F464520

General Info

Members Datasets Scaffolds Average Seq Length
567 241 1134 89

Family's Representative Sequence

Representative Sequence 3300025960|Ga0207651_11882977|Ga0207651_118829771
Length 92
Sequence MGVRWRPVTTKRGPVAKRTKSALKANRQNIKRREANRQIRASLDDNDVDGAKTALSQTVSIVDKMATKGIIHRNTAGRYKSRLASRLTKASA

Samples

Sample ID Description Type Environment
1 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
85 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
86 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
87 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
93 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
94 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
95 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
96 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
99 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
100 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
101 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
102 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
103 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
104 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
105 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
106 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
107 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
108 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027252 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S PM (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
156 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
162 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
163 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
164 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
165 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
166 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
167 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
168 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
169 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
170 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
180 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
181 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
182 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
183 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
184 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
185 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
186 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
187 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
191 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
192 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
193 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
194 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
197 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
204 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
205 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
206 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
207 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
208 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
209 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
210 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
211 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
212 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
218 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
223 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
224 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
225 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
226 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
227 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
228 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
229 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
232 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
233 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
234 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
235 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
236 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
237 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
238 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
239 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
240 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
241 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.41
Rhizosphere 98.41
Stem 0
Stem Tuber 0
Unclassified 36.33

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207651_11882977 3300025960 Unclassified 538
2 MBSR1b_contig_11812573 2162886012 Unclassified 836
3 Ga0058860_12175475 3300004801 Bacteria 515
4 Ga0065714_10292723 3300005288 Bacteria 705
5 Ga0065704_10450404 3300005289 Bacteria 706
6 Ga0065704_10658794 3300005289 Bacteria 568
7 Ga0065712_10000157 3300005290 Bacteria 58547
8 Ga0065712_10099250 3300005290 Unclassified 2090
9 Ga0065712_10796277 3300005290 Unclassified 506
10 Ga0065715_10449556 3300005293 Unclassified 827
11 Ga0065707_10100639 3300005295 Unclassified 2916
12 Ga0065707_10118375 3300005295 Bacteria 2187
13 Ga0065707_10401373 3300005295 Bacteria 852
14 Ga0070676_10002732 3300005328 Bacteria 9099
15 Ga0070690_100138128 3300005330 Unclassified 1652
16 Ga0070690_100178879 3300005330 Bacteria 1465
17 Ga0070690_100266220 3300005330 Unclassified 1217
18 Ga0070690_100321250 3300005330 Bacteria 1115
19 Ga0070690_100663726 3300005330 Bacteria 797
20 Ga0070670_100095821 3300005331 Bacteria 2553
21 Ga0070670_100435054 3300005331 Bacteria 1161
22 Ga0070670_101739731 3300005331 Bacteria 574
23 Ga0070677_10003227 3300005333 Bacteria 5248
24 Ga0070677_10049033 3300005333 Bacteria 1699
25 Ga0068869_100581096 3300005334 Bacteria 944
26 Ga0068869_100822610 3300005334 Bacteria 800
27 Ga0070666_10002058 3300005335 Bacteria 12205
28 Ga0070666_11110198 3300005335 Unclassified 588
29 Ga0070666_11325561 3300005335 Unclassified 537
30 Ga0070680_100215371 3300005336 Bacteria 1621
31 Ga0070680_100724390 3300005336 Bacteria 856
32 Ga0070682_100347562 3300005337 Bacteria 1104
33 Ga0070682_100925485 3300005337 Bacteria 718
34 Ga0068868_100420654 3300005338 Bacteria 1157
35 Ga0068868_101342716 3300005338 Bacteria 665
36 Ga0070660_101541518 3300005339 Bacteria 565
37 Ga0070689_100037709 3300005340 Bacteria 3696
38 Ga0070689_100098826 3300005340 Bacteria 2309
39 Ga0070689_100219776 3300005340 Unclassified 1558
40 Ga0070689_100421749 3300005340 Unclassified 1131
41 Ga0070691_10289425 3300005341 Bacteria 891
42 Ga0070687_100010126 3300005343 Bacteria 4062
43 Ga0070687_100600785 3300005343 Unclassified 756
44 Ga0070661_100018283 3300005344 Bacteria 4982
45 Ga0070661_100285848 3300005344 Unclassified 1280
46 Ga0070692_10046272 3300005345 Bacteria 2248
47 Ga0070692_11339184 3300005345 Unclassified 515
48 Ga0070668_100077184 3300005347 Bacteria 2604
49 Ga0070668_100090405 3300005347 Unclassified 2412
50 Ga0070668_100338528 3300005347 Bacteria 1270
51 Ga0070669_100004330 3300005353 Bacteria 10253
52 Ga0070669_100317993 3300005353 Bacteria 1256
53 Ga0070669_100466161 3300005353 Bacteria 1043
54 Ga0070669_100714246 3300005353 Bacteria 847
55 Ga0070669_101400909 3300005353 Unclassified 607
56 Ga0070669_101886647 3300005353 Bacteria 522
57 Ga0070675_100015380 3300005354 Bacteria 6048
58 Ga0070675_100020507 3300005354 Bacteria 5273
59 Ga0070675_100065654 3300005354 Bacteria 3001
60 Ga0070675_100069390 3300005354 Bacteria 2920
61 Ga0070675_100828104 3300005354 Bacteria 846
62 Ga0070671_101243697 3300005355 Unclassified 656
63 Ga0070674_100233167 3300005356 Unclassified 1437
64 Ga0070673_100017267 3300005364 Bacteria 5125
65 Ga0070673_100153102 3300005364 Bacteria 1954
66 Ga0070673_100721151 3300005364 Bacteria 917
67 Ga0070673_100810870 3300005364 Bacteria 865
68 Ga0070688_100062307 3300005365 Bacteria 2361
69 Ga0070688_100083133 3300005365 Unclassified 2077
70 Ga0070688_100118734 3300005365 Bacteria 1768
71 Ga0070688_100345739 3300005365 Unclassified 1087
72 Ga0070688_100786295 3300005365 Bacteria 743
73 Ga0070659_100154135 3300005366 Unclassified 1875
74 Ga0070659_100945344 3300005366 Unclassified 755
75 Ga0070667_100099133 3300005367 Unclassified 2515
76 Ga0070667_100634342 3300005367 Bacteria 986
77 Ga0070701_10041587 3300005438 Bacteria 2343
78 Ga0070701_10316566 3300005438 Unclassified 964
79 Ga0070711_100321012 3300005439 Unclassified 1237
80 Ga0070705_100549046 3300005440 Bacteria 885
81 Ga0070705_100992109 3300005440 Unclassified 681
82 Ga0070700_100043287 3300005441 Bacteria 2769
83 Ga0070700_100576587 3300005441 Bacteria 878
84 Ga0070700_101146552 3300005441 Bacteria 647
85 Ga0070694_100776216 3300005444 Unclassified 784
86 Ga0070694_100941101 3300005444 Unclassified 715
87 Ga0070694_100947348 3300005444 Bacteria 713
88 Ga0070708_101925431 3300005445 Bacteria 548
89 Ga0070663_100996421 3300005455 Bacteria 728
90 Ga0070678_100061768 3300005456 Bacteria 2763
91 Ga0070678_100126106 3300005456 Bacteria 2027
92 Ga0070678_100608849 3300005456 Unclassified 976
93 Ga0070678_101160205 3300005456 Unclassified 715
94 Ga0070678_101275804 3300005456 Unclassified 683
95 Ga0070678_102081309 3300005456 Bacteria 537
96 Ga0070662_100015586 3300005457 Bacteria 5093
97 Ga0070662_100585745 3300005457 Unclassified 937
98 Ga0070681_10047573 3300005458 Bacteria 4288
99 Ga0068867_100011383 3300005459 Bacteria 6277
100 Ga0068867_100312007 3300005459 Bacteria 1300
101 Ga0070685_10002152 3300005466 Bacteria 10148
102 Ga0070706_100071653 3300005467 Bacteria 3205
103 Ga0070707_100075015 3300005468 Bacteria 3262
104 Ga0070707_100350536 3300005468 Unclassified 1434
105 Ga0070698_100069962 3300005471 Bacteria 3522
106 Ga0070698_100992958 3300005471 Unclassified 786
107 Ga0070699_100283005 3300005518 Bacteria 1485
108 Ga0070699_100760290 3300005518 Bacteria 886
109 Ga0070679_100091085 3300005530 Unclassified 3037
110 Ga0070684_100403721 3300005535 Unclassified 1260
111 Ga0070697_100173734 3300005536 Unclassified 1824
112 Ga0070672_100048249 3300005543 Unclassified 3308
113 Ga0070672_100090003 3300005543 Unclassified 2474
114 Ga0070672_100409230 3300005543 Unclassified 1164
115 Ga0070672_101243029 3300005543 Unclassified 664
116 Ga0070672_101322209 3300005543 Unclassified 644
117 Ga0070672_101363096 3300005543 Bacteria 634
118 Ga0070686_100030006 3300005544 Bacteria 3313
119 Ga0070686_100332548 3300005544 Bacteria 1136
120 Ga0070686_100411412 3300005544 Unclassified 1031
121 Ga0070686_100541762 3300005544 Unclassified 909
122 Ga0070686_101206284 3300005544 Unclassified 629
123 Ga0070695_100321726 3300005545 Bacteria 1150
124 Ga0070696_100223184 3300005546 Bacteria 1415
125 Ga0070693_100740435 3300005547 Unclassified 723
126 Ga0070665_100083489 3300005548 Bacteria 3199
127 Ga0070665_100491356 3300005548 Bacteria 1238
128 Ga0070665_100610085 3300005548 Unclassified 1104
129 Ga0070704_100063426 3300005549 Bacteria 2652
130 Ga0070704_100114053 3300005549 Bacteria 2062
131 Ga0070704_100215805 3300005549 Unclassified 1557
132 Ga0070704_100296862 3300005549 Bacteria 1345
133 Ga0070704_100902106 3300005549 Bacteria 795
134 Ga0070704_101826326 3300005549 Bacteria 563
135 Ga0070664_100006238 3300005564 Bacteria 9630
136 Ga0070664_100059268 3300005564 Bacteria 3256
137 Ga0070664_100106703 3300005564 Unclassified 2441
138 Ga0070664_100943615 3300005564 Bacteria 810
139 Ga0068857_100215386 3300005577 Unclassified 1753
140 Ga0068857_100671882 3300005577 Bacteria 983
141 Ga0068854_100882347 3300005578 Bacteria 785
142 Ga0070702_100774808 3300005615 Bacteria 739
143 Ga0070702_100939524 3300005615 Bacteria 680
144 Ga0070702_101649028 3300005615 Bacteria 532
145 Ga0068852_100050124 3300005616 Bacteria 3576
146 Ga0068859_100048797 3300005617 Unclassified 4253
147 Ga0068859_100188780 3300005617 Bacteria 2145
148 Ga0068859_100243264 3300005617 Bacteria 1889
149 Ga0068859_100274759 3300005617 Unclassified 1777
150 Ga0068859_100787437 3300005617 Unclassified 1039
151 Ga0068859_101175476 3300005617 Unclassified 845
152 Ga0068859_101444286 3300005617 Unclassified 759
153 Ga0068859_102013246 3300005617 Bacteria 638
154 Ga0068864_100111047 3300005618 Bacteria 2442
155 Ga0068864_100261602 3300005618 Unclassified 1610
156 Ga0068864_100310920 3300005618 Unclassified 1477
157 Ga0068864_100603003 3300005618 Bacteria 1066
158 Ga0068864_101133557 3300005618 Unclassified 779
159 Ga0068861_100003257 3300005719 Bacteria 10742
160 Ga0068861_100294418 3300005719 Bacteria 1403
161 Ga0068861_100411480 3300005719 Unclassified 1203
162 Ga0068861_101027323 3300005719 Unclassified 788
163 Ga0068870_10000409 3300005840 Bacteria 16148
164 Ga0068870_10135116 3300005840 Unclassified 1437
165 Ga0068870_10621507 3300005840 Bacteria 736
166 Ga0068863_100042106 3300005841 Bacteria 4340
167 Ga0068863_100609731 3300005841 Unclassified 1081
168 Ga0068858_100210597 3300005842 Unclassified 1839
169 Ga0068860_100054699 3300005843 Bacteria 3794
170 Ga0068860_100257794 3300005843 Unclassified 1699
171 Ga0068860_100550420 3300005843 Bacteria 1156
172 Ga0068860_101588018 3300005843 Unclassified 676
173 Ga0068862_100006569 3300005844 Bacteria 9648
174 Ga0068862_100037927 3300005844 Bacteria 4086
175 Ga0068862_100291411 3300005844 Bacteria 1499
176 Ga0068862_100909470 3300005844 Bacteria 866
177 Ga0068862_101598092 3300005844 Unclassified 659
178 Ga0068862_102071741 3300005844 Bacteria 580
179 Ga0075432_10115023 3300006058 Bacteria 1006
180 Ga0097621_100502328 3300006237 Bacteria 1098
181 Ga0097621_101688942 3300006237 Unclassified 603
182 Ga0068871_100100507 3300006358 Unclassified 2423
183 Ga0068871_100401166 3300006358 Unclassified 1221
184 Ga0068871_100848087 3300006358 Bacteria 844
185 Ga0075428_100001700 3300006844 Bacteria 23477
186 Ga0075428_100002416 3300006844 Bacteria 20297
187 Ga0075428_100005624 3300006844 Bacteria 13924
188 Ga0075428_100024130 3300006844 Bacteria 6728
189 Ga0075428_100044304 3300006844 Bacteria 4890
190 Ga0075428_100543122 3300006844 Bacteria 1242
191 Ga0075428_100544505 3300006844 Bacteria 1241
192 Ga0075428_100607190 3300006844 Unclassified 1168
193 Ga0075428_102200606 3300006844 Unclassified 569
194 Ga0075430_100006849 3300006846 Bacteria 9607
195 Ga0075430_100021061 3300006846 Bacteria 5543
196 Ga0075430_100087556 3300006846 Bacteria 2606
197 Ga0075430_100300438 3300006846 Unclassified 1328
198 Ga0075430_100506955 3300006846 Bacteria 996
199 Ga0075430_100698472 3300006846 Bacteria 836
200 Ga0075431_100090492 3300006847 Bacteria 3158
201 Ga0075431_100126365 3300006847 Bacteria 2638
202 Ga0075431_100218140 3300006847 Unclassified 1946
203 Ga0075431_100845498 3300006847 Bacteria 887
204 Ga0075433_10060674 3300006852 Bacteria 3312
205 Ga0075433_10061911 3300006852 Unclassified 3278
206 Ga0075433_10232638 3300006852 Bacteria 1636
207 Ga0075433_10432161 3300006852 Bacteria 1161
208 Ga0075433_10434379 3300006852 Bacteria 1158
209 Ga0075434_100062600 3300006871 Unclassified 3704
210 Ga0075434_100085172 3300006871 Bacteria 3160
211 Ga0075434_101373994 3300006871 Unclassified 716
212 Ga0075429_100001299 3300006880 Bacteria 20353
213 Ga0075429_100021693 3300006880 Bacteria 5567
214 Ga0075429_100022229 3300006880 Bacteria 5502
215 Ga0075429_100057628 3300006880 Bacteria 3382
216 Ga0075429_100220346 3300006880 Bacteria 1662
217 Ga0075429_100481740 3300006880 Unclassified 1087
218 Ga0075429_101259609 3300006880 Unclassified 645
219 Ga0068865_100335187 3300006881 Bacteria 1221
220 Ga0068865_101627352 3300006881 Unclassified 581
221 Ga0097620_100048797 3300006931 Unclassified 4253
222 Ga0097620_100188781 3300006931 Bacteria 2145
223 Ga0097620_100243271 3300006931 Bacteria 1889
224 Ga0097620_100274767 3300006931 Unclassified 1777
225 Ga0097620_100787229 3300006931 Unclassified 1039
226 Ga0097620_101175609 3300006931 Unclassified 845
227 Ga0097620_101443996 3300006931 Unclassified 759
228 Ga0097620_102013397 3300006931 Bacteria 638
229 Ga0075435_100024200 3300007076 Bacteria 4708
230 Ga0075435_101357130 3300007076 Unclassified 623
231 Ga0075435_101746759 3300007076 Unclassified 546
232 Ga0105240_10015432 3300009093 Bacteria 10387
233 Ga0111539_10001176 3300009094 Bacteria 34725
234 Ga0111539_10007015 3300009094 Bacteria 14452
235 Ga0111539_10011819 3300009094 Bacteria 10944
236 Ga0111539_10014042 3300009094 Bacteria 10007
237 Ga0111539_10085748 3300009094 Bacteria 3701
238 Ga0111539_10330824 3300009094 Bacteria 1773
239 Ga0111539_10588410 3300009094 Bacteria 1296
240 Ga0111539_10742466 3300009094 Bacteria 1142
241 Ga0111539_12448957 3300009094 Bacteria 605
242 Ga0105245_10430399 3300009098 Bacteria 1324
243 Ga0105245_11409355 3300009098 Unclassified 747
244 Ga0105247_10551484 3300009101 Unclassified 848
245 Ga0114129_10025293 3300009147 Bacteria 8411
246 Ga0114129_10108629 3300009147 Bacteria 3830
247 Ga0114129_10253277 3300009147 Bacteria 2362
248 Ga0114129_10446193 3300009147 Unclassified 1697
249 Ga0114129_10456680 3300009147 Bacteria 1675
250 Ga0114129_10555270 3300009147 Unclassified 1493
251 Ga0114129_10579030 3300009147 Unclassified 1457
252 Ga0114129_12620998 3300009147 Bacteria 601
253 Ga0105243_11762624 3300009148 Bacteria 649
254 Ga0105242_10556744 3300009176 Unclassified 1100
255 Ga0105242_12241914 3300009176 Unclassified 592
256 Ga0105248_10027232 3300009177 Bacteria 6360
257 Ga0105248_10630074 3300009177 Bacteria 1210
258 Ga0105248_10974505 3300009177 Bacteria 958
259 Ga0105248_11032901 3300009177 Unclassified 929
260 Ga0105249_10005440 3300009553 Bacteria 10995
261 Ga0105249_10940168 3300009553 Bacteria 932
262 Ga0105249_12263548 3300009553 Unclassified 616
263 Ga0105249_12362118 3300009553 Bacteria 604
264 Ga0099796_10241392 3300010159 Bacteria 747
265 Ga0105246_10041172 3300011119 Bacteria 3121
266 Ga0105246_10995656 3300011119 Bacteria 758
267 Ga0157321_1015243 3300012487 Unclassified 647
268 Ga0157314_1009787 3300012500 Unclassified 817
269 Ga0157371_10417344 3300013102 Unclassified 983
270 Ga0157371_11190791 3300013102 Bacteria 587
271 Ga0157374_10362810 3300013296 Bacteria 1441
272 Ga0163162_10264816 3300013306 Bacteria 1850
273 Ga0163162_11219367 3300013306 Bacteria 854
274 Ga0163162_11488664 3300013306 Bacteria 771
275 Ga0157372_10428061 3300013307 Unclassified 1543
276 Ga0157372_12128408 3300013307 Bacteria 645
277 Ga0157375_10017399 3300013308 Bacteria 6486
278 Ga0157375_10363735 3300013308 Unclassified 1613
279 Ga0157375_10771455 3300013308 Bacteria 1112
280 Ga0157375_11218114 3300013308 Unclassified 883
281 Ga0157375_12298425 3300013308 Unclassified 643
282 Ga0163163_13068646 3300014325 Bacteria 521
283 Ga0157380_10094819 3300014326 Unclassified 2471
284 Ga0157380_10195247 3300014326 Bacteria 1791
285 Ga0157380_10199689 3300014326 Bacteria 1773
286 Ga0157380_10204076 3300014326 Unclassified 1756
287 Ga0157377_10001579 3300014745 Bacteria 9911
288 Ga0157377_10012641 3300014745 Bacteria 4249
289 Ga0157377_10420179 3300014745 Bacteria 915
290 Ga0157377_10606549 3300014745 Bacteria 782
291 Ga0157379_10018661 3300014968 Bacteria 6114
292 Ga0157376_10354060 3300014969 Bacteria 1406
293 Ga0157376_10376103 3300014969 Bacteria 1367
294 Ga0157376_11475922 3300014969 Unclassified 713
295 Ga0163161_10018958 3300017792 Bacteria 4823
296 Ga0207673_1039471 3300025290 Bacteria 662
297 Ga0207697_10000483 3300025315 Bacteria 22534
298 Ga0207697_10488256 3300025315 Bacteria 544
299 Ga0207682_10005531 3300025893 Bacteria 5143
300 Ga0207682_10150156 3300025893 Bacteria 1050
301 Ga0207688_10002562 3300025901 Bacteria 9831
302 Ga0207688_10479087 3300025901 Bacteria 778
303 Ga0207680_10062643 3300025903 Unclassified 2273
304 Ga0207645_10003430 3300025907 Bacteria 12048
305 Ga0207643_10002454 3300025908 Bacteria 10012
306 Ga0207643_10428439 3300025908 Bacteria 839
307 Ga0207684_10074921 3300025910 Bacteria 2876
308 Ga0207684_10308322 3300025910 Bacteria 1365
309 Ga0207663_11117817 3300025916 Unclassified 634
310 Ga0207660_10656011 3300025917 Bacteria 856
311 Ga0207662_10010573 3300025918 Bacteria 5101
312 Ga0207662_10078343 3300025918 Bacteria 2011
313 Ga0207657_10306820 3300025919 Bacteria 1257
314 Ga0207657_10988618 3300025919 Bacteria 646
315 Ga0207649_10019427 3300025920 Bacteria 3883
316 Ga0207649_10219423 3300025920 Unclassified 1353
317 Ga0207652_10104459 3300025921 Unclassified 2506
318 Ga0207646_10047830 3300025922 Bacteria 3836
319 Ga0207646_10543525 3300025922 Unclassified 1045
320 Ga0207681_10011928 3300025923 Bacteria 5352
321 Ga0207681_10161591 3300025923 Bacteria 1689
322 Ga0207681_10344577 3300025923 Bacteria 1191
323 Ga0207681_10438607 3300025923 Bacteria 1061
324 Ga0207681_10669713 3300025923 Bacteria 861
325 Ga0207681_11602501 3300025923 Unclassified 545
326 Ga0207681_11671005 3300025923 Bacteria 532
327 Ga0207650_10071762 3300025925 Unclassified 2605
328 Ga0207650_10411594 3300025925 Bacteria 1121
329 Ga0207650_11085101 3300025925 Unclassified 681
330 Ga0207659_10009325 3300025926 Bacteria 6128
331 Ga0207659_10011060 3300025926 Bacteria 5689
332 Ga0207659_10065358 3300025926 Unclassified 2636
333 Ga0207659_10147021 3300025926 Unclassified 1836
334 Ga0207687_11669833 3300025927 Unclassified 546
335 Ga0207644_11827978 3300025931 Bacteria 508
336 Ga0207690_10058404 3300025932 Unclassified 2609
337 Ga0207706_10018937 3300025933 Bacteria 6191
338 Ga0207706_10127436 3300025933 Bacteria 2238
339 Ga0207706_10624306 3300025933 Unclassified 924
340 Ga0207670_10210737 3300025936 Unclassified 1482
341 Ga0207670_11072962 3300025936 Unclassified 679
342 Ga0207669_10026677 3300025937 Unclassified 3148
343 Ga0207669_10859175 3300025937 Bacteria 756
344 Ga0207669_11585612 3300025937 Unclassified 559
345 Ga0207704_10519042 3300025938 Bacteria 963
346 Ga0207704_10859357 3300025938 Bacteria 761
347 Ga0207704_11257604 3300025938 Unclassified 632
348 Ga0207704_11906644 3300025938 Unclassified 511
349 Ga0207691_10003015 3300025940 Bacteria 16440
350 Ga0207691_10033543 3300025940 Bacteria 4779
351 Ga0207691_10036150 3300025940 Bacteria 4577
352 Ga0207691_10745213 3300025940 Unclassified 825
353 Ga0207691_11632382 3300025940 Unclassified 523
354 Ga0207711_10088205 3300025941 Unclassified 2723
355 Ga0207711_10621459 3300025941 Unclassified 1008
356 Ga0207689_10005330 3300025942 Bacteria 11529
357 Ga0207689_10146139 3300025942 Bacteria 1948
358 Ga0207651_10043416 3300025960 Unclassified 3000
359 Ga0207651_10585964 3300025960 Bacteria 973
360 Ga0207712_10169778 3300025961 Unclassified 1704
361 Ga0207712_10590385 3300025961 Unclassified 960
362 Ga0207712_11625460 3300025961 Bacteria 579
363 Ga0207668_10066538 3300025972 Unclassified 2555
364 Ga0207658_10315696 3300025986 Bacteria 1351
365 Ga0207677_10243954 3300026023 Unclassified 1455
366 Ga0207677_11100082 3300026023 Bacteria 724
367 Ga0207703_10256353 3300026035 Unclassified 1579
368 Ga0207678_10332542 3300026067 Bacteria 1308
369 Ga0207678_11585048 3300026067 Unclassified 577
370 Ga0207708_10318851 3300026075 Bacteria 1268
371 Ga0207708_10320950 3300026075 Bacteria 1264
372 Ga0207708_10789170 3300026075 Bacteria 817
373 Ga0207702_11969302 3300026078 Unclassified 575
374 Ga0207641_10028662 3300026088 Bacteria 4601
375 Ga0207641_10128653 3300026088 Bacteria 2271
376 Ga0207648_10008442 3300026089 Bacteria 9976
377 Ga0207648_10172182 3300026089 Bacteria 1914
378 Ga0207648_10260051 3300026089 Bacteria 1549
379 Ga0207648_10360139 3300026089 Bacteria 1312
380 Ga0207676_10092442 3300026095 Bacteria 2488
381 Ga0207676_10281520 3300026095 Unclassified 1510
382 Ga0207676_10299317 3300026095 Unclassified 1468
383 Ga0207676_10596798 3300026095 Unclassified 1060
384 Ga0207676_11092619 3300026095 Bacteria 788
385 Ga0207676_11238122 3300026095 Unclassified 740
386 Ga0207674_10068664 3300026116 Bacteria 3566
387 Ga0207675_100001490 3300026118 Bacteria 23487
388 Ga0207675_100119983 3300026118 Bacteria 2487
389 Ga0207675_100574183 3300026118 Unclassified 1129
390 Ga0207675_100676349 3300026118 Unclassified 1040
391 Ga0207675_101388030 3300026118 Bacteria 723
392 Ga0207683_10005514 3300026121 Bacteria 10845
393 Ga0207683_10380646 3300026121 Bacteria 1297
394 Ga0207683_10643931 3300026121 Unclassified 982
395 Ga0207683_11319020 3300026121 Unclassified 668
396 Ga0207698_10480637 3300026142 Bacteria 1205
397 Ga0207698_12050030 3300026142 Unclassified 586
398 Ga0209973_1035219 3300027252 Bacteria 719
399 Ga0209995_1033233 3300027471 Unclassified 866
400 Ga0209970_1094118 3300027614 Unclassified 570
401 Ga0209966_1051884 3300027695 Unclassified 874
402 Ga0209998_10207626 3300027717 Unclassified 513
403 Ga0209974_10419149 3300027876 Bacteria 528
404 Ga0207428_10000236 3300027907 Bacteria 75764
405 Ga0207428_10018461 3300027907 Bacteria 5956
406 Ga0207428_10039349 3300027907 Bacteria 3840
407 Ga0207428_10071417 3300027907 Bacteria 2726
408 Ga0207428_10199899 3300027907 Bacteria 1504
409 Ga0207428_10427500 3300027907 Bacteria 967
410 Ga0207428_10830411 3300027907 Unclassified 655
411 Ga0268266_10206222 3300028379 Unclassified 1801
412 Ga0268265_10062056 3300028380 Unclassified 2870
413 Ga0268265_10569019 3300028380 Bacteria 1078
414 Ga0268265_11015422 3300028380 Bacteria 820
415 Ga0268265_11041903 3300028380 Unclassified 810
416 Ga0268265_11101254 3300028380 Bacteria 788
417 Ga0268265_11937260 3300028380 Bacteria 596
418 Ga0268265_12690850 3300028380 Bacteria 503
419 Ga0268264_10051047 3300028381 Unclassified 3445
420 Ga0268264_10203658 3300028381 Unclassified 1812
421 Ga0268264_11969699 3300028381 Unclassified 593
422 Ga0316182_1112002 3300030745 Bacteria 786
423 Ga0307408_100050590 3300031548 Bacteria 2989
424 Ga0307408_101156895 3300031548 Bacteria 720
425 Ga0307408_101629401 3300031548 Bacteria 613
426 Ga0307405_10089035 3300031731 Unclassified 2038
427 Ga0307413_10245672 3300031824 Unclassified 1324
428 Ga0307413_10686555 3300031824 Bacteria 849
429 Ga0307413_10874059 3300031824 Unclassified 761
430 Ga0307410_10001474 3300031852 Bacteria 10647
431 Ga0307410_10042158 3300031852 Bacteria 3015
432 Ga0307406_10014930 3300031901 Bacteria 4481
433 Ga0307406_10411474 3300031901 Bacteria 1075
434 Ga0307406_11866609 3300031901 Unclassified 535
435 Ga0307407_10003122 3300031903 Bacteria 6703
436 Ga0307407_10364498 3300031903 Bacteria 1027
437 Ga0307412_10026807 3300031911 Bacteria 3587
438 Ga0307412_10043594 3300031911 Bacteria 2922
439 Ga0307412_10406306 3300031911 Bacteria 1110
440 Ga0307409_100138426 3300031995 Bacteria 2093
441 Ga0307409_100514974 3300031995 Bacteria 1168
442 Ga0307409_100572616 3300031995 Unclassified 1112
443 Ga0307409_101169846 3300031995 Bacteria 792
444 Ga0307416_100012197 3300032002 Bacteria 5775
445 Ga0307416_100050094 3300032002 Bacteria 3326
446 Ga0307416_100053309 3300032002 Unclassified 3244
447 Ga0307416_100806477 3300032002 Unclassified 1035
448 Ga0307416_101219836 3300032002 Unclassified 858
449 Ga0307416_101366798 3300032002 Unclassified 814
450 Ga0307416_102579622 3300032002 Unclassified 606
451 Ga0307411_10004021 3300032005 Bacteria 6954
452 Ga0307411_10756651 3300032005 Bacteria 852
453 Ga0307415_100031497 3300032126 Bacteria 3417
454 Ga0307415_100082865 3300032126 Bacteria 2296
455 Ga0307415_100887134 3300032126 Bacteria 821
456 Ga0373950_0052900 3300034818 Unclassified 801
457 Ga0373938_0247345 3300034957 Unclassified 509
458 Ga0373940_0025660 3300035088 Unclassified 1536
459 Ga0373932_0026007 3300035112 Unclassified 1589
460 Ga0373962_0174023 3300035242 Unclassified 716
461 Ga0373931_0573605 3300035691 Unclassified 735
462 Ga0373933_0340623 3300035724 Unclassified 973
463 Ga0395901_1213230 3300038443 Bacteria 720
464 Ga0439453_0077842 3300041408 Unclassified 711
465 Ga0439443_018376 3300042003 Unclassified 1082
466 Ga0450920_039213 3300042122 Bacteria 943
467 Ga0450923_100863 3300042125 Bacteria 666
468 Ga0450890_033880 3300042127 Bacteria 736
469 Ga0439446_0320156 3300042156 Unclassified 548
470 Ga0450908_018712 3300042184 Bacteria 1222
471 Ga0450908_030068 3300042184 Bacteria 944
472 Ga0439435_0107464 3300042436 Bacteria 863
473 Ga0439435_0185199 3300042436 Unclassified 681
474 Ga0439444_0071978 3300042437 Unclassified 742
475 Ga0439459_0012378 3300042438 Bacteria 1519
476 Ga0439464_0130179 3300042439 Unclassified 779
477 Ga0439460_0286741 3300042461 Unclassified 574
478 Ga0439460_0318293 3300042461 Unclassified 546
479 Ga0439440_0044918 3300042993 Unclassified 1088
480 Ga0453683_0152923 3300044673 Bacteria 1458
481 Ga0451576_1477861 3300045051 Unclassified 706
482 Ga0451576_1833955 3300045051 Unclassified 626
483 Ga0495592_0786021 3300046454 Unclassified 566
484 Ga0495603_0555086 3300046455 Unclassified 658
485 Ga0495651_0841472 3300046462 Unclassified 564
486 Ga0495594_0301321 3300046499 Unclassified 913
487 Ga0495587_0396249 3300046536 Unclassified 767
488 Ga0495598_0026687 3300046537 Bacteria 1586
489 Ga0495645_0488976 3300046543 Unclassified 771
490 Ga0495633_0352240 3300046558 Unclassified 667
491 Ga0495656_0064205 3300046615 Bacteria 1612
492 Ga0495588_0466307 3300046674 Bacteria 662
493 Ga0495599_0312814 3300046678 Bacteria 946
494 Ga0495658_0718066 3300046683 Unclassified 640
495 Ga0495636_0500906 3300047318 Bacteria 587
496 Ga0495674_0222210 3300047319 Bacteria 1561
497 Ga0496104_0257541 3300048907 Bacteria 1658
498 Ga0496104_0472315 3300048907 Bacteria 1166
499 Ga0496109_0027094 3300048912 Bacteria 5115
500 Ga0496109_0174091 3300048912 Bacteria 2020
501 Ga0496110_1617677 3300048913 Bacteria 558
502 Ga0496113_0031209 3300048916 Bacteria 3865
503 Ga0496113_0258607 3300048916 Bacteria 1391
504 Ga0496114_0604608 3300048917 Bacteria 967
505 Ga0501296_025560 3300049519 Bacteria 774
506 Ga0501031_0950598 3300049568 Bacteria 550
507 Ga0501038_0231165 3300049574 Bacteria 1472
508 Ga0501039_1040471 3300049575 Bacteria 635
509 Ga0501041_0197209 3300049577 Bacteria 1262
510 Ga0501042_0701312 3300049578 Unclassified 736
511 Ga0501043_1309408 3300049579 Unclassified 505
512 Ga0501072_1342778 3300049588 Bacteria 554
513 Ga0501072_1343573 3300049588 Bacteria 553
514 Ga0501073_0434877 3300049589 Bacteria 907
515 Ga0501076_0515301 3300049592 Unclassified 986
516 Ga0501076_0524112 3300049592 Bacteria 977
517 Ga0501077_0378687 3300049593 Bacteria 904
518 Ga0501202_192227 3300049652 Unclassified 555
519 Ga0501207_010342 3300049654 Bacteria 1375
520 Ga0501216_132157 3300049660 Unclassified 580
521 Ga0501257_173845 3300049686 Unclassified 606
522 Ga0501081_0204551 3300049743 Bacteria 1433
523 nmdc:mga05p37_1154181_c1 3300050507 Bacteria 805
524 nmdc:mga05p37_122217_c1 3300050507 Bacteria 3198
525 nmdc:mga05p37_1281567_c1 3300050507 Bacteria 749
526 nmdc:mga05p37_2088889_c1 3300050507 Bacteria 531
527 nmdc:mga05p37_25392_c1 3300050507 Bacteria 7205
528 nmdc:mga05p37_284354_c1 3300050507 Bacteria 1971
529 nmdc:mga05p37_543844_c1 3300050507 Bacteria 1324
530 nmdc:mga05p37_588114_c1 3300050507 Bacteria 1259
531 nmdc:mga05p37_77896_c1 3300050507 Bacteria 4081
532 nmdc:mga09592_1071885_c1 3300050508 Unclassified 671
533 nmdc:mga09592_10726_c1 3300050508 Bacteria 7459
534 nmdc:mga09592_10824_c2 3300050508 Bacteria 3363
535 nmdc:mga09592_1276253_c1 3300050508 Bacteria 605
536 nmdc:mga09592_2708_c1 3300050508 Bacteria 14322
537 nmdc:mga09592_999746_c1 3300050508 Bacteria 699
538 nmdc:mga0qj67_10168_c1 3300050509 Bacteria 7025
539 nmdc:mga0qj67_136371_c1 3300050509 Bacteria 1989
540 nmdc:mga0qj67_154761_c1 3300050509 Bacteria 1860
541 nmdc:mga0qj67_272953_c1 3300050509 Bacteria 1371
542 nmdc:mga0qj67_37991_c2 3300050509 Bacteria 3390
543 nmdc:mga0qj67_409874_c1 3300050509 Unclassified 1093
544 nmdc:mga06r32_1357207_c1 3300050510 Bacteria 654
545 nmdc:mga06r32_75345_c1 3300050510 Bacteria 3274
546 nmdc:mga06r32_79871_c1 3300050510 Bacteria 3182
547 nmdc:mga08y16_10088_c1 3300050511 Bacteria 9916
548 nmdc:mga08y16_10550_c1 3300050511 Bacteria 9697
549 nmdc:mga08y16_140137_c1 3300050511 Bacteria 2514
550 nmdc:mga08y16_1558_c1 3300050511 Bacteria 23104
551 nmdc:mga08y16_158584_c1 3300050511 Bacteria 2351
552 nmdc:mga08y16_209402_c1 3300050511 Bacteria 2019
553 nmdc:mga08y16_256435_c1 3300050511 Bacteria 1806
554 nmdc:mga08y16_499408_c1 3300050511 Unclassified 1236
555 nmdc:mga08y16_86309_c1 3300050511 Bacteria 3271
556 nmdc:mga0n895_15386_c1 3300050512 Bacteria 6972
557 nmdc:mga0n895_32944_c1 3300050512 Bacteria 4976
558 nmdc:mga0n895_368861_c1 3300050512 Bacteria 1454
559 nmdc:mga0rr50_138461_c1 3300050513 Bacteria 1956
560 nmdc:mga0rr50_706693_c1 3300050513 Bacteria 860
561 nmdc:mga08x19_1079884_c1 3300050514 Unclassified 570
562 nmdc:mga0a205_118878_c1 3300050515 Bacteria 2541
563 nmdc:mga0a205_166964_c1 3300050515 Unclassified 2097
564 nmdc:mga0a205_404076_c1 3300050515 Bacteria 1230
565 nmdc:mga0a205_679082_c1 3300050515 Bacteria 880
566 Ga0501084_1865161 3300054114 Unclassified 502
567 Ga0530510_1053918 3300061734 Unclassified 623
568 Ga0207651_11882977
569 MBSR1b_contig_11812573
570 Ga0058860_12175475
571 Ga0065714_10292723
572 Ga0065704_10450404
573 Ga0065704_10658794
574 Ga0065712_10000157
575 Ga0065712_10099250
576 Ga0065712_10796277
577 Ga0065715_10449556
578 Ga0065707_10100639
579 Ga0065707_10118375
580 Ga0065707_10401373
581 Ga0070676_10002732
582 Ga0070690_100138128
583 Ga0070690_100178879
584 Ga0070690_100266220
585 Ga0070690_100321250
586 Ga0070690_100663726
587 Ga0070670_100095821
588 Ga0070670_100435054
589 Ga0070670_101739731
590 Ga0070677_10003227
591 Ga0070677_10049033
592 Ga0068869_100581096
593 Ga0068869_100822610
594 Ga0070666_10002058
595 Ga0070666_11110198
596 Ga0070666_11325561
597 Ga0070680_100215371
598 Ga0070680_100724390
599 Ga0070682_100347562
600 Ga0070682_100925485
601 Ga0068868_100420654
602 Ga0068868_101342716
603 Ga0070660_101541518
604 Ga0070689_100037709
605 Ga0070689_100098826
606 Ga0070689_100219776
607 Ga0070689_100421749
608 Ga0070691_10289425
609 Ga0070687_100010126
610 Ga0070687_100600785
611 Ga0070661_100018283
612 Ga0070661_100285848
613 Ga0070692_10046272
614 Ga0070692_11339184
615 Ga0070668_100077184
616 Ga0070668_100090405
617 Ga0070668_100338528
618 Ga0070669_100004330
619 Ga0070669_100317993
620 Ga0070669_100466161
621 Ga0070669_100714246
622 Ga0070669_101400909
623 Ga0070669_101886647
624 Ga0070675_100015380
625 Ga0070675_100020507
626 Ga0070675_100065654
627 Ga0070675_100069390
628 Ga0070675_100828104
629 Ga0070671_101243697
630 Ga0070674_100233167
631 Ga0070673_100017267
632 Ga0070673_100153102
633 Ga0070673_100721151
634 Ga0070673_100810870
635 Ga0070688_100062307
636 Ga0070688_100083133
637 Ga0070688_100118734
638 Ga0070688_100345739
639 Ga0070688_100786295
640 Ga0070659_100154135
641 Ga0070659_100945344
642 Ga0070667_100099133
643 Ga0070667_100634342
644 Ga0070701_10041587
645 Ga0070701_10316566
646 Ga0070711_100321012
647 Ga0070705_100549046
648 Ga0070705_100992109
649 Ga0070700_100043287
650 Ga0070700_100576587
651 Ga0070700_101146552
652 Ga0070694_100776216
653 Ga0070694_100941101
654 Ga0070694_100947348
655 Ga0070708_101925431
656 Ga0070663_100996421
657 Ga0070678_100061768
658 Ga0070678_100126106
659 Ga0070678_100608849
660 Ga0070678_101160205
661 Ga0070678_101275804
662 Ga0070678_102081309
663 Ga0070662_100015586
664 Ga0070662_100585745
665 Ga0070681_10047573
666 Ga0068867_100011383
667 Ga0068867_100312007
668 Ga0070685_10002152
669 Ga0070706_100071653
670 Ga0070707_100075015
671 Ga0070707_100350536
672 Ga0070698_100069962
673 Ga0070698_100992958
674 Ga0070699_100283005
675 Ga0070699_100760290
676 Ga0070679_100091085
677 Ga0070684_100403721
678 Ga0070697_100173734
679 Ga0070672_100048249
680 Ga0070672_100090003
681 Ga0070672_100409230
682 Ga0070672_101243029
683 Ga0070672_101322209
684 Ga0070672_101363096
685 Ga0070686_100030006
686 Ga0070686_100332548
687 Ga0070686_100411412
688 Ga0070686_100541762
689 Ga0070686_101206284
690 Ga0070695_100321726
691 Ga0070696_100223184
692 Ga0070693_100740435
693 Ga0070665_100083489
694 Ga0070665_100491356
695 Ga0070665_100610085
696 Ga0070704_100063426
697 Ga0070704_100114053
698 Ga0070704_100215805
699 Ga0070704_100296862
700 Ga0070704_100902106
701 Ga0070704_101826326
702 Ga0070664_100006238
703 Ga0070664_100059268
704 Ga0070664_100106703
705 Ga0070664_100943615
706 Ga0068857_100215386
707 Ga0068857_100671882
708 Ga0068854_100882347
709 Ga0070702_100774808
710 Ga0070702_100939524
711 Ga0070702_101649028
712 Ga0068852_100050124
713 Ga0068859_100048797
714 Ga0068859_100188780
715 Ga0068859_100243264
716 Ga0068859_100274759
717 Ga0068859_100787437
718 Ga0068859_101175476
719 Ga0068859_101444286
720 Ga0068859_102013246
721 Ga0068864_100111047
722 Ga0068864_100261602
723 Ga0068864_100310920
724 Ga0068864_100603003
725 Ga0068864_101133557
726 Ga0068861_100003257
727 Ga0068861_100294418
728 Ga0068861_100411480
729 Ga0068861_101027323
730 Ga0068870_10000409
731 Ga0068870_10135116
732 Ga0068870_10621507
733 Ga0068863_100042106
734 Ga0068863_100609731
735 Ga0068858_100210597
736 Ga0068860_100054699
737 Ga0068860_100257794
738 Ga0068860_100550420
739 Ga0068860_101588018
740 Ga0068862_100006569
741 Ga0068862_100037927
742 Ga0068862_100291411
743 Ga0068862_100909470
744 Ga0068862_101598092
745 Ga0068862_102071741
746 Ga0075432_10115023
747 Ga0097621_100502328
748 Ga0097621_101688942
749 Ga0068871_100100507
750 Ga0068871_100401166
751 Ga0068871_100848087
752 Ga0075428_100001700
753 Ga0075428_100002416
754 Ga0075428_100005624
755 Ga0075428_100024130
756 Ga0075428_100044304
757 Ga0075428_100543122
758 Ga0075428_100544505
759 Ga0075428_100607190
760 Ga0075428_102200606
761 Ga0075430_100006849
762 Ga0075430_100021061
763 Ga0075430_100087556
764 Ga0075430_100300438
765 Ga0075430_100506955
766 Ga0075430_100698472
767 Ga0075431_100090492
768 Ga0075431_100126365
769 Ga0075431_100218140
770 Ga0075431_100845498
771 Ga0075433_10060674
772 Ga0075433_10061911
773 Ga0075433_10232638
774 Ga0075433_10432161
775 Ga0075433_10434379
776 Ga0075434_100062600
777 Ga0075434_100085172
778 Ga0075434_101373994
779 Ga0075429_100001299
780 Ga0075429_100021693
781 Ga0075429_100022229
782 Ga0075429_100057628
783 Ga0075429_100220346
784 Ga0075429_100481740
785 Ga0075429_101259609
786 Ga0068865_100335187
787 Ga0068865_101627352
788 Ga0097620_100048797
789 Ga0097620_100188781
790 Ga0097620_100243271
791 Ga0097620_100274767
792 Ga0097620_100787229
793 Ga0097620_101175609
794 Ga0097620_101443996
795 Ga0097620_102013397
796 Ga0075435_100024200
797 Ga0075435_101357130
798 Ga0075435_101746759
799 Ga0105240_10015432
800 Ga0111539_10001176
801 Ga0111539_10007015
802 Ga0111539_10011819
803 Ga0111539_10014042
804 Ga0111539_10085748
805 Ga0111539_10330824
806 Ga0111539_10588410
807 Ga0111539_10742466
808 Ga0111539_12448957
809 Ga0105245_10430399
810 Ga0105245_11409355
811 Ga0105247_10551484
812 Ga0114129_10025293
813 Ga0114129_10108629
814 Ga0114129_10253277
815 Ga0114129_10446193
816 Ga0114129_10456680
817 Ga0114129_10555270
818 Ga0114129_10579030
819 Ga0114129_12620998
820 Ga0105243_11762624
821 Ga0105242_10556744
822 Ga0105242_12241914
823 Ga0105248_10027232
824 Ga0105248_10630074
825 Ga0105248_10974505
826 Ga0105248_11032901
827 Ga0105249_10005440
828 Ga0105249_10940168
829 Ga0105249_12263548
830 Ga0105249_12362118
831 Ga0099796_10241392
832 Ga0105246_10041172
833 Ga0105246_10995656
834 Ga0157321_1015243
835 Ga0157314_1009787
836 Ga0157371_10417344
837 Ga0157371_11190791
838 Ga0157374_10362810
839 Ga0163162_10264816
840 Ga0163162_11219367
841 Ga0163162_11488664
842 Ga0157372_10428061
843 Ga0157372_12128408
844 Ga0157375_10017399
845 Ga0157375_10363735
846 Ga0157375_10771455
847 Ga0157375_11218114
848 Ga0157375_12298425
849 Ga0163163_13068646
850 Ga0157380_10094819
851 Ga0157380_10195247
852 Ga0157380_10199689
853 Ga0157380_10204076
854 Ga0157377_10001579
855 Ga0157377_10012641
856 Ga0157377_10420179
857 Ga0157377_10606549
858 Ga0157379_10018661
859 Ga0157376_10354060
860 Ga0157376_10376103
861 Ga0157376_11475922
862 Ga0163161_10018958
863 Ga0207673_1039471
864 Ga0207697_10000483
865 Ga0207697_10488256
866 Ga0207682_10005531
867 Ga0207682_10150156
868 Ga0207688_10002562
869 Ga0207688_10479087
870 Ga0207680_10062643
871 Ga0207645_10003430
872 Ga0207643_10002454
873 Ga0207643_10428439
874 Ga0207684_10074921
875 Ga0207684_10308322
876 Ga0207663_11117817
877 Ga0207660_10656011
878 Ga0207662_10010573
879 Ga0207662_10078343
880 Ga0207657_10306820
881 Ga0207657_10988618
882 Ga0207649_10019427
883 Ga0207649_10219423
884 Ga0207652_10104459
885 Ga0207646_10047830
886 Ga0207646_10543525
887 Ga0207681_10011928
888 Ga0207681_10161591
889 Ga0207681_10344577
890 Ga0207681_10438607
891 Ga0207681_10669713
892 Ga0207681_11602501
893 Ga0207681_11671005
894 Ga0207650_10071762
895 Ga0207650_10411594
896 Ga0207650_11085101
897 Ga0207659_10009325
898 Ga0207659_10011060
899 Ga0207659_10065358
900 Ga0207659_10147021
901 Ga0207687_11669833
902 Ga0207644_11827978
903 Ga0207690_10058404
904 Ga0207706_10018937
905 Ga0207706_10127436
906 Ga0207706_10624306
907 Ga0207670_10210737
908 Ga0207670_11072962
909 Ga0207669_10026677
910 Ga0207669_10859175
911 Ga0207669_11585612
912 Ga0207704_10519042
913 Ga0207704_10859357
914 Ga0207704_11257604
915 Ga0207704_11906644
916 Ga0207691_10003015
917 Ga0207691_10033543
918 Ga0207691_10036150
919 Ga0207691_10745213
920 Ga0207691_11632382
921 Ga0207711_10088205
922 Ga0207711_10621459
923 Ga0207689_10005330
924 Ga0207689_10146139
925 Ga0207651_10043416
926 Ga0207651_10585964
927 Ga0207712_10169778
928 Ga0207712_10590385
929 Ga0207712_11625460
930 Ga0207668_10066538
931 Ga0207658_10315696
932 Ga0207677_10243954
933 Ga0207677_11100082
934 Ga0207703_10256353
935 Ga0207678_10332542
936 Ga0207678_11585048
937 Ga0207708_10318851
938 Ga0207708_10320950
939 Ga0207708_10789170
940 Ga0207702_11969302
941 Ga0207641_10028662
942 Ga0207641_10128653
943 Ga0207648_10008442
944 Ga0207648_10172182
945 Ga0207648_10260051
946 Ga0207648_10360139
947 Ga0207676_10092442
948 Ga0207676_10281520
949 Ga0207676_10299317
950 Ga0207676_10596798
951 Ga0207676_11092619
952 Ga0207676_11238122
953 Ga0207674_10068664
954 Ga0207675_100001490
955 Ga0207675_100119983
956 Ga0207675_100574183
957 Ga0207675_100676349
958 Ga0207675_101388030
959 Ga0207683_10005514
960 Ga0207683_10380646
961 Ga0207683_10643931
962 Ga0207683_11319020
963 Ga0207698_10480637
964 Ga0207698_12050030
965 Ga0209973_1035219
966 Ga0209995_1033233
967 Ga0209970_1094118
968 Ga0209966_1051884
969 Ga0209998_10207626
970 Ga0209974_10419149
971 Ga0207428_10000236
972 Ga0207428_10018461
973 Ga0207428_10039349
974 Ga0207428_10071417
975 Ga0207428_10199899
976 Ga0207428_10427500
977 Ga0207428_10830411
978 Ga0268266_10206222
979 Ga0268265_10062056
980 Ga0268265_10569019
981 Ga0268265_11015422
982 Ga0268265_11041903
983 Ga0268265_11101254
984 Ga0268265_11937260
985 Ga0268265_12690850
986 Ga0268264_10051047
987 Ga0268264_10203658
988 Ga0268264_11969699
989 Ga0316182_1112002
990 Ga0307408_100050590
991 Ga0307408_101156895
992 Ga0307408_101629401
993 Ga0307405_10089035
994 Ga0307413_10245672
995 Ga0307413_10686555
996 Ga0307413_10874059
997 Ga0307410_10001474
998 Ga0307410_10042158
999 Ga0307406_10014930
1000 Ga0307406_10411474
1001 Ga0307406_11866609
1002 Ga0307407_10003122
1003 Ga0307407_10364498
1004 Ga0307412_10026807
1005 Ga0307412_10043594
1006 Ga0307412_10406306
1007 Ga0307409_100138426
1008 Ga0307409_100514974
1009 Ga0307409_100572616
1010 Ga0307409_101169846
1011 Ga0307416_100012197
1012 Ga0307416_100050094
1013 Ga0307416_100053309
1014 Ga0307416_100806477
1015 Ga0307416_101219836
1016 Ga0307416_101366798
1017 Ga0307416_102579622
1018 Ga0307411_10004021
1019 Ga0307411_10756651
1020 Ga0307415_100031497
1021 Ga0307415_100082865
1022 Ga0307415_100887134
1023 Ga0373950_0052900
1024 Ga0373938_0247345
1025 Ga0373940_0025660
1026 Ga0373932_0026007
1027 Ga0373962_0174023
1028 Ga0373931_0573605
1029 Ga0373933_0340623
1030 Ga0395901_1213230
1031 Ga0439453_0077842
1032 Ga0439443_018376
1033 Ga0450920_039213
1034 Ga0450923_100863
1035 Ga0450890_033880
1036 Ga0439446_0320156
1037 Ga0450908_018712
1038 Ga0450908_030068
1039 Ga0439435_0107464
1040 Ga0439435_0185199
1041 Ga0439444_0071978
1042 Ga0439459_0012378
1043 Ga0439464_0130179
1044 Ga0439460_0286741
1045 Ga0439460_0318293
1046 Ga0439440_0044918
1047 Ga0453683_0152923
1048 Ga0451576_1477861
1049 Ga0451576_1833955
1050 Ga0495592_0786021
1051 Ga0495603_0555086
1052 Ga0495651_0841472
1053 Ga0495594_0301321
1054 Ga0495587_0396249
1055 Ga0495598_0026687
1056 Ga0495645_0488976
1057 Ga0495633_0352240
1058 Ga0495656_0064205
1059 Ga0495588_0466307
1060 Ga0495599_0312814
1061 Ga0495658_0718066
1062 Ga0495636_0500906
1063 Ga0495674_0222210
1064 Ga0496104_0257541
1065 Ga0496104_0472315
1066 Ga0496109_0027094
1067 Ga0496109_0174091
1068 Ga0496110_1617677
1069 Ga0496113_0031209
1070 Ga0496113_0258607
1071 Ga0496114_0604608
1072 Ga0501296_025560
1073 Ga0501031_0950598
1074 Ga0501038_0231165
1075 Ga0501039_1040471
1076 Ga0501041_0197209
1077 Ga0501042_0701312
1078 Ga0501043_1309408
1079 Ga0501072_1342778
1080 Ga0501072_1343573
1081 Ga0501073_0434877
1082 Ga0501076_0515301
1083 Ga0501076_0524112
1084 Ga0501077_0378687
1085 Ga0501202_192227
1086 Ga0501207_010342
1087 Ga0501216_132157
1088 Ga0501257_173845
1089 Ga0501081_0204551
1090 nmdc:mga05p37_1154181_c1
1091 nmdc:mga05p37_122217_c1
1092 nmdc:mga05p37_1281567_c1
1093 nmdc:mga05p37_2088889_c1
1094 nmdc:mga05p37_25392_c1
1095 nmdc:mga05p37_284354_c1
1096 nmdc:mga05p37_543844_c1
1097 nmdc:mga05p37_588114_c1
1098 nmdc:mga05p37_77896_c1
1099 nmdc:mga09592_1071885_c1
1100 nmdc:mga09592_10726_c1
1101 nmdc:mga09592_10824_c2
1102 nmdc:mga09592_1276253_c1
1103 nmdc:mga09592_2708_c1
1104 nmdc:mga09592_999746_c1
1105 nmdc:mga0qj67_10168_c1
1106 nmdc:mga0qj67_136371_c1
1107 nmdc:mga0qj67_154761_c1
1108 nmdc:mga0qj67_272953_c1
1109 nmdc:mga0qj67_37991_c2
1110 nmdc:mga0qj67_409874_c1
1111 nmdc:mga06r32_1357207_c1
1112 nmdc:mga06r32_75345_c1
1113 nmdc:mga06r32_79871_c1
1114 nmdc:mga08y16_10088_c1
1115 nmdc:mga08y16_10550_c1
1116 nmdc:mga08y16_140137_c1
1117 nmdc:mga08y16_1558_c1
1118 nmdc:mga08y16_158584_c1
1119 nmdc:mga08y16_209402_c1
1120 nmdc:mga08y16_256435_c1
1121 nmdc:mga08y16_499408_c1
1122 nmdc:mga08y16_86309_c1
1123 nmdc:mga0n895_15386_c1
1124 nmdc:mga0n895_32944_c1
1125 nmdc:mga0n895_368861_c1
1126 nmdc:mga0rr50_138461_c1
1127 nmdc:mga0rr50_706693_c1
1128 nmdc:mga08x19_1079884_c1
1129 nmdc:mga0a205_118878_c1
1130 nmdc:mga0a205_166964_c1
1131 nmdc:mga0a205_404076_c1
1132 nmdc:mga0a205_679082_c1
1133 Ga0501084_1865161
1134 Ga0530510_1053918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01649

Ribosomal_S20p

Ribosomal protein S20

17

88

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4k51-assembly2.cif.gz_B crystal structure of the pci domain of eif3a 0.9868 29 61
4u1c-assembly1.cif.gz_A crystal structure of the eif3a/eif3c pci-domain heterodimer 0.9804 20 60
7dgq-assembly1.cif.gz_A9 activity optimized supercomplex state1 0.9258 24 64
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.9258 24 64
5luf-assembly1.cif.gz_z cryo-em of bovine respirasome 0.9258 24 64
ID Description Score Start End Superfamily
4k51B00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.9868 29 61 1.25.40.860
4u1cA01 Few Secondary Structures;Irregular;DNA Excision Repair, Uvrb; Chain A;UVR domain 0.9804 20 60 4.10.860.10
af_A4I5D2_109_274_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9709 14 61 1.25.10.10
af_K7LI90_496_807_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9653 23 60 1.20.120.670
af_Q54DW5_515_797_1.20.120.670 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);N-acetyl-b-d-glucoasminidase 0.9627 25 62 1.20.120.670
ID Description Score Start End GO Terms
AF-A0A645BS02-F1-model_v4 30S ribosomal protein S20 0.978 21 89 GO:0003735
GO:0005829
GO:0006412
GO:0015935
GO:0070181
AF-X0VFS6-F1-model_v4 30S ribosomal protein S20 0.9779 17 88 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-H5SRE3-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.9778 21 86 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-A0A0C1H3Z2-F1-model_v4 Small ribosomal subunit protein bS20 (30S ribosomal protein S20) 0.974 25 87 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904
AF-X0SC26-F1-model_v4 30S ribosomal protein S20 0.9702 20 87 GO:0003735
GO:0005840
GO:0006412
GO:0019843
GO:1990904

Map