F464526

General Info

Members Datasets Scaffolds Average Seq Length
567 259 1134 254

Family's Representative Sequence

Representative Sequence 3300035114|Ga0373939_0038574|Ga0373939_0038574_441_1202
Length 253
Sequence MTGTGRALSRYLPAAALFAALLAAWQLAVSGLGLREYLLPAPMRVIQAMLGDEIPWPRHVGVTALEIGGAFVVAGAVGVALGIAVAWTPLLSRALVPFLVFVNTLPKVAVAPLFLLWLGYGVVPNMLIGALIGFFPVVINTAVGLSQVDEELLDLGRVFNAPKWKVFTTIPNAYPYILSALKVTATAAVVGAIVGEFVASQQGLGYVIITTQGSMNTPVAFAALVWISLVGLAVYGLVVLAARRIAPWADSVD

Samples

Sample ID Description Type Environment
1 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
40 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
59 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
60 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
63 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
67 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
68 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
69 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
70 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
71 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
72 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
73 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
74 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
75 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
76 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
77 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
78 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
79 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
81 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
82 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
83 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
84 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
87 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
92 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
96 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
161 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
162 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
165 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
166 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
167 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
168 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
169 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
170 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
171 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
172 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
174 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
175 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
176 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
182 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
183 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
184 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
185 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
186 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
187 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
188 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
189 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
190 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
191 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
192 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
193 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
194 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
195 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
196 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
220 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
221 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
225 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
226 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
227 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
234 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
237 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
238 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
241 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
242 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
243 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
244 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
251 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
252 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
253 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
254 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
255 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
256 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
257 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
258 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
259 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.47
Nodule 0
Rhizoplane 2.82
Rhizosphere 91.36
Stem 0
Stem Tuber 0
Unclassified 0.88

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373939_0038574 3300035114 Bacteria 1426
2 Ga0065707_10157438 3300005295 Bacteria 1595
3 Ga0070658_10457243 3300005327 Bacteria 1100
4 Ga0070676_10000494 3300005328 Bacteria 18771
5 Ga0070683_100022580 3300005329 Bacteria 5625
6 Ga0070670_100033607 3300005331 Bacteria 4417
7 Ga0070677_10116629 3300005333 Bacteria 1200
8 Ga0068869_100000633 3300005334 Bacteria 19871
9 Ga0068869_100017701 3300005334 Bacteria 4837
10 Ga0068869_100042258 3300005334 Bacteria 3268
11 Ga0070680_100000096 3300005336 Bacteria 50255
12 Ga0070680_100002706 3300005336 Bacteria 13145
13 Ga0070680_100054835 3300005336 Bacteria 3256
14 Ga0070680_100495653 3300005336 Bacteria 1045
15 Ga0070682_100000209 3300005337 Bacteria 42875
16 Ga0070660_100002490 3300005339 Bacteria 12642
17 Ga0070689_100024106 3300005340 Bacteria 4562
18 Ga0070689_100203100 3300005340 Bacteria 1619
19 Ga0070691_10002351 3300005341 Bacteria 8382
20 Ga0070691_10015706 3300005341 Bacteria 3479
21 Ga0070691_10081286 3300005341 Bacteria 1587
22 Ga0070687_100002533 3300005343 Bacteria 6883
23 Ga0070661_100001130 3300005344 Bacteria 18750
24 Ga0070661_100037082 3300005344 Bacteria 3546
25 Ga0070692_10011911 3300005345 Bacteria 4010
26 Ga0070692_10012409 3300005345 Bacteria 3943
27 Ga0070675_100160263 3300005354 Bacteria 1934
28 Ga0070673_100551945 3300005364 Bacteria 1047
29 Ga0070703_10004269 3300005406 Bacteria 4025
30 Ga0070713_100035201 3300005436 Bacteria 4029
31 Ga0070711_100452006 3300005439 Bacteria 1052
32 Ga0070705_100003577 3300005440 Bacteria 7611
33 Ga0070705_100567376 3300005440 Bacteria 873
34 Ga0070700_100017109 3300005441 Bacteria 4140
35 Ga0070700_100032087 3300005441 Bacteria 3154
36 Ga0070694_100012207 3300005444 Bacteria 5338
37 Ga0070694_100027151 3300005444 Bacteria 3717
38 Ga0070694_100029070 3300005444 Bacteria 3604
39 Ga0070694_100035471 3300005444 Bacteria 3298
40 Ga0070694_100075398 3300005444 Bacteria 2333
41 Ga0070708_100003818 3300005445 Bacteria 11822
42 Ga0070708_100101602 3300005445 Bacteria 2634
43 Ga0070708_100174224 3300005445 Bacteria 2010
44 Ga0070708_100378689 3300005445 Bacteria 1334
45 Ga0070708_100404398 3300005445 Bacteria 1287
46 Ga0070663_100008345 3300005455 Bacteria 6363
47 Ga0070662_100001288 3300005457 Bacteria 15415
48 Ga0070662_100067735 3300005457 Bacteria 2622
49 Ga0070681_10009396 3300005458 Bacteria 9622
50 Ga0070681_10016376 3300005458 Bacteria 7401
51 Ga0070681_10067649 3300005458 Bacteria 3540
52 Ga0070681_10073944 3300005458 Bacteria 3370
53 Ga0068867_100005897 3300005459 Bacteria 8692
54 Ga0068867_100048795 3300005459 Bacteria 3116
55 Ga0070706_100019637 3300005467 Bacteria 6233
56 Ga0070706_100087189 3300005467 Bacteria 2893
57 Ga0070706_100100404 3300005467 Bacteria 2689
58 Ga0070706_100189736 3300005467 Bacteria 1920
59 Ga0070706_100402318 3300005467 Bacteria 1274
60 Ga0070707_100056244 3300005468 Bacteria 3773
61 Ga0070707_100056959 3300005468 Bacteria 3750
62 Ga0070707_100382205 3300005468 Bacteria 1368
63 Ga0070707_100462609 3300005468 Bacteria 1229
64 Ga0070698_100015090 3300005471 Bacteria 8167
65 Ga0070698_100134122 3300005471 Bacteria 2431
66 Ga0070698_100161236 3300005471 Bacteria 2186
67 Ga0070699_100036365 3300005518 Bacteria 4260
68 Ga0070699_100052903 3300005518 Bacteria 3514
69 Ga0070699_100072415 3300005518 Bacteria 2997
70 Ga0070699_100079984 3300005518 Bacteria 2848
71 Ga0070699_100106225 3300005518 Bacteria 2463
72 Ga0070699_100252518 3300005518 Bacteria 1576
73 Ga0070699_100450741 3300005518 Bacteria 1167
74 Ga0070699_100505735 3300005518 Bacteria 1098
75 Ga0070699_100639260 3300005518 Bacteria 971
76 Ga0070679_100007108 3300005530 Bacteria 10447
77 Ga0070679_100107302 3300005530 Bacteria 2778
78 Ga0070679_100127063 3300005530 Bacteria 2531
79 Ga0070679_100295558 3300005530 Bacteria 1571
80 Ga0070684_100107892 3300005535 Bacteria 2494
81 Ga0070697_100013533 3300005536 Bacteria 6399
82 Ga0070697_100067607 3300005536 Unclassified 2923
83 Ga0070697_100124979 3300005536 Bacteria 2154
84 Ga0070697_100173266 3300005536 Bacteria 1827
85 Ga0070697_100193160 3300005536 Bacteria 1728
86 Ga0068853_100006624 3300005539 Bacteria 9224
87 Ga0070695_100000515 3300005545 Bacteria 20317
88 Ga0070695_100002481 3300005545 Bacteria 10620
89 Ga0070695_100024925 3300005545 Bacteria 3689
90 Ga0070695_100129133 3300005545 Bacteria 1740
91 Ga0070696_100001788 3300005546 Bacteria 14090
92 Ga0070696_100049434 3300005546 Bacteria 2921
93 Ga0070696_100445682 3300005546 Bacteria 1021
94 Ga0070693_100000276 3300005547 Bacteria 24146
95 Ga0070665_100085559 3300005548 Bacteria 3158
96 Ga0070665_100434573 3300005548 Bacteria 1322
97 Ga0070704_100011006 3300005549 Bacteria 5520
98 Ga0070704_100027553 3300005549 Bacteria 3771
99 Ga0068855_100050801 3300005563 Bacteria 4884
100 Ga0068855_100147741 3300005563 Bacteria 2674
101 Ga0070664_100029985 3300005564 Bacteria 4536
102 Ga0068857_100010973 3300005577 Bacteria 7884
103 Ga0068857_100108897 3300005577 Bacteria 2489
104 Ga0068854_100000604 3300005578 Bacteria 21347
105 Ga0068856_100000353 3300005614 Bacteria 50137
106 Ga0068856_100035468 3300005614 Bacteria 4888
107 Ga0068856_100059786 3300005614 Bacteria 3764
108 Ga0070702_100031972 3300005615 Bacteria 2884
109 Ga0068852_100140443 3300005616 Bacteria 2235
110 Ga0068852_100448546 3300005616 Bacteria 1277
111 Ga0068859_100007290 3300005617 Bacteria 11216
112 Ga0068859_100115063 3300005617 Bacteria 2754
113 Ga0068859_100487739 3300005617 Bacteria 1328
114 Ga0068864_100011107 3300005618 Bacteria 7442
115 Ga0068861_100015430 3300005719 Bacteria 5383
116 Ga0068870_10009873 3300005840 Bacteria 4359
117 Ga0068863_100009507 3300005841 Bacteria 9482
118 Ga0068858_100140786 3300005842 Bacteria 2264
119 Ga0068860_100046946 3300005843 Bacteria 4116
120 Ga0068860_100050354 3300005843 Bacteria 3966
121 Ga0068860_100111972 3300005843 Bacteria 2610
122 Ga0068860_100123565 3300005843 Bacteria 2480
123 Ga0068862_100001824 3300005844 Bacteria 19303
124 Ga0068862_100009957 3300005844 Bacteria 7852
125 Ga0068862_100020664 3300005844 Bacteria 5501
126 Ga0068862_100091254 3300005844 Bacteria 2653
127 Ga0068862_100131504 3300005844 Bacteria 2214
128 Ga0081455_10000772 3300005937 Bacteria 41282
129 Ga0081455_10008361 3300005937 Bacteria 10770
130 Ga0081455_10015239 3300005937 Bacteria 7477
131 Ga0081455_10022438 3300005937 Bacteria 5898
132 Ga0081538_10020055 3300005981 Bacteria 4940
133 Ga0081540_1053727 3300005983 Bacteria 1973
134 Ga0081539_10004948 3300005985 Bacteria 14158
135 Ga0075365_10057227 3300006038 Bacteria 2594
136 Ga0075365_10386406 3300006038 Bacteria 987
137 Ga0075365_10486182 3300006038 Bacteria 872
138 Ga0075363_100080652 3300006048 Bacteria 1779
139 Ga0070715_10085668 3300006163 Unclassified 1439
140 Ga0070716_100003940 3300006173 Bacteria 7044
141 Ga0075362_10011902 3300006177 Bacteria 3438
142 Ga0075362_10023230 3300006177 Bacteria 2621
143 Ga0075362_10099153 3300006177 Bacteria 1360
144 Ga0075367_10014012 3300006178 Bacteria 4331
145 Ga0075367_10183381 3300006178 Bacteria 1305
146 Ga0075367_10238873 3300006178 Bacteria 1138
147 Ga0075369_10000065 3300006186 Bacteria 27633
148 Ga0075366_10005277 3300006195 Bacteria 7001
149 Ga0075366_10063355 3300006195 Bacteria 2197
150 Ga0075370_10139564 3300006353 Bacteria 1416
151 Ga0075428_100338761 3300006844 Bacteria 1615
152 Ga0075430_100000013 3300006846 Bacteria 93627
153 Ga0075430_100000114 3300006846 Bacteria 48642
154 Ga0075430_100084697 3300006846 Bacteria 2655
155 Ga0075431_100000087 3300006847 Bacteria 56140
156 Ga0075431_100001575 3300006847 Bacteria 21211
157 Ga0075431_100010317 3300006847 Bacteria 9386
158 Ga0075431_100078916 3300006847 Bacteria 3399
159 Ga0075431_100124326 3300006847 Bacteria 2662
160 Ga0075431_100570155 3300006847 Bacteria 1118
161 Ga0075433_10004555 3300006852 Bacteria 10813
162 Ga0075433_10009036 3300006852 Bacteria 7959
163 Ga0075433_10014440 3300006852 Bacteria 6452
164 Ga0075433_10018185 3300006852 Bacteria 5839
165 Ga0075433_10033171 3300006852 Bacteria 4425
166 Ga0075433_10057199 3300006852 Bacteria 3409
167 Ga0075433_10072688 3300006852 Bacteria 3024
168 Ga0075433_10085242 3300006852 Bacteria 2789
169 Ga0075433_10116514 3300006852 Bacteria 2370
170 Ga0075434_100016066 3300006871 Bacteria 7192
171 Ga0075434_100037328 3300006871 Bacteria 4810
172 Ga0075434_100088680 3300006871 Bacteria 3094
173 Ga0075434_100115134 3300006871 Bacteria 2701
174 Ga0075434_100146515 3300006871 Bacteria 2381
175 Ga0075434_100146932 3300006871 Bacteria 2378
176 Ga0075434_100265809 3300006871 Bacteria 1734
177 Ga0075434_100289466 3300006871 Bacteria 1658
178 Ga0075434_100373286 3300006871 Bacteria 1447
179 Ga0075429_100000234 3300006880 Bacteria 38034
180 Ga0068865_100068727 3300006881 Bacteria 2505
181 Ga0075436_100055417 3300006914 Bacteria 2737
182 Ga0075436_100063731 3300006914 Bacteria 2547
183 Ga0075436_100081915 3300006914 Bacteria 2238
184 Ga0097620_100007290 3300006931 Bacteria 11216
185 Ga0097620_100115063 3300006931 Bacteria 2754
186 Ga0097620_100487761 3300006931 Bacteria 1328
187 Ga0075435_100016605 3300007076 Bacteria 5552
188 Ga0075435_100048970 3300007076 Bacteria 3396
189 Ga0075435_100070141 3300007076 Bacteria 2860
190 Ga0075435_100079366 3300007076 Bacteria 2693
191 Ga0075435_100222743 3300007076 Bacteria 1602
192 Ga0105240_10057854 3300009093 Bacteria 4840
193 Ga0111539_10000182 3300009094 Bacteria 73143
194 Ga0111539_10011539 3300009094 Bacteria 11087
195 Ga0111539_10042815 3300009094 Bacteria 5433
196 Ga0105245_10227799 3300009098 Bacteria 1801
197 Ga0114129_10012006 3300009147 Bacteria 12319
198 Ga0114129_10027871 3300009147 Bacteria 7999
199 Ga0114129_10059203 3300009147 Bacteria 5356
200 Ga0114129_10067061 3300009147 Bacteria 5005
201 Ga0114129_10080899 3300009147 Bacteria 4516
202 Ga0114129_10172119 3300009147 Bacteria 2951
203 Ga0114129_10377727 3300009147 Bacteria 1872
204 Ga0114129_10476750 3300009147 Bacteria 1633
205 Ga0114129_10636944 3300009147 Bacteria 1377
206 Ga0105243_10044311 3300009148 Bacteria 3490
207 Ga0105241_10000214 3300009174 Bacteria 43488
208 Ga0105241_10093323 3300009174 Bacteria 2378
209 Ga0105242_10018659 3300009176 Bacteria 5427
210 Ga0105242_10379949 3300009176 Unclassified 1313
211 Ga0105237_10259816 3300009545 Bacteria 1739
212 Ga0105237_10403514 3300009545 Bacteria 1371
213 Ga0105238_10208673 3300009551 Bacteria 1929
214 Ga0105249_10081765 3300009553 Bacteria 3004
215 Ga0105249_10278265 3300009553 Bacteria 1670
216 Ga0105239_10158361 3300010375 Bacteria 2529
217 Ga0105239_10206974 3300010375 Bacteria 2198
218 Ga0105239_10239947 3300010375 Bacteria 2034
219 Ga0105246_10066243 3300011119 Bacteria 2528
220 Ga0157373_10001118 3300013100 Bacteria 20587
221 Ga0157371_10056208 3300013102 Bacteria 2792
222 Ga0157371_10063549 3300013102 Bacteria 2616
223 Ga0157370_10037345 3300013104 Bacteria 4709
224 Ga0157370_10138459 3300013104 Bacteria 2268
225 Ga0157370_10339254 3300013104 Bacteria 1385
226 Ga0157370_10637641 3300013104 Bacteria 974
227 Ga0157369_10002595 3300013105 Bacteria 21616
228 Ga0157369_10102415 3300013105 Bacteria 3051
229 Ga0157369_10786694 3300013105 Bacteria 978
230 Ga0157372_10000063 3300013307 Bacteria 119595
231 Ga0157375_10115378 3300013308 Bacteria 2788
232 Ga0157375_10931742 3300013308 Bacteria 1011
233 Ga0163163_10060030 3300014325 Bacteria 3764
234 Ga0157380_10068250 3300014326 Bacteria 2865
235 Ga0157379_11006237 3300014968 Bacteria 795
236 Ga0207653_10001016 3300025885 Bacteria 9263
237 Ga0207653_10133028 3300025885 Bacteria 904
238 Ga0207688_10064919 3300025901 Bacteria 2062
239 Ga0207647_10091796 3300025904 Bacteria 1811
240 Ga0207647_10133094 3300025904 Bacteria 1460
241 Ga0207685_10177334 3300025905 Bacteria 985
242 Ga0207699_10191042 3300025906 Bacteria 1382
243 Ga0207645_10011837 3300025907 Bacteria 5938
244 Ga0207643_10000347 3300025908 Bacteria 31237
245 Ga0207643_10318252 3300025908 Bacteria 971
246 Ga0207684_10008484 3300025910 Bacteria 9141
247 Ga0207684_10102605 3300025910 Bacteria 2446
248 Ga0207684_10169063 3300025910 Bacteria 1884
249 Ga0207684_10280753 3300025910 Bacteria 1436
250 Ga0207684_10323735 3300025910 Bacteria 1328
251 Ga0207654_10001289 3300025911 Bacteria 13337
252 Ga0207654_10054624 3300025911 Bacteria 2309
253 Ga0207707_10000429 3300025912 Bacteria 43692
254 Ga0207707_10044674 3300025912 Bacteria 3862
255 Ga0207707_10070723 3300025912 Bacteria 3040
256 Ga0207707_10122382 3300025912 Bacteria 2275
257 Ga0207695_10084205 3300025913 Bacteria 3211
258 Ga0207671_10203862 3300025914 Bacteria 1545
259 Ga0207663_10091169 3300025916 Bacteria 2023
260 Ga0207660_10000191 3300025917 Bacteria 38989
261 Ga0207660_10025559 3300025917 Bacteria 4010
262 Ga0207660_10290017 3300025917 Bacteria 1301
263 Ga0207660_10422058 3300025917 Bacteria 1076
264 Ga0207662_10116797 3300025918 Bacteria 1669
265 Ga0207657_10000075 3300025919 Bacteria 93163
266 Ga0207657_10192634 3300025919 Bacteria 1644
267 Ga0207649_10003503 3300025920 Bacteria 8577
268 Ga0207649_10078844 3300025920 Bacteria 2126
269 Ga0207652_10000511 3300025921 Bacteria 39295
270 Ga0207652_10127855 3300025921 Bacteria 2264
271 Ga0207652_10254766 3300025921 Bacteria 1583
272 Ga0207646_10006342 3300025922 Bacteria 12248
273 Ga0207646_10257217 3300025922 Bacteria 1578
274 Ga0207646_10263439 3300025922 Bacteria 1558
275 Ga0207646_10272705 3300025922 Bacteria 1529
276 Ga0207646_10296939 3300025922 Bacteria 1460
277 Ga0207681_10162437 3300025923 Bacteria 1685
278 Ga0207694_10125626 3300025924 Bacteria 2052
279 Ga0207659_10249747 3300025926 Bacteria 1439
280 Ga0207659_10498709 3300025926 Bacteria 1030
281 Ga0207644_10022451 3300025931 Bacteria 4312
282 Ga0207690_10003235 3300025932 Bacteria 9776
283 Ga0207706_10001002 3300025933 Bacteria 28767
284 Ga0207706_10112554 3300025933 Bacteria 2395
285 Ga0207686_10029998 3300025934 Bacteria 3215
286 Ga0207686_10247397 3300025934 Unclassified 1301
287 Ga0207709_10016176 3300025935 Bacteria 4146
288 Ga0207670_10010942 3300025936 Bacteria 5242
289 Ga0207670_10234791 3300025936 Bacteria 1410
290 Ga0207669_10104893 3300025937 Bacteria 1879
291 Ga0207704_10023656 3300025938 Bacteria 3315
292 Ga0207665_10006324 3300025939 Bacteria 7855
293 Ga0207691_10018576 3300025940 Bacteria 6589
294 Ga0207689_10000750 3300025942 Bacteria 31126
295 Ga0207689_10027919 3300025942 Bacteria 4721
296 Ga0207689_10040435 3300025942 Bacteria 3859
297 Ga0207689_10480251 3300025942 Bacteria 1040
298 Ga0207661_10007843 3300025944 Bacteria 7603
299 Ga0207679_10000739 3300025945 Bacteria 21725
300 Ga0207679_10008593 3300025945 Bacteria 6510
301 Ga0207667_10004119 3300025949 Bacteria 17860
302 Ga0207667_10092089 3300025949 Bacteria 3131
303 Ga0207667_10285561 3300025949 Bacteria 1686
304 Ga0207651_10398367 3300025960 Bacteria 1170
305 Ga0207712_10114056 3300025961 Bacteria 2032
306 Ga0207640_10083271 3300025981 Bacteria 2193
307 Ga0207640_10561016 3300025981 Bacteria 961
308 Ga0207703_10061553 3300026035 Bacteria 3073
309 Ga0207639_10000841 3300026041 Bacteria 20841
310 Ga0207639_10129065 3300026041 Bacteria 2090
311 Ga0207678_10017091 3300026067 Bacteria 6370
312 Ga0207678_10231194 3300026067 Bacteria 1583
313 Ga0207678_10323024 3300026067 Bacteria 1328
314 Ga0207708_10048781 3300026075 Bacteria 3223
315 Ga0207708_10126166 3300026075 Unclassified 1998
316 Ga0207708_10159236 3300026075 Bacteria 1782
317 Ga0207708_10217784 3300026075 Bacteria 1529
318 Ga0207702_10001971 3300026078 Bacteria 19966
319 Ga0207702_10016032 3300026078 Bacteria 6204
320 Ga0207702_10063348 3300026078 Bacteria 3161
321 Ga0207702_10447311 3300026078 Bacteria 1253
322 Ga0207641_10244480 3300026088 Bacteria 1673
323 Ga0207648_10001603 3300026089 Bacteria 24764
324 Ga0207648_10038534 3300026089 Bacteria 4205
325 Ga0207676_10164976 3300026095 Bacteria 1923
326 Ga0207674_10001396 3300026116 Bacteria 31130
327 Ga0207674_10005197 3300026116 Bacteria 15495
328 Ga0207675_100002867 3300026118 Bacteria 16965
329 Ga0207675_100100935 3300026118 Bacteria 2718
330 Ga0207698_10012898 3300026142 Bacteria 5491
331 Ga0209971_1000557 3300027682 Bacteria 9744
332 Ga0209966_1000241 3300027695 Bacteria 20361
333 Ga0207428_10000514 3300027907 Bacteria 46308
334 Ga0207428_10027090 3300027907 Bacteria 4773
335 Ga0207428_10096135 3300027907 Bacteria 2294
336 Ga0268266_10062594 3300028379 Bacteria 3212
337 Ga0268266_10105900 3300028379 Bacteria 2485
338 Ga0268266_10352008 3300028379 Bacteria 1384
339 Ga0268265_10017432 3300028380 Bacteria 4955
340 Ga0268265_10025163 3300028380 Bacteria 4221
341 Ga0268265_10100179 3300028380 Bacteria 2338
342 Ga0268265_10107495 3300028380 Bacteria 2269
343 Ga0268265_10245267 3300028380 Bacteria 1583
344 Ga0268264_10056631 3300028381 Bacteria 3277
345 Ga0268264_10083729 3300028381 Bacteria 2733
346 Ga0268264_10084759 3300028381 Bacteria 2718
347 Ga0307405_10256290 3300031731 Bacteria 1304
348 Ga0307413_10385948 3300031824 Bacteria 1093
349 Ga0307413_10557211 3300031824 Bacteria 931
350 Ga0307416_100013597 3300032002 Bacteria 5540
351 Ga0373958_0020624 3300034819 Bacteria 1216
352 Ga0373959_0042239 3300034820 Bacteria 960
353 Ga0373928_0093723 3300035084 Bacteria 774
354 Ga0373940_0019988 3300035088 Bacteria 1697
355 Ga0373940_0065842 3300035088 Bacteria 1045
356 Ga0373949_0010823 3300035090 Bacteria 2003
357 Ga0373949_0040493 3300035090 Bacteria 1144
358 Ga0373952_0012638 3300035092 Bacteria 1664
359 Ga0373952_0031925 3300035092 Bacteria 1173
360 Ga0373960_0011152 3300035121 Bacteria 2209
361 Ga0373960_0058425 3300035121 Bacteria 1163
362 Ga0373946_0078835 3300035171 Bacteria 1438
363 Ga0373961_0025216 3300035241 Bacteria 1614
364 Ga0373962_0036360 3300035242 Bacteria 1371
365 Ga0373931_0006329 3300035691 Bacteria 5524
366 Ga0373931_0016166 3300035691 Bacteria 3669
367 Ga0373931_0024383 3300035691 Bacteria 3064
368 Ga0373931_0164335 3300035691 Bacteria 1303
369 Ga0373931_0370053 3300035691 Bacteria 901
370 Ga0373935_0401444 3300035692 Bacteria 984
371 Ga0373927_0070682 3300035695 Bacteria 2259
372 Ga0373927_0452476 3300035695 Bacteria 848
373 Ga0373925_0158261 3300037068 Bacteria 1783
374 Ga0395899_0019783 3300037312 Bacteria 5110
375 Ga0395899_0028253 3300037312 Bacteria 4224
376 Ga0395900_0012494 3300037418 Bacteria 8684
377 Ga0395900_0025710 3300037418 Bacteria 6027
378 Ga0395900_0031304 3300037418 Bacteria 5465
379 Ga0395900_0290326 3300037418 Bacteria 1624
380 Ga0395898_0014546 3300037466 Bacteria 8082
381 Ga0395898_0026217 3300037466 Bacteria 5867
382 Ga0395898_0117048 3300037466 Bacteria 2553
383 Ga0395905_0133531 3300037471 Bacteria 2335
384 Ga0395901_0002195 3300038443 Bacteria 19921
385 Ga0395901_0020442 3300038443 Bacteria 6777
386 Ga0395901_0285299 3300038443 Bacteria 1714
387 Ga0436365_0409520 3300039437 Bacteria 976
388 Ga0436360_0381469 3300039438 Bacteria 12708
389 Ga0436363_0304984 3300039450 Bacteria 1818
390 Ga0439443_032654 3300042003 Bacteria 864
391 Ga0439448_0007032 3300042005 Bacteria 3249
392 Ga0439448_0029805 3300042005 Bacteria 1728
393 Ga0439450_004769 3300042008 Bacteria 2341
394 Ga0439458_0005195 3300042157 Bacteria 2932
395 Ga0439459_0002301 3300042438 Bacteria 2931
396 Ga0439460_0000765 3300042461 Bacteria 7233
397 Ga0439460_0020950 3300042461 Bacteria 1781
398 Ga0451577_0008746 3300042876 Bacteria 9817
399 Ga0451577_0032496 3300042876 Bacteria 4701
400 Ga0453683_0018164 3300044673 Bacteria 4516
401 Ga0453683_0029200 3300044673 Bacteria 3489
402 Ga0466963_0027640 3300044694 Bacteria 3635
403 Ga0466964_0087802 3300044706 Bacteria 1348
404 Ga0453684_0105552 3300044712 Bacteria 3435
405 Ga0453684_0204779 3300044712 Bacteria 2297
406 Ga0451576_0032424 3300045051 Bacteria 5562
407 Ga0451576_0040638 3300045051 Bacteria 4920
408 Ga0451576_0042326 3300045051 Bacteria 4808
409 Ga0451576_0043808 3300045051 Bacteria 4720
410 Ga0451576_0239085 3300045051 Bacteria 1897
411 Ga0451576_0272838 3300045051 Bacteria 1768
412 Ga0495580_0159695 3300046472 Bacteria 1560
413 Ga0495584_0082756 3300046491 Bacteria 1616
414 Ga0496102_0008643 3300048905 Bacteria 8740
415 Ga0496102_0077469 3300048905 Bacteria 3060
416 Ga0496103_0179949 3300048906 Bacteria 1359
417 Ga0496105_0065607 3300048908 Bacteria 2996
418 Ga0496106_0188488 3300048909 Bacteria 1639
419 Ga0496106_0582664 3300048909 Bacteria 897
420 Ga0496108_0055603 3300048911 Bacteria 3324
421 Ga0496108_0488867 3300048911 Bacteria 1075
422 Ga0496109_0081837 3300048912 Bacteria 2975
423 Ga0496109_0885665 3300048912 Bacteria 830
424 Ga0496110_0108725 3300048913 Bacteria 2490
425 Ga0496110_0167927 3300048913 Bacteria 1990
426 Ga0496111_0071888 3300048914 Bacteria 2518
427 Ga0496112_0058376 3300048915 Bacteria 3800
428 Ga0496113_0671282 3300048916 Bacteria 828
429 Ga0496115_0077908 3300048918 Bacteria 2696
430 Ga0501031_0106501 3300049568 Bacteria 1830
431 Ga0501033_0039971 3300049570 Bacteria 3503
432 Ga0501033_0096204 3300049570 Bacteria 2164
433 Ga0501034_0001568 3300049571 Bacteria 29868
434 Ga0501034_0004066 3300049571 Bacteria 16421
435 Ga0501036_0283217 3300049572 Bacteria 1387
436 Ga0501036_0762301 3300049572 Bacteria 798
437 Ga0501038_0169621 3300049574 Bacteria 1768
438 Ga0501038_0508581 3300049574 Bacteria 920
439 Ga0501039_0029509 3300049575 Bacteria 4224
440 Ga0501039_0307730 3300049575 Bacteria 1246
441 Ga0501040_0000980 3300049576 Bacteria 18069
442 Ga0501040_0057339 3300049576 Bacteria 2674
443 Ga0501040_0095939 3300049576 Bacteria 2064
444 Ga0501041_0012946 3300049577 Bacteria 4941
445 Ga0501041_0059179 3300049577 Bacteria 2345
446 Ga0501042_0011205 3300049578 Bacteria 6042
447 Ga0501042_0260830 3300049578 Bacteria 1251
448 Ga0501046_0000953 3300049580 Bacteria 28407
449 Ga0501046_0053118 3300049580 Bacteria 3192
450 Ga0501046_0091170 3300049580 Bacteria 2344
451 Ga0501047_0128694 3300049581 Bacteria 2412
452 Ga0501067_0215943 3300049583 Bacteria 1068
453 Ga0501068_0000906 3300049584 Bacteria 15514
454 Ga0501069_0090327 3300049585 Bacteria 1732
455 Ga0501070_0073212 3300049586 Bacteria 2835
456 Ga0501072_0043177 3300049588 Bacteria 3543
457 Ga0501072_0049578 3300049588 Bacteria 3306
458 Ga0501072_0146836 3300049588 Bacteria 1880
459 Ga0501072_0185803 3300049588 Bacteria 1658
460 Ga0501074_0000599 3300049590 Bacteria 22381
461 Ga0501074_0034458 3300049590 Bacteria 3670
462 Ga0501074_0107828 3300049590 Bacteria 1994
463 Ga0501075_0028923 3300049591 Bacteria 4095
464 Ga0501075_0052403 3300049591 Bacteria 3068
465 Ga0501075_0059184 3300049591 Bacteria 2885
466 Ga0501076_0020685 3300049592 Bacteria 5039
467 Ga0501076_0103241 3300049592 Bacteria 2300
468 Ga0501076_0165149 3300049592 Bacteria 1804
469 Ga0501077_0086181 3300049593 Bacteria 1991
470 Ga0501077_0092038 3300049593 Bacteria 1921
471 Ga0501077_0158028 3300049593 Bacteria 1439
472 Ga0501079_0004802 3300049741 Bacteria 10019
473 Ga0501079_0024039 3300049741 Bacteria 4674
474 Ga0501079_0178419 3300049741 Bacteria 1657
475 Ga0501080_0247610 3300049742 Bacteria 1625
476 Ga0501080_0252802 3300049742 Bacteria 1607
477 Ga0501081_0028568 3300049743 Bacteria 3764
478 Ga0501081_0167130 3300049743 Bacteria 1587
479 Ga0501081_0566021 3300049743 Bacteria 849
480 Ga0501083_0060001 3300049744 Bacteria 2543
481 Ga0501083_0097634 3300049744 Bacteria 1938
482 Ga0501044_0156231 3300049823 Bacteria 2260
483 Ga0501044_0191911 3300049823 Bacteria 2005
484 Ga0501045_0002865 3300049824 Bacteria 11783
485 Ga0501045_0064265 3300049824 Bacteria 2694
486 Ga0501045_0148197 3300049824 Bacteria 1746
487 nmdc:mga03683_12639_c1 3300050489 Bacteria 3090
488 nmdc:mga03n38_26925_c1 3300050490 Bacteria 2379
489 nmdc:mga00v17_24922_c1 3300050491 Bacteria 3472
490 nmdc:mga0yw44_45778_c1 3300050492 Bacteria 2624
491 nmdc:mga0yw44_78112_c1 3300050492 Bacteria 2069
492 nmdc:mga0k408_233173_c1 3300050493 Bacteria 1099
493 nmdc:mga0k408_2555_c1 3300050493 Bacteria 9667
494 nmdc:mga06z11_9911_c1 3300050494 Bacteria 4036
495 nmdc:mga07m45_28683_c1 3300050496 Bacteria 1619
496 nmdc:mga05p37_232825_c1 3300050507 Bacteria 2218
497 nmdc:mga05p37_282810_c1 3300050507 Bacteria 1978
498 nmdc:mga05p37_40548_c1 3300050507 Bacteria 5718
499 nmdc:mga05p37_481286_c1 3300050507 Bacteria 1430
500 nmdc:mga05p37_49236_c1 3300050507 Bacteria 5183
501 nmdc:mga05p37_53501_c2 3300050507 Bacteria 3479
502 nmdc:mga05p37_64690_c1 3300050507 Bacteria 4500
503 nmdc:mga05p37_6668_c1 3300050507 Bacteria 13617
504 nmdc:mga05p37_74580_c1 3300050507 Bacteria 4176
505 nmdc:mga05p37_774642_c1 3300050507 Bacteria 1054
506 nmdc:mga09592_122_c1 3300050508 Bacteria 49514
507 nmdc:mga09592_190794_c1 3300050508 Bacteria 1774
508 nmdc:mga09592_42957_c1 3300050508 Bacteria 3803
509 nmdc:mga09592_50600_c1 3300050508 Bacteria 3504
510 nmdc:mga0qj67_115_c1 3300050509 Bacteria 52730
511 nmdc:mga0qj67_745392_c1 3300050509 Bacteria 777
512 nmdc:mga0qj67_8752_c1 3300050509 Bacteria 7511
513 nmdc:mga0qj67_92213_c1 3300050509 Bacteria 2435
514 nmdc:mga06r32_1168_c1 3300050510 Bacteria 23647
515 nmdc:mga06r32_119472_c1 3300050510 Bacteria 2599
516 nmdc:mga06r32_423_c1 3300050510 Bacteria 35563
517 nmdc:mga06r32_522_c1 3300050510 Bacteria 33144
518 nmdc:mga08y16_15865_c1 3300050511 Bacteria 7917
519 nmdc:mga08y16_260164_c1 3300050511 Bacteria 1792
520 nmdc:mga08y16_29018_c1 3300050511 Bacteria 5832
521 nmdc:mga08y16_64258_c1 3300050511 Bacteria 3833
522 nmdc:mga08y16_859154_c1 3300050511 Bacteria 896
523 nmdc:mga0n895_139212_c1 3300050512 Bacteria 2455
524 nmdc:mga0n895_190679_c1 3300050512 Bacteria 2081
525 nmdc:mga0n895_235373_c1 3300050512 Bacteria 1859
526 nmdc:mga0n895_38642_c1 3300050512 Bacteria 4626
527 nmdc:mga0n895_40751_c1 3300050512 Bacteria 4512
528 nmdc:mga0n895_634897_c1 3300050512 Bacteria 1068
529 nmdc:mga0n895_837501_c1 3300050512 Bacteria 908
530 nmdc:mga0n895_98976_c1 3300050512 Bacteria 2924
531 nmdc:mga0rr50_19854_c1 3300050513 Bacteria 4547
532 nmdc:mga0rr50_21457_c1 3300050513 Bacteria 4410
533 nmdc:mga0rr50_221129_c1 3300050513 Bacteria 1564
534 nmdc:mga0rr50_35499_c1 3300050513 Bacteria 3581
535 nmdc:mga0rr50_36833_c1 3300050513 Bacteria 3526
536 nmdc:mga0rr50_70114_c1 3300050513 Bacteria 2671
537 nmdc:mga0rr50_85598_c1 3300050513 Bacteria 2443
538 nmdc:mga08x19_70508_c1 3300050514 Bacteria 2277
539 nmdc:mga08x19_78724_c1 3300050514 Bacteria 2161
540 nmdc:mga08x19_96992_c1 3300050514 Bacteria 1952
541 nmdc:mga0a205_161696_c1 3300050515 Bacteria 2136
542 nmdc:mga0a205_21051_c1 3300050515 Bacteria 6166
543 nmdc:mga0a205_21399_c1 3300050515 Bacteria 6120
544 nmdc:mga0a205_224987_c1 3300050515 Bacteria 1761
545 nmdc:mga0a205_23241_c1 3300050515 Bacteria 5880
546 nmdc:mga0a205_235728_c1 3300050515 Bacteria 1712
547 nmdc:mga0a205_25734_c1 3300050515 Bacteria 5607
548 nmdc:mga0a205_47901_c1 3300050515 Bacteria 4125
549 nmdc:mga0a205_50286_c1 3300050515 Bacteria 4024
550 nmdc:mga0a205_5513_c1 3300050515 Bacteria 11398
551 nmdc:mga0a205_8279_c1 3300050515 Bacteria 9454
552 nmdc:mga0a205_96893_c1 3300050515 Bacteria 2849
553 nmdc:mga0sz30_212_c1 3300050516 Bacteria 21940
554 nmdc:mga0sz30_43422_c1 3300050516 Bacteria 1892
555 Ga0500644_0014056 3300053088 Bacteria 2251
556 Ga0500651_0066453 3300053093 Bacteria 2246
557 Ga0500658_0033690 3300053134 Bacteria 2016
558 Ga0500616_0002226 3300053153 Bacteria 16578
559 Ga0500609_008393 3300053731 Bacteria 1395
560 Ga0500552_000227 3300053733 Bacteria 5100
561 Ga0501084_0012502 3300054114 Bacteria 7031
562 Ga0501084_0643733 3300054114 Bacteria 895
563 Ga0501082_0001347 3300060353 Bacteria 21578
564 Ga0501082_0044096 3300060353 Bacteria 3847
565 Ga0501082_0175273 3300060353 Bacteria 1864
566 Ga0530510_0069204 3300061734 Bacteria 2561
567 Ga0530510_0234689 3300061734 Bacteria 1365
568 Ga0373939_0038574
569 Ga0065707_10157438
570 Ga0070658_10457243
571 Ga0070676_10000494
572 Ga0070683_100022580
573 Ga0070670_100033607
574 Ga0070677_10116629
575 Ga0068869_100000633
576 Ga0068869_100017701
577 Ga0068869_100042258
578 Ga0070680_100000096
579 Ga0070680_100002706
580 Ga0070680_100054835
581 Ga0070680_100495653
582 Ga0070682_100000209
583 Ga0070660_100002490
584 Ga0070689_100024106
585 Ga0070689_100203100
586 Ga0070691_10002351
587 Ga0070691_10015706
588 Ga0070691_10081286
589 Ga0070687_100002533
590 Ga0070661_100001130
591 Ga0070661_100037082
592 Ga0070692_10011911
593 Ga0070692_10012409
594 Ga0070675_100160263
595 Ga0070673_100551945
596 Ga0070703_10004269
597 Ga0070713_100035201
598 Ga0070711_100452006
599 Ga0070705_100003577
600 Ga0070705_100567376
601 Ga0070700_100017109
602 Ga0070700_100032087
603 Ga0070694_100012207
604 Ga0070694_100027151
605 Ga0070694_100029070
606 Ga0070694_100035471
607 Ga0070694_100075398
608 Ga0070708_100003818
609 Ga0070708_100101602
610 Ga0070708_100174224
611 Ga0070708_100378689
612 Ga0070708_100404398
613 Ga0070663_100008345
614 Ga0070662_100001288
615 Ga0070662_100067735
616 Ga0070681_10009396
617 Ga0070681_10016376
618 Ga0070681_10067649
619 Ga0070681_10073944
620 Ga0068867_100005897
621 Ga0068867_100048795
622 Ga0070706_100019637
623 Ga0070706_100087189
624 Ga0070706_100100404
625 Ga0070706_100189736
626 Ga0070706_100402318
627 Ga0070707_100056244
628 Ga0070707_100056959
629 Ga0070707_100382205
630 Ga0070707_100462609
631 Ga0070698_100015090
632 Ga0070698_100134122
633 Ga0070698_100161236
634 Ga0070699_100036365
635 Ga0070699_100052903
636 Ga0070699_100072415
637 Ga0070699_100079984
638 Ga0070699_100106225
639 Ga0070699_100252518
640 Ga0070699_100450741
641 Ga0070699_100505735
642 Ga0070699_100639260
643 Ga0070679_100007108
644 Ga0070679_100107302
645 Ga0070679_100127063
646 Ga0070679_100295558
647 Ga0070684_100107892
648 Ga0070697_100013533
649 Ga0070697_100067607
650 Ga0070697_100124979
651 Ga0070697_100173266
652 Ga0070697_100193160
653 Ga0068853_100006624
654 Ga0070695_100000515
655 Ga0070695_100002481
656 Ga0070695_100024925
657 Ga0070695_100129133
658 Ga0070696_100001788
659 Ga0070696_100049434
660 Ga0070696_100445682
661 Ga0070693_100000276
662 Ga0070665_100085559
663 Ga0070665_100434573
664 Ga0070704_100011006
665 Ga0070704_100027553
666 Ga0068855_100050801
667 Ga0068855_100147741
668 Ga0070664_100029985
669 Ga0068857_100010973
670 Ga0068857_100108897
671 Ga0068854_100000604
672 Ga0068856_100000353
673 Ga0068856_100035468
674 Ga0068856_100059786
675 Ga0070702_100031972
676 Ga0068852_100140443
677 Ga0068852_100448546
678 Ga0068859_100007290
679 Ga0068859_100115063
680 Ga0068859_100487739
681 Ga0068864_100011107
682 Ga0068861_100015430
683 Ga0068870_10009873
684 Ga0068863_100009507
685 Ga0068858_100140786
686 Ga0068860_100046946
687 Ga0068860_100050354
688 Ga0068860_100111972
689 Ga0068860_100123565
690 Ga0068862_100001824
691 Ga0068862_100009957
692 Ga0068862_100020664
693 Ga0068862_100091254
694 Ga0068862_100131504
695 Ga0081455_10000772
696 Ga0081455_10008361
697 Ga0081455_10015239
698 Ga0081455_10022438
699 Ga0081538_10020055
700 Ga0081540_1053727
701 Ga0081539_10004948
702 Ga0075365_10057227
703 Ga0075365_10386406
704 Ga0075365_10486182
705 Ga0075363_100080652
706 Ga0070715_10085668
707 Ga0070716_100003940
708 Ga0075362_10011902
709 Ga0075362_10023230
710 Ga0075362_10099153
711 Ga0075367_10014012
712 Ga0075367_10183381
713 Ga0075367_10238873
714 Ga0075369_10000065
715 Ga0075366_10005277
716 Ga0075366_10063355
717 Ga0075370_10139564
718 Ga0075428_100338761
719 Ga0075430_100000013
720 Ga0075430_100000114
721 Ga0075430_100084697
722 Ga0075431_100000087
723 Ga0075431_100001575
724 Ga0075431_100010317
725 Ga0075431_100078916
726 Ga0075431_100124326
727 Ga0075431_100570155
728 Ga0075433_10004555
729 Ga0075433_10009036
730 Ga0075433_10014440
731 Ga0075433_10018185
732 Ga0075433_10033171
733 Ga0075433_10057199
734 Ga0075433_10072688
735 Ga0075433_10085242
736 Ga0075433_10116514
737 Ga0075434_100016066
738 Ga0075434_100037328
739 Ga0075434_100088680
740 Ga0075434_100115134
741 Ga0075434_100146515
742 Ga0075434_100146932
743 Ga0075434_100265809
744 Ga0075434_100289466
745 Ga0075434_100373286
746 Ga0075429_100000234
747 Ga0068865_100068727
748 Ga0075436_100055417
749 Ga0075436_100063731
750 Ga0075436_100081915
751 Ga0097620_100007290
752 Ga0097620_100115063
753 Ga0097620_100487761
754 Ga0075435_100016605
755 Ga0075435_100048970
756 Ga0075435_100070141
757 Ga0075435_100079366
758 Ga0075435_100222743
759 Ga0105240_10057854
760 Ga0111539_10000182
761 Ga0111539_10011539
762 Ga0111539_10042815
763 Ga0105245_10227799
764 Ga0114129_10012006
765 Ga0114129_10027871
766 Ga0114129_10059203
767 Ga0114129_10067061
768 Ga0114129_10080899
769 Ga0114129_10172119
770 Ga0114129_10377727
771 Ga0114129_10476750
772 Ga0114129_10636944
773 Ga0105243_10044311
774 Ga0105241_10000214
775 Ga0105241_10093323
776 Ga0105242_10018659
777 Ga0105242_10379949
778 Ga0105237_10259816
779 Ga0105237_10403514
780 Ga0105238_10208673
781 Ga0105249_10081765
782 Ga0105249_10278265
783 Ga0105239_10158361
784 Ga0105239_10206974
785 Ga0105239_10239947
786 Ga0105246_10066243
787 Ga0157373_10001118
788 Ga0157371_10056208
789 Ga0157371_10063549
790 Ga0157370_10037345
791 Ga0157370_10138459
792 Ga0157370_10339254
793 Ga0157370_10637641
794 Ga0157369_10002595
795 Ga0157369_10102415
796 Ga0157369_10786694
797 Ga0157372_10000063
798 Ga0157375_10115378
799 Ga0157375_10931742
800 Ga0163163_10060030
801 Ga0157380_10068250
802 Ga0157379_11006237
803 Ga0207653_10001016
804 Ga0207653_10133028
805 Ga0207688_10064919
806 Ga0207647_10091796
807 Ga0207647_10133094
808 Ga0207685_10177334
809 Ga0207699_10191042
810 Ga0207645_10011837
811 Ga0207643_10000347
812 Ga0207643_10318252
813 Ga0207684_10008484
814 Ga0207684_10102605
815 Ga0207684_10169063
816 Ga0207684_10280753
817 Ga0207684_10323735
818 Ga0207654_10001289
819 Ga0207654_10054624
820 Ga0207707_10000429
821 Ga0207707_10044674
822 Ga0207707_10070723
823 Ga0207707_10122382
824 Ga0207695_10084205
825 Ga0207671_10203862
826 Ga0207663_10091169
827 Ga0207660_10000191
828 Ga0207660_10025559
829 Ga0207660_10290017
830 Ga0207660_10422058
831 Ga0207662_10116797
832 Ga0207657_10000075
833 Ga0207657_10192634
834 Ga0207649_10003503
835 Ga0207649_10078844
836 Ga0207652_10000511
837 Ga0207652_10127855
838 Ga0207652_10254766
839 Ga0207646_10006342
840 Ga0207646_10257217
841 Ga0207646_10263439
842 Ga0207646_10272705
843 Ga0207646_10296939
844 Ga0207681_10162437
845 Ga0207694_10125626
846 Ga0207659_10249747
847 Ga0207659_10498709
848 Ga0207644_10022451
849 Ga0207690_10003235
850 Ga0207706_10001002
851 Ga0207706_10112554
852 Ga0207686_10029998
853 Ga0207686_10247397
854 Ga0207709_10016176
855 Ga0207670_10010942
856 Ga0207670_10234791
857 Ga0207669_10104893
858 Ga0207704_10023656
859 Ga0207665_10006324
860 Ga0207691_10018576
861 Ga0207689_10000750
862 Ga0207689_10027919
863 Ga0207689_10040435
864 Ga0207689_10480251
865 Ga0207661_10007843
866 Ga0207679_10000739
867 Ga0207679_10008593
868 Ga0207667_10004119
869 Ga0207667_10092089
870 Ga0207667_10285561
871 Ga0207651_10398367
872 Ga0207712_10114056
873 Ga0207640_10083271
874 Ga0207640_10561016
875 Ga0207703_10061553
876 Ga0207639_10000841
877 Ga0207639_10129065
878 Ga0207678_10017091
879 Ga0207678_10231194
880 Ga0207678_10323024
881 Ga0207708_10048781
882 Ga0207708_10126166
883 Ga0207708_10159236
884 Ga0207708_10217784
885 Ga0207702_10001971
886 Ga0207702_10016032
887 Ga0207702_10063348
888 Ga0207702_10447311
889 Ga0207641_10244480
890 Ga0207648_10001603
891 Ga0207648_10038534
892 Ga0207676_10164976
893 Ga0207674_10001396
894 Ga0207674_10005197
895 Ga0207675_100002867
896 Ga0207675_100100935
897 Ga0207698_10012898
898 Ga0209971_1000557
899 Ga0209966_1000241
900 Ga0207428_10000514
901 Ga0207428_10027090
902 Ga0207428_10096135
903 Ga0268266_10062594
904 Ga0268266_10105900
905 Ga0268266_10352008
906 Ga0268265_10017432
907 Ga0268265_10025163
908 Ga0268265_10100179
909 Ga0268265_10107495
910 Ga0268265_10245267
911 Ga0268264_10056631
912 Ga0268264_10083729
913 Ga0268264_10084759
914 Ga0307405_10256290
915 Ga0307413_10385948
916 Ga0307413_10557211
917 Ga0307416_100013597
918 Ga0373958_0020624
919 Ga0373959_0042239
920 Ga0373928_0093723
921 Ga0373940_0019988
922 Ga0373940_0065842
923 Ga0373949_0010823
924 Ga0373949_0040493
925 Ga0373952_0012638
926 Ga0373952_0031925
927 Ga0373960_0011152
928 Ga0373960_0058425
929 Ga0373946_0078835
930 Ga0373961_0025216
931 Ga0373962_0036360
932 Ga0373931_0006329
933 Ga0373931_0016166
934 Ga0373931_0024383
935 Ga0373931_0164335
936 Ga0373931_0370053
937 Ga0373935_0401444
938 Ga0373927_0070682
939 Ga0373927_0452476
940 Ga0373925_0158261
941 Ga0395899_0019783
942 Ga0395899_0028253
943 Ga0395900_0012494
944 Ga0395900_0025710
945 Ga0395900_0031304
946 Ga0395900_0290326
947 Ga0395898_0014546
948 Ga0395898_0026217
949 Ga0395898_0117048
950 Ga0395905_0133531
951 Ga0395901_0002195
952 Ga0395901_0020442
953 Ga0395901_0285299
954 Ga0436365_0409520
955 Ga0436360_0381469
956 Ga0436363_0304984
957 Ga0439443_032654
958 Ga0439448_0007032
959 Ga0439448_0029805
960 Ga0439450_004769
961 Ga0439458_0005195
962 Ga0439459_0002301
963 Ga0439460_0000765
964 Ga0439460_0020950
965 Ga0451577_0008746
966 Ga0451577_0032496
967 Ga0453683_0018164
968 Ga0453683_0029200
969 Ga0466963_0027640
970 Ga0466964_0087802
971 Ga0453684_0105552
972 Ga0453684_0204779
973 Ga0451576_0032424
974 Ga0451576_0040638
975 Ga0451576_0042326
976 Ga0451576_0043808
977 Ga0451576_0239085
978 Ga0451576_0272838
979 Ga0495580_0159695
980 Ga0495584_0082756
981 Ga0496102_0008643
982 Ga0496102_0077469
983 Ga0496103_0179949
984 Ga0496105_0065607
985 Ga0496106_0188488
986 Ga0496106_0582664
987 Ga0496108_0055603
988 Ga0496108_0488867
989 Ga0496109_0081837
990 Ga0496109_0885665
991 Ga0496110_0108725
992 Ga0496110_0167927
993 Ga0496111_0071888
994 Ga0496112_0058376
995 Ga0496113_0671282
996 Ga0496115_0077908
997 Ga0501031_0106501
998 Ga0501033_0039971
999 Ga0501033_0096204
1000 Ga0501034_0001568
1001 Ga0501034_0004066
1002 Ga0501036_0283217
1003 Ga0501036_0762301
1004 Ga0501038_0169621
1005 Ga0501038_0508581
1006 Ga0501039_0029509
1007 Ga0501039_0307730
1008 Ga0501040_0000980
1009 Ga0501040_0057339
1010 Ga0501040_0095939
1011 Ga0501041_0012946
1012 Ga0501041_0059179
1013 Ga0501042_0011205
1014 Ga0501042_0260830
1015 Ga0501046_0000953
1016 Ga0501046_0053118
1017 Ga0501046_0091170
1018 Ga0501047_0128694
1019 Ga0501067_0215943
1020 Ga0501068_0000906
1021 Ga0501069_0090327
1022 Ga0501070_0073212
1023 Ga0501072_0043177
1024 Ga0501072_0049578
1025 Ga0501072_0146836
1026 Ga0501072_0185803
1027 Ga0501074_0000599
1028 Ga0501074_0034458
1029 Ga0501074_0107828
1030 Ga0501075_0028923
1031 Ga0501075_0052403
1032 Ga0501075_0059184
1033 Ga0501076_0020685
1034 Ga0501076_0103241
1035 Ga0501076_0165149
1036 Ga0501077_0086181
1037 Ga0501077_0092038
1038 Ga0501077_0158028
1039 Ga0501079_0004802
1040 Ga0501079_0024039
1041 Ga0501079_0178419
1042 Ga0501080_0247610
1043 Ga0501080_0252802
1044 Ga0501081_0028568
1045 Ga0501081_0167130
1046 Ga0501081_0566021
1047 Ga0501083_0060001
1048 Ga0501083_0097634
1049 Ga0501044_0156231
1050 Ga0501044_0191911
1051 Ga0501045_0002865
1052 Ga0501045_0064265
1053 Ga0501045_0148197
1054 nmdc:mga03683_12639_c1
1055 nmdc:mga03n38_26925_c1
1056 nmdc:mga00v17_24922_c1
1057 nmdc:mga0yw44_45778_c1
1058 nmdc:mga0yw44_78112_c1
1059 nmdc:mga0k408_233173_c1
1060 nmdc:mga0k408_2555_c1
1061 nmdc:mga06z11_9911_c1
1062 nmdc:mga07m45_28683_c1
1063 nmdc:mga05p37_232825_c1
1064 nmdc:mga05p37_282810_c1
1065 nmdc:mga05p37_40548_c1
1066 nmdc:mga05p37_481286_c1
1067 nmdc:mga05p37_49236_c1
1068 nmdc:mga05p37_53501_c2
1069 nmdc:mga05p37_64690_c1
1070 nmdc:mga05p37_6668_c1
1071 nmdc:mga05p37_74580_c1
1072 nmdc:mga05p37_774642_c1
1073 nmdc:mga09592_122_c1
1074 nmdc:mga09592_190794_c1
1075 nmdc:mga09592_42957_c1
1076 nmdc:mga09592_50600_c1
1077 nmdc:mga0qj67_115_c1
1078 nmdc:mga0qj67_745392_c1
1079 nmdc:mga0qj67_8752_c1
1080 nmdc:mga0qj67_92213_c1
1081 nmdc:mga06r32_1168_c1
1082 nmdc:mga06r32_119472_c1
1083 nmdc:mga06r32_423_c1
1084 nmdc:mga06r32_522_c1
1085 nmdc:mga08y16_15865_c1
1086 nmdc:mga08y16_260164_c1
1087 nmdc:mga08y16_29018_c1
1088 nmdc:mga08y16_64258_c1
1089 nmdc:mga08y16_859154_c1
1090 nmdc:mga0n895_139212_c1
1091 nmdc:mga0n895_190679_c1
1092 nmdc:mga0n895_235373_c1
1093 nmdc:mga0n895_38642_c1
1094 nmdc:mga0n895_40751_c1
1095 nmdc:mga0n895_634897_c1
1096 nmdc:mga0n895_837501_c1
1097 nmdc:mga0n895_98976_c1
1098 nmdc:mga0rr50_19854_c1
1099 nmdc:mga0rr50_21457_c1
1100 nmdc:mga0rr50_221129_c1
1101 nmdc:mga0rr50_35499_c1
1102 nmdc:mga0rr50_36833_c1
1103 nmdc:mga0rr50_70114_c1
1104 nmdc:mga0rr50_85598_c1
1105 nmdc:mga08x19_70508_c1
1106 nmdc:mga08x19_78724_c1
1107 nmdc:mga08x19_96992_c1
1108 nmdc:mga0a205_161696_c1
1109 nmdc:mga0a205_21051_c1
1110 nmdc:mga0a205_21399_c1
1111 nmdc:mga0a205_224987_c1
1112 nmdc:mga0a205_23241_c1
1113 nmdc:mga0a205_235728_c1
1114 nmdc:mga0a205_25734_c1
1115 nmdc:mga0a205_47901_c1
1116 nmdc:mga0a205_50286_c1
1117 nmdc:mga0a205_5513_c1
1118 nmdc:mga0a205_8279_c1
1119 nmdc:mga0a205_96893_c1
1120 nmdc:mga0sz30_212_c1
1121 nmdc:mga0sz30_43422_c1
1122 Ga0500644_0014056
1123 Ga0500651_0066453
1124 Ga0500658_0033690
1125 Ga0500616_0002226
1126 Ga0500609_008393
1127 Ga0500552_000227
1128 Ga0501084_0012502
1129 Ga0501084_0643733
1130 Ga0501082_0001347
1131 Ga0501082_0044096
1132 Ga0501082_0175273
1133 Ga0530510_0069204
1134 Ga0530510_0234689

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

76

247

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.756 50 248
7mc0-assembly1.cif.gz_B inward facing conformation of the metni methionine abc transporter 0.71 43 247
3tuz-assembly2.cif.gz_F inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form 0.7017 50 248
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.6929 58 235
7ahh-assembly1.cif.gz_B opua inhibited inward-facing, sbd docked 0.6827 17 247
ID Description Score Start End Superfamily
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9141 56 245 1.10.3720.10
af_Q57856_64_258_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9014 62 240 1.10.3720.10
af_Q2G1I4_54_251_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8914 57 247 1.10.3720.10
af_P75851_53_247_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8879 56 245 1.10.3720.10
af_Q2FVG9_10_202_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8865 59 245 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V2TWS1-F1-model_v4 ABC transporter permease 0.9338 5 252 GO:0005886
GO:0055085
AF-A0A7W7Z8F5-F1-model_v4 NitT/TauT family transport system permease protein 0.9271 9 252 GO:0005886
GO:0055085
AF-A0A1N7J0R8-F1-model_v4 Putative hydroxymethylpyrimidine transport system permease protein 0.9253 19 246 GO:0005886
GO:0055085
AF-A0A847VNA7-F1-model_v4 ABC transporter permease 0.9246 4 252 GO:0005886
GO:0055085
AF-A0A524IF45-F1-model_v4 ABC transporter permease 0.9241 7 252 GO:0005886
GO:0055085

Map