | 341 |
| 559 | 3300025911 | Ga0207654_10000032 | Ga0207654_1000003280 | 341 |
| 560 | 3300025924 | Ga0207694_10000812 | Ga0207694_1000081222 | 341 |
| 561 | 3300025933 | Ga0207706_10004347 | Ga0207706_100043475 | 341 |
| 562 | 3300026067 | Ga0207678_10000038 | Ga0207678_1000003821 | 341 |
| 563 | 3300026078 | Ga0207702_10000061 | Ga0207702_1000006134 | 341 |
| 564 | 3300026116 | Ga0207674_10013363 | Ga0207674_100133638 | 341 |
| 565 | 3300046506 | Ga0495583_0049273 | Ga0495583_0049273_479_1549 | 341 |
| 566 | 3300046522 | Ga0495643_0019082 | Ga0495643_0019082_1752_2822 | 341 |
| 567 | 3300046616 | Ga0495668_0000013 | Ga0495668_0000013_139492_140562 | 341 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7xrj-assembly1.cif.gz_A | crystal structure of n-acetyltransferase dgcn-25328 | 0.9588 | 11 | 341 |
| 7xrj-assembly1.cif.gz_A | crystal structure of n-acetyltransferase dgcn-25328 | 0.9504 | 11 | 341 |
| 2obn-assembly1.cif.gz_B | crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution | 0.839 | 12 | 339 |
| 2obn-assembly1.cif.gz_A | crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution | 0.8213 | 12 | 339 |
| 2obn-assembly2.cif.gz_C | crystal structure of a duf1611 family protein (ava_3511) from anabaena variabilis atcc 29413 at 2.30 a resolution | 0.8157 | 11 | 339 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2obnD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.906 | 132 | 341 | 3.40.50.300 |
| 2obnD02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.8977 | 132 | 341 | 3.40.50.300 |
| 2g0tB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.824 | 136 | 338 | 3.40.50.300 |
| 2g0tB02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.812 | 136 | 338 | 3.40.50.300 |
| af_Q4DA36_188_506_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.7659 | 145 | 179 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A258BV82-F1-model_v4 | EBNA-1 nuclear protein | 0.9935 | 206 | 341 |
|
| AF-A0A4V2BKK6-F1-model_v4 | DUF1611 domain-containing protein | 0.9917 | 118 | 341 |
|
| AF-A0A1H1BVK5-F1-model_v4 | Uncharacterized conserved protein, NAD-dependent epimerase/dehydratase family | 0.9912 | 7 | 341 |
|
| AF-A0A349Z5P4-F1-model_v4 | DUF1611 domain-containing protein | 0.9896 | 151 | 266 |
|
| AF-A0A4V1SCZ4-F1-model_v4 | TonB-dependent receptor | 0.9889 | 5 | 341 |
GO:0006826
GO:0009279 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar