F464498

General Info

Members Datasets Scaffolds Average Seq Length
567 296 1134 74

Family's Representative Sequence

Representative Sequence 3300006051|Ga0075364_10015848|Ga0075364_100158486
Length 86
Sequence MMTNDDLALPALPAPVGAGVFNVYTGAEMGAAAGTVIPTAAQLGLEPPRFCAECGRRMIVQVRPTGWWAKCSRHGQVDSTDLDTQR

Samples

Sample ID Description Type Environment
1 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
9 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
10 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
11 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
22 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
52 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
53 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
76 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
79 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
106 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
107 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
172 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
176 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
177 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
178 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
179 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
180 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
181 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
182 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
183 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
184 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
188 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
191 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
194 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
195 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
196 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
197 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
198 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
199 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
200 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
201 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
202 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
203 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
204 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
205 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
206 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
207 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
208 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
209 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
210 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
211 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
212 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
213 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
214 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
217 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
218 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
219 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
220 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
221 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
222 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
223 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
224 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
240 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
241 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
242 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
243 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
244 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
245 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
248 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
252 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
253 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
254 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
258 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
259 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
260 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
261 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
262 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
263 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
267 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
268 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
272 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
273 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
274 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
275 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
276 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
277 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
278 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
279 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
280 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
281 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
282 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
283 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
284 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
285 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
286 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
287 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
288 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
289 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
290 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
291 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
292 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
293 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
294 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
295 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
296 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.24
Metatranscriptomes 0
Isolates 1.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.17
Nodule 0
Rhizoplane 8.11
Rhizosphere 78.48
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075364_10015848 3300006051 Bacteria 4678
2 JGI24739J22299_10149906 3300001989 Bacteria 690
3 JGI24743J22301_10013785 3300001991 Bacteria 1484
4 JGI24743J22301_10026481 3300001991 Bacteria 1129
5 JGI24750J21931_1064298 3300002070 Bacteria 591
6 JGI24745J21846_1005539 3300002073 Bacteria 1380
7 JGI24745J21846_1023849 3300002073 Bacteria 725
8 JGI24748J21848_1003107 3300002074 Bacteria 1894
9 JGI24738J21930_10031244 3300002075 Bacteria 1086
10 JGI24749J21850_1036210 3300002076 Bacteria 716
11 JGI24744J21845_10000326 3300002077 Bacteria 7991
12 JGI24744J21845_10007820 3300002077 Bacteria 2208
13 JGI24034J26672_10002872 3300002239 Bacteria 2381
14 JGI24034J26672_10065718 3300002239 Bacteria 643
15 JGI24034J26672_10109193 3300002239 Bacteria 527
16 JGI24742J22300_10034482 3300002244 Bacteria 891
17 JGI24742J22300_10035213 3300002244 Bacteria 883
18 Ga0070676_10005389 3300005328 Bacteria 6815
19 Ga0070690_100093070 3300005330 Bacteria 1988
20 Ga0070677_10277549 3300005333 Bacteria 843
21 Ga0068869_100022937 3300005334 Bacteria 4305
22 Ga0068869_100304569 3300005334 Bacteria 1288
23 Ga0068869_101962096 3300005334 Bacteria 525
24 Ga0070666_10070086 3300005335 Bacteria 2385
25 Ga0070666_10571337 3300005335 Bacteria 824
26 Ga0070680_100346574 3300005336 Bacteria 1263
27 Ga0070682_100073685 3300005337 Bacteria 2191
28 Ga0070682_100908613 3300005337 Bacteria 724
29 Ga0068868_100005485 3300005338 Bacteria 8923
30 Ga0070660_100340161 3300005339 Bacteria 1235
31 Ga0070660_100440923 3300005339 Bacteria 1080
32 Ga0070660_100487332 3300005339 Bacteria 1025
33 Ga0070689_100093245 3300005340 Bacteria 2376
34 Ga0070689_102154154 3300005340 Bacteria 511
35 Ga0070691_10001448 3300005341 Bacteria 10161
36 Ga0070691_10036792 3300005341 Bacteria 2308
37 Ga0070661_101358241 3300005344 Bacteria 597
38 Ga0070692_10203194 3300005345 Bacteria 1162
39 Ga0070668_100000568 3300005347 Bacteria 24706
40 Ga0070668_100158634 3300005347 Bacteria 1834
41 Ga0070668_100964326 3300005347 Bacteria 765
42 Ga0070668_101999122 3300005347 Bacteria 535
43 Ga0070668_102214655 3300005347 Bacteria 508
44 Ga0070669_100009018 3300005353 Bacteria 7114
45 Ga0070671_100447989 3300005355 Bacteria 1107
46 Ga0070674_100208716 3300005356 Bacteria 1512
47 Ga0070674_100228360 3300005356 Bacteria 1451
48 Ga0070673_100136666 3300005364 Bacteria 2064
49 Ga0070688_100015882 3300005365 Bacteria 4293
50 Ga0070688_101481042 3300005365 Bacteria 552
51 Ga0070659_100099965 3300005366 Bacteria 2334
52 Ga0070659_100509377 3300005366 Bacteria 1026
53 Ga0070667_100018217 3300005367 Bacteria 5822
54 Ga0070667_100066477 3300005367 Bacteria 3063
55 Ga0070667_100218834 3300005367 Bacteria 1695
56 Ga0070709_11009046 3300005434 Bacteria 662
57 Ga0070714_100043677 3300005435 Bacteria 3792
58 Ga0070714_100234486 3300005435 Bacteria 1692
59 Ga0070714_100399721 3300005435 Bacteria 1298
60 Ga0070714_100582117 3300005435 Bacteria 1074
61 Ga0070714_101695198 3300005435 Bacteria 617
62 Ga0070713_100114593 3300005436 Bacteria 2355
63 Ga0070713_100691974 3300005436 Bacteria 973
64 Ga0070710_10000932 3300005437 Bacteria 13915
65 Ga0070710_10034170 3300005437 Bacteria 2765
66 Ga0070710_10073090 3300005437 Bacteria 1982
67 Ga0070701_10003743 3300005438 Bacteria 6073
68 Ga0070711_100001643 3300005439 Bacteria 12357
69 Ga0070711_100876414 3300005439 Bacteria 765
70 Ga0070705_100073895 3300005440 Bacteria 2070
71 Ga0070705_101444344 3300005440 Bacteria 574
72 Ga0070700_100002582 3300005441 Bacteria 9259
73 Ga0070700_100736146 3300005441 Bacteria 788
74 Ga0070694_100583328 3300005444 Bacteria 899
75 Ga0070663_100094540 3300005455 Bacteria 2220
76 Ga0070663_100383312 3300005455 Bacteria 1145
77 Ga0070678_100070238 3300005456 Bacteria 2617
78 Ga0070678_100103789 3300005456 Bacteria 2209
79 Ga0070678_100255189 3300005456 Bacteria 1472
80 Ga0070678_100378025 3300005456 Bacteria 1225
81 Ga0070662_100539258 3300005457 Bacteria 977
82 Ga0070662_101321408 3300005457 Bacteria 621
83 Ga0068867_100010113 3300005459 Bacteria 6649
84 Ga0068867_101379143 3300005459 Bacteria 653
85 Ga0070685_10218105 3300005466 Bacteria 1248
86 Ga0070697_100167052 3300005536 Bacteria 1861
87 Ga0068853_100010926 3300005539 Bacteria 7359
88 Ga0068853_100360912 3300005539 Bacteria 1353
89 Ga0070672_101695381 3300005543 Bacteria 568
90 Ga0070686_100271670 3300005544 Bacteria 1247
91 Ga0070695_100027005 3300005545 Bacteria 3554
92 Ga0070695_100116189 3300005545 Bacteria 1824
93 Ga0070696_100017971 3300005546 Bacteria 4776
94 Ga0070693_100012592 3300005547 Bacteria 4283
95 Ga0070693_101085200 3300005547 Bacteria 610
96 Ga0070665_100027133 3300005548 Bacteria 5768
97 Ga0070665_100034595 3300005548 Bacteria 5081
98 Ga0070665_102091460 3300005548 Bacteria 571
99 Ga0070704_100012664 3300005549 Bacteria 5218
100 Ga0070704_100368931 3300005549 Bacteria 1216
101 Ga0068855_100039696 3300005563 Bacteria 5588
102 Ga0068855_101779329 3300005563 Bacteria 626
103 Ga0068854_100000704 3300005578 Bacteria 19787
104 Ga0068854_100602011 3300005578 Bacteria 938
105 Ga0068854_101396440 3300005578 Bacteria 633
106 Ga0068856_100269132 3300005614 Bacteria 1720
107 Ga0068856_101855566 3300005614 Bacteria 614
108 Ga0070702_100027914 3300005615 Bacteria 3051
109 Ga0070702_100091423 3300005615 Bacteria 1846
110 Ga0070702_100421505 3300005615 Bacteria 961
111 Ga0070702_101773115 3300005615 Bacteria 515
112 Ga0068852_100080920 3300005616 Bacteria 2882
113 Ga0068852_100094052 3300005616 Bacteria 2688
114 Ga0068859_100005722 3300005617 Bacteria 12646
115 Ga0068859_100198524 3300005617 Bacteria 2090
116 Ga0068859_102217843 3300005617 Bacteria 606
117 Ga0068864_101001874 3300005618 Bacteria 829
118 Ga0068866_10001957 3300005718 Bacteria 8588
119 Ga0068866_10132306 3300005718 Bacteria 1420
120 Ga0068861_100000622 3300005719 Bacteria 20950
121 Ga0068861_100118366 3300005719 Bacteria 2133
122 Ga0068851_10102500 3300005834 Bacteria 1520
123 Ga0068858_100102636 3300005842 Bacteria 2668
124 Ga0068858_100535183 3300005842 Bacteria 1134
125 Ga0068858_100902568 3300005842 Bacteria 864
126 Ga0068860_100013606 3300005843 Bacteria 7976
127 Ga0068860_100344139 3300005843 Bacteria 1466
128 Ga0068860_100417454 3300005843 Bacteria 1329
129 Ga0068860_102788905 3300005843 Bacteria 507
130 Ga0068862_100030020 3300005844 Bacteria 4580
131 Ga0070717_11821895 3300006028 Bacteria 550
132 Ga0075365_10011492 3300006038 Bacteria 5209
133 Ga0075365_10114963 3300006038 Bacteria 1852
134 Ga0075365_10560495 3300006038 Bacteria 808
135 Ga0075365_10673062 3300006038 Bacteria 731
136 Ga0075363_100094957 3300006048 Bacteria 1644
137 Ga0075363_100165959 3300006048 Bacteria 1252
138 Ga0075363_100296835 3300006048 Bacteria 937
139 Ga0075364_10049989 3300006051 Bacteria 2728
140 Ga0075364_10213810 3300006051 Bacteria 1308
141 Ga0075364_10288613 3300006051 Bacteria 1116
142 Ga0075364_10655135 3300006051 Bacteria 717
143 Ga0070715_10066647 3300006163 Bacteria 1597
144 Ga0070716_100008355 3300006173 Bacteria 5135
145 Ga0070716_100352951 3300006173 Bacteria 1042
146 Ga0070716_100543756 3300006173 Bacteria 865
147 Ga0070716_100686072 3300006173 Bacteria 781
148 Ga0070712_100017986 3300006175 Bacteria 4583
149 Ga0070712_100098504 3300006175 Bacteria 2156
150 Ga0075362_10007434 3300006177 Bacteria 4150
151 Ga0075369_10058053 3300006186 Bacteria 1685
152 Ga0075369_10064045 3300006186 Bacteria 1609
153 Ga0075369_10570179 3300006186 Bacteria 541
154 Ga0097621_100896590 3300006237 Bacteria 826
155 Ga0075370_10045795 3300006353 Bacteria 2474
156 Ga0068871_100276916 3300006358 Bacteria 1467
157 Ga0068865_100004019 3300006881 Bacteria 8836
158 Ga0068865_100035559 3300006881 Bacteria 3351
159 Ga0097620_100005722 3300006931 Bacteria 12646
160 Ga0097620_100198530 3300006931 Bacteria 2090
161 Ga0097620_102217525 3300006931 Bacteria 606
162 Ga0105250_10139696 3300009092 Bacteria 1003
163 Ga0105240_10104635 3300009093 Bacteria 3437
164 Ga0105240_11005306 3300009093 Bacteria 892
165 Ga0111539_12317784 3300009094 Bacteria 623
166 Ga0105245_10007406 3300009098 Bacteria 9613
167 Ga0105245_10187766 3300009098 Bacteria 1978
168 Ga0105245_10942767 3300009098 Bacteria 906
169 Ga0105247_10003220 3300009101 Bacteria 10742
170 Ga0105247_10164368 3300009101 Bacteria 1472
171 Ga0105247_10940859 3300009101 Bacteria 670
172 Ga0105243_10007329 3300009148 Bacteria 8481
173 Ga0105243_10082248 3300009148 Bacteria 2631
174 Ga0105243_11495025 3300009148 Bacteria 699
175 Ga0105243_12843284 3300009148 Bacteria 525
176 Ga0105241_10025326 3300009174 Bacteria 4409
177 Ga0105241_10755396 3300009174 Bacteria 892
178 Ga0105242_10001104 3300009176 Bacteria 21251
179 Ga0105242_12618241 3300009176 Bacteria 553
180 Ga0105248_10010806 3300009177 Bacteria 10081
181 Ga0105237_10030464 3300009545 Bacteria 5480
182 Ga0105237_11395220 3300009545 Bacteria 707
183 Ga0105237_12568820 3300009545 Bacteria 520
184 Ga0105238_10210781 3300009551 Bacteria 1919
185 Ga0105249_10000571 3300009553 Bacteria 33782
186 Ga0105249_10032430 3300009553 Bacteria 4726
187 Ga0105239_10394117 3300010375 Bacteria 1566
188 Ga0105239_10873966 3300010375 Bacteria 1031
189 Ga0105246_10023371 3300011119 Bacteria 3999
190 Ga0105246_11304378 3300011119 Bacteria 673
191 Ga0157373_11292926 3300013100 Bacteria 552
192 Ga0157371_10455848 3300013102 Bacteria 941
193 Ga0157369_10122651 3300013105 Bacteria 2756
194 Ga0157369_10336002 3300013105 Bacteria 1569
195 Ga0157369_11006439 3300013105 Bacteria 853
196 Ga0157378_10043733 3300013297 Bacteria 3977
197 Ga0157378_10232121 3300013297 Bacteria 1759
198 Ga0163162_10137615 3300013306 Bacteria 2554
199 Ga0163162_12682781 3300013306 Bacteria 573
200 Ga0157372_11368680 3300013307 Bacteria 816
201 Ga0157375_10042543 3300013308 Bacteria 4397
202 Ga0157375_10899181 3300013308 Bacteria 1029
203 Ga0157375_12752539 3300013308 Bacteria 588
204 Ga0163163_10465955 3300014325 Bacteria 1324
205 Ga0163163_10777345 3300014325 Bacteria 1021
206 Ga0163163_11198006 3300014325 Bacteria 822
207 Ga0157380_10000597 3300014326 Bacteria 22234
208 Ga0182008_10514743 3300014497 Bacteria 660
209 Ga0157377_10047699 3300014745 Bacteria 2400
210 Ga0157377_10266754 3300014745 Bacteria 1116
211 Ga0157379_10018092 3300014968 Bacteria 6210
212 Ga0157379_10252695 3300014968 Bacteria 1601
213 Ga0157379_10556392 3300014968 Bacteria 1068
214 Ga0157376_10907174 3300014969 Bacteria 899
215 Ga0163161_10006021 3300017792 Bacteria 8404
216 Ga0163161_10578724 3300017792 Bacteria 923
217 Ga0209051_1096263 3300025303 Bacteria 808
218 Ga0207697_10390295 3300025315 Bacteria 618
219 Ga0207656_10154169 3300025321 Bacteria 1090
220 Ga0207653_10033595 3300025885 Bacteria 1664
221 Ga0207692_10007629 3300025898 Bacteria 4439
222 Ga0207692_10066799 3300025898 Bacteria 1881
223 Ga0207692_10189941 3300025898 Bacteria 1202
224 Ga0207642_10000205 3300025899 Bacteria 17391
225 Ga0207710_10004260 3300025900 Bacteria 6263
226 Ga0207710_10107289 3300025900 Bacteria 1323
227 Ga0207710_10333284 3300025900 Bacteria 771
228 Ga0207688_10003825 3300025901 Bacteria 8212
229 Ga0207688_10004459 3300025901 Bacteria 7623
230 Ga0207680_10241784 3300025903 Bacteria 1244
231 Ga0207647_10013855 3300025904 Bacteria 5583
232 Ga0207647_10032885 3300025904 Bacteria 3327
233 Ga0207647_10236297 3300025904 Bacteria 1050
234 Ga0207685_10045627 3300025905 Bacteria 1663
235 Ga0207699_10079667 3300025906 Bacteria 2027
236 Ga0207645_10023364 3300025907 Bacteria 4019
237 Ga0207645_10075446 3300025907 Bacteria 2158
238 Ga0207643_10979186 3300025908 Bacteria 547
239 Ga0207654_10016336 3300025911 Bacteria 3864
240 Ga0207654_10938003 3300025911 Bacteria 628
241 Ga0207695_11494871 3300025913 Bacteria 556
242 Ga0207671_10063989 3300025914 Bacteria 2734
243 Ga0207693_10000705 3300025915 Bacteria 30041
244 Ga0207693_10014488 3300025915 Bacteria 6337
245 Ga0207663_10012077 3300025916 Bacteria 4657
246 Ga0207663_10036477 3300025916 Bacteria 2958
247 Ga0207663_10223299 3300025916 Bacteria 1372
248 Ga0207660_10212161 3300025917 Bacteria 1517
249 Ga0207662_10042550 3300025918 Bacteria 2678
250 Ga0207657_10264694 3300025919 Bacteria 1368
251 Ga0207681_10019220 3300025923 Bacteria 4315
252 Ga0207694_10407905 3300025924 Bacteria 1130
253 Ga0207694_10752049 3300025924 Bacteria 823
254 Ga0207659_10645944 3300025926 Bacteria 904
255 Ga0207659_11221445 3300025926 Bacteria 646
256 Ga0207687_10002750 3300025927 Bacteria 11926
257 Ga0207687_10245396 3300025927 Bacteria 1421
258 Ga0207700_10761709 3300025928 Bacteria 865
259 Ga0207664_10116929 3300025929 Bacteria 2225
260 Ga0207664_10881835 3300025929 Bacteria 804
261 Ga0207664_11108804 3300025929 Bacteria 707
262 Ga0207644_10484073 3300025931 Bacteria 1019
263 Ga0207690_10157873 3300025932 Bacteria 1688
264 Ga0207706_10122796 3300025933 Bacteria 2284
265 Ga0207706_10142306 3300025933 Bacteria 2110
266 Ga0207686_10040315 3300025934 Bacteria 2838
267 Ga0207686_11613863 3300025934 Bacteria 536
268 Ga0207709_10008492 3300025935 Bacteria 5681
269 Ga0207709_10383785 3300025935 Bacteria 1070
270 Ga0207670_11524807 3300025936 Bacteria 568
271 Ga0207669_10000318 3300025937 Bacteria 22011
272 Ga0207669_10013923 3300025937 Bacteria 4015
273 Ga0207669_10596041 3300025937 Bacteria 897
274 Ga0207704_10001564 3300025938 Bacteria 10254
275 Ga0207665_10136793 3300025939 Bacteria 1744
276 Ga0207665_10501737 3300025939 Bacteria 937
277 Ga0207691_10497271 3300025940 Bacteria 1036
278 Ga0207711_10072577 3300025941 Bacteria 2990
279 Ga0207711_10336827 3300025941 Bacteria 1396
280 Ga0207711_10556838 3300025941 Bacteria 1069
281 Ga0207689_10008722 3300025942 Bacteria 8823
282 Ga0207689_10052197 3300025942 Bacteria 3370
283 Ga0207679_12120200 3300025945 Bacteria 511
284 Ga0207667_10084343 3300025949 Bacteria 3289
285 Ga0207651_10192997 3300025960 Bacteria 1626
286 Ga0207712_10097042 3300025961 Bacteria 2183
287 Ga0207712_10147110 3300025961 Bacteria 1815
288 Ga0207668_10063791 3300025972 Bacteria 2600
289 Ga0207668_10751311 3300025972 Bacteria 860
290 Ga0207640_10000920 3300025981 Bacteria 16509
291 Ga0207658_10007579 3300025986 Bacteria 7394
292 Ga0207658_10307397 3300025986 Bacteria 1368
293 Ga0207677_10001170 3300026023 Bacteria 14261
294 Ga0207677_10067731 3300026023 Bacteria 2502
295 Ga0207703_10018029 3300026035 Bacteria 5513
296 Ga0207703_10484620 3300026035 Bacteria 1159
297 Ga0207703_10889197 3300026035 Bacteria 853
298 Ga0207639_10072000 3300026041 Bacteria 2706
299 Ga0207639_10117959 3300026041 Bacteria 2175
300 Ga0207678_10003485 3300026067 Bacteria 14158
301 Ga0207708_10003132 3300026075 Bacteria 12174
302 Ga0207708_10078454 3300026075 Bacteria 2536
303 Ga0207648_10010874 3300026089 Bacteria 8603
304 Ga0207648_12208047 3300026089 Bacteria 511
305 Ga0207675_100000941 3300026118 Bacteria 29074
306 Ga0207675_100020330 3300026118 Bacteria 6189
307 Ga0207683_10027074 3300026121 Bacteria 4955
308 Ga0207698_10132787 3300026142 Bacteria 2131
309 Ga0207698_12700485 3300026142 Bacteria 505
310 Ga0268266_10033590 3300028379 Bacteria 4361
311 Ga0268266_10049602 3300028379 Bacteria 3600
312 Ga0268266_11983100 3300028379 Bacteria 556
313 Ga0268265_10005537 3300028380 Bacteria 8621
314 Ga0268264_10004799 3300028381 Bacteria 11468
315 Ga0268264_10168335 3300028381 Bacteria 1980
316 Ga0265327_10000081 3300031251 Bacteria 205988
317 Ga0265327_10009711 3300031251 Bacteria 6892
318 Ga0307408_102457974 3300031548 Bacteria 506
319 Ga0316579_10506410 3300031691 Bacteria 584
320 Ga0316578_10329255 3300031728 Bacteria 911
321 Ga0307406_10099386 3300031901 Bacteria 1978
322 Ga0307406_10412082 3300031901 Bacteria 1074
323 Ga0307406_11427850 3300031901 Bacteria 607
324 Ga0307416_103678548 3300032002 Bacteria 513
325 Ga0307414_12051271 3300032004 Bacteria 534
326 Ga0307415_100239738 3300032126 Bacteria 1466
327 Ga0373928_0064638 3300035084 Bacteria 892
328 Ga0373929_0220861 3300035085 Bacteria 539
329 Ga0373940_0145333 3300035088 Bacteria 752
330 Ga0373952_0250296 3300035092 Bacteria 536
331 Ga0373941_0139590 3300035115 Bacteria 880
332 Ga0373960_0249558 3300035121 Bacteria 644
333 Ga0373942_0073698 3300035207 Bacteria 1002
334 Ga0373961_0221235 3300035241 Bacteria 675
335 Ga0316574_0383710 3300035398 Bacteria 886
336 Ga0373931_0020790 3300035691 Bacteria 3286
337 Ga0373931_0662850 3300035691 Bacteria 686
338 Ga0316584_0120309 3300036712 Bacteria 1962
339 Ga0436364_0273491 3300037853 Bacteria 1628
340 Ga0436364_0610518 3300037853 Bacteria 13173
341 Ga0436364_1115493 3300037853 Bacteria 769
342 Ga0436365_0280180 3300039437 Bacteria 835
343 Ga0436365_1696994 3300039437 Bacteria 4160
344 Ga0436365_1896310 3300039437 Bacteria 4303
345 Ga0436360_0497156 3300039438 Bacteria 1076
346 Ga0436360_0729409 3300039438 Bacteria 501
347 Ga0436361_0638357 3300039447 Bacteria 553
348 Ga0436361_0897672 3300039447 Bacteria 832
349 Ga0436363_0130242 3300039450 Bacteria 2167
350 Ga0439461_0000435 3300041410 Bacteria 6003
351 Ga0439466_0017914 3300041411 Bacteria 2546
352 Ga0439465_0009389 3300041413 Bacteria 3080
353 Ga0439431_0002555 3300041997 Bacteria 4017
354 Ga0439445_0001715 3300042004 Bacteria 4820
355 Ga0439448_0297977 3300042005 Bacteria 572
356 Ga0439434_0020654 3300042435 Bacteria 1978
357 Ga0466969_0141606 3300044656 Bacteria 1111
358 Ga0466969_0394524 3300044656 Bacteria 628
359 Ga0466969_0516392 3300044656 Bacteria 546
360 Ga0466972_0022960 3300044658 Bacteria 3104
361 Ga0466972_0260320 3300044658 Bacteria 811
362 Ga0466972_0311424 3300044658 Bacteria 736
363 Ga0466965_0000977 3300044683 Bacteria 11071
364 Ga0466965_0008391 3300044683 Bacteria 4779
365 Ga0466965_0384490 3300044683 Bacteria 773
366 Ga0466966_0030434 3300044684 Bacteria 3506
367 Ga0466966_0033245 3300044684 Bacteria 3339
368 Ga0466961_0049072 3300044693 Bacteria 2698
369 Ga0466961_0202714 3300044693 Bacteria 1226
370 Ga0466963_0053388 3300044694 Bacteria 2683
371 Ga0466963_1307540 3300044694 Bacteria 509
372 Ga0466964_0126579 3300044706 Bacteria 1158
373 Ga0466964_0262692 3300044706 Bacteria 856
374 Ga0466964_0444635 3300044706 Bacteria 686
375 Ga0466964_0767852 3300044706 Bacteria 542
376 Ga0466971_0087548 3300044719 Bacteria 1424
377 Ga0466971_0229653 3300044719 Bacteria 881
378 Ga0466968_0001250 3300044735 Bacteria 9032
379 Ga0466968_0005889 3300044735 Bacteria 4602
380 Ga0466968_0141465 3300044735 Bacteria 1101
381 Ga0466968_0299122 3300044735 Bacteria 773
382 Ga0466970_0020643 3300044765 Bacteria 3424
383 Ga0466970_0136300 3300044765 Bacteria 1350
384 Ga0466970_0172418 3300044765 Bacteria 1199
385 Ga0466957_0004000 3300044842 Bacteria 8149
386 Ga0466957_0019061 3300044842 Bacteria 4034
387 Ga0466957_0145888 3300044842 Bacteria 1528
388 Ga0466957_0561008 3300044842 Bacteria 796
389 Ga0466957_0669524 3300044842 Bacteria 731
390 Ga0466960_0000150 3300044901 Bacteria 23737
391 Ga0466960_0015817 3300044901 Bacteria 3260
392 Ga0466959_0008385 3300045049 Bacteria 7304
393 Ga0466959_0008423 3300045049 Bacteria 7291
394 Ga0466959_0023497 3300045049 Bacteria 4561
395 Ga0466958_0036476 3300045836 Bacteria 2943
396 Ga0466958_0212903 3300045836 Bacteria 1232
397 Ga0466958_0429535 3300045836 Bacteria 854
398 Ga0466958_0437539 3300045836 Bacteria 846
399 Ga0466958_0643682 3300045836 Bacteria 690
400 Ga0466958_1087591 3300045836 Bacteria 522
401 Ga0466958_1098780 3300045836 Bacteria 519
402 Ga0466967_0002298 3300045976 Bacteria 11805
403 Ga0466967_0008237 3300045976 Bacteria 7615
404 Ga0466967_0011056 3300045976 Bacteria 6813
405 Ga0466967_0107084 3300045976 Bacteria 2564
406 Ga0466967_0257249 3300045976 Bacteria 1669
407 Ga0466967_1140213 3300045976 Bacteria 777
408 Ga0466967_1772513 3300045976 Bacteria 615
409 Ga0495638_0030522 3300046460 Bacteria 3469
410 Ga0495618_0588312 3300046514 Bacteria 663
411 Ga0495621_0519457 3300046539 Bacteria 515
412 Ga0495649_0378951 3300046694 Bacteria 712
413 Ga0495674_0758019 3300047319 Bacteria 758
414 Ga0495672_0077710 3300047320 Bacteria 1859
415 Ga0495602_0360943 3300048088 Bacteria 1046
416 Ga0495626_0179203 3300048091 Bacteria 879
417 Ga0496100_0027855 3300048903 Bacteria 3478
418 Ga0496100_0522999 3300048903 Bacteria 916
419 Ga0496100_0646190 3300048903 Bacteria 823
420 Ga0496101_0012357 3300048904 Bacteria 5697
421 Ga0496101_0030556 3300048904 Bacteria 3779
422 Ga0496101_0119027 3300048904 Bacteria 1995
423 Ga0496101_0143376 3300048904 Bacteria 1822
424 Ga0496101_0764148 3300048904 Bacteria 762
425 Ga0496102_0005951 3300048905 Bacteria 10387
426 Ga0496102_0173271 3300048905 Bacteria 2031
427 Ga0496102_0430388 3300048905 Bacteria 1239
428 Ga0496103_0000932 3300048906 Bacteria 20970
429 Ga0496104_0100919 3300048907 Bacteria 2763
430 Ga0496104_0221836 3300048907 Bacteria 1803
431 Ga0496104_0544049 3300048907 Bacteria 1072
432 Ga0496104_0580203 3300048907 Bacteria 1032
433 Ga0496105_0072825 3300048908 Bacteria 2839
434 Ga0496106_0009592 3300048909 Bacteria 7146
435 Ga0496106_0038341 3300048909 Bacteria 3585
436 Ga0496106_0081969 3300048909 Bacteria 2479
437 Ga0496106_0252927 3300048909 Bacteria 1409
438 Ga0496106_0325178 3300048909 Bacteria 1234
439 Ga0496106_1038721 3300048909 Bacteria 644
440 Ga0496107_0001310 3300048910 Bacteria 15256
441 Ga0496107_0208427 3300048910 Bacteria 1453
442 Ga0496108_0000404 3300048911 Bacteria 35603
443 Ga0496108_0129414 3300048911 Bacteria 2170
444 Ga0496108_0268994 3300048911 Bacteria 1483
445 Ga0496109_0000670 3300048912 Bacteria 28362
446 Ga0496109_0049676 3300048912 Bacteria 3820
447 Ga0496109_0610993 3300048912 Bacteria 1027
448 Ga0496110_0097586 3300048913 Bacteria 2633
449 Ga0496110_1013782 3300048913 Bacteria 738
450 Ga0496111_0490113 3300048914 Bacteria 905
451 Ga0496111_1298238 3300048914 Bacteria 513
452 Ga0496112_0068714 3300048915 Bacteria 3499
453 Ga0496112_0516874 3300048915 Bacteria 1129
454 Ga0496112_0795893 3300048915 Bacteria 870
455 Ga0496113_0043659 3300048916 Bacteria 3318
456 Ga0496114_0002700 3300048917 Bacteria 13558
457 Ga0496114_0169767 3300048917 Bacteria 1901
458 Ga0496114_0285102 3300048917 Bacteria 1457
459 Ga0496114_0694585 3300048917 Bacteria 893
460 Ga0496115_0020339 3300048918 Bacteria 5119
461 Ga0496115_0531507 3300048918 Bacteria 942
462 Ga0496115_0537960 3300048918 Bacteria 935
463 Ga0496117_0564341 3300048920 Bacteria 539
464 Ga0496119_0090437 3300048922 Bacteria 1741
465 Ga0496122_0024627 3300048925 Bacteria 5261
466 Ga0496123_0006092 3300048926 Bacteria 11831
467 Ga0496125_0395886 3300048928 Bacteria 809
468 Ga0496126_0006189 3300048929 Bacteria 13394
469 Ga0496126_0158087 3300048929 Bacteria 1938
470 Ga0501031_0261930 3300049568 Bacteria 1123
471 Ga0501032_0008663 3300049569 Bacteria 7413
472 Ga0501032_0016051 3300049569 Bacteria 5273
473 Ga0501032_0026234 3300049569 Bacteria 4010
474 Ga0501033_0088689 3300049570 Bacteria 2263
475 Ga0501033_0139368 3300049570 Bacteria 1754
476 Ga0501033_0170475 3300049570 Bacteria 1563
477 Ga0501034_0002996 3300049571 Bacteria 19542
478 Ga0501034_0013493 3300049571 Bacteria 8411
479 Ga0501034_0048428 3300049571 Bacteria 4289
480 Ga0501036_0009512 3300049572 Bacteria 7996
481 Ga0501036_0111723 3300049572 Bacteria 2309
482 Ga0501036_0555674 3300049572 Bacteria 954
483 Ga0501037_0005727 3300049573 Bacteria 9068
484 Ga0501037_0017959 3300049573 Bacteria 5206
485 Ga0501037_0079814 3300049573 Bacteria 2375
486 Ga0501038_0046860 3300049574 Bacteria 3746
487 Ga0501038_0334922 3300049574 Bacteria 1181
488 Ga0501038_0728780 3300049574 Bacteria 741
489 Ga0501039_0001425 3300049575 Bacteria 17614
490 Ga0501039_0772481 3300049575 Bacteria 750
491 Ga0501043_0000337 3300049579 Bacteria 42520
492 Ga0501043_0271960 3300049579 Bacteria 1300
493 Ga0501043_0532674 3300049579 Bacteria 874
494 Ga0501046_0008004 3300049580 Bacteria 9238
495 Ga0501047_0002406 3300049581 Bacteria 17883
496 Ga0501047_0012600 3300049581 Bacteria 8011
497 Ga0501047_0126125 3300049581 Bacteria 2440
498 Ga0501047_0276401 3300049581 Bacteria 1525
499 Ga0501048_0568694 3300049582 Bacteria 813
500 Ga0501048_1113764 3300049582 Bacteria 568
501 Ga0501067_0098142 3300049583 Bacteria 1627
502 Ga0501068_0057078 3300049584 Bacteria 2367
503 Ga0501069_0022738 3300049585 Bacteria 3414
504 Ga0501069_0035338 3300049585 Bacteria 2753
505 Ga0501070_0000642 3300049586 Bacteria 32168
506 Ga0501070_0005878 3300049586 Bacteria 10463
507 Ga0501070_0809585 3300049586 Bacteria 735
508 Ga0501071_0253507 3300049587 Bacteria 1329
509 Ga0501073_0016559 3300049589 Bacteria 5343
510 Ga0501077_0714166 3300049593 Bacteria 644
511 Ga0501080_0095347 3300049742 Bacteria 2763
512 Ga0501035_0000279 3300049822 Bacteria 60584
513 Ga0501035_0004831 3300049822 Bacteria 12782
514 Ga0501044_0000637 3300049823 Bacteria 42365
515 Ga0501044_0003653 3300049823 Bacteria 17312
516 Ga0501044_0014514 3300049823 Bacteria 8498
517 Ga0501044_0033874 3300049823 Bacteria 5363
518 Ga0501044_0071845 3300049823 Bacteria 3519
519 nmdc:mga03683_233901_c1 3300050489 Bacteria 850
520 nmdc:mga03683_258155_c1 3300050489 Bacteria 810
521 nmdc:mga03n38_778012_c1 3300050490 Bacteria 556
522 nmdc:mga03n38_83293_c1 3300050490 Bacteria 1508
523 nmdc:mga03n38_950027_c1 3300050490 Bacteria 507
524 nmdc:mga00v17_178913_c1 3300050491 Bacteria 958
525 nmdc:mga00v17_33218_c1 3300050491 Bacteria 2544
526 nmdc:mga00v17_3681_c1 3300050491 Bacteria 7919
527 nmdc:mga0yw44_104045_c1 3300050492 Bacteria 1811
528 nmdc:mga0yw44_155474_c1 3300050492 Bacteria 1494
529 nmdc:mga0yw44_181596_c1 3300050492 Bacteria 1385
530 nmdc:mga0yw44_28241_c1 3300050492 Bacteria 3225
531 nmdc:mga0yw44_516685_c1 3300050492 Bacteria 810
532 nmdc:mga07m45_25292_c1 3300050496 Bacteria 3255
533 nmdc:mga07m45_499923_c1 3300050496 Bacteria 704
534 nmdc:mga0sz30_26439_c2 3300050516 Bacteria 1991
535 nmdc:mga0sz30_505175_c1 3300050516 Bacteria 544
536 nmdc:mga0sz30_507492_c1 3300050516 Bacteria 543
537 Ga0495601_0845506 3300053077 Bacteria 580
538 Ga0500635_0005811 3300053080 Bacteria 3263
539 Ga0500635_0448813 3300053080 Bacteria 511
540 Ga0495655_0035940 3300053083 Bacteria 1236
541 Ga0500643_043243 3300053087 Bacteria 1314
542 Ga0500583_0450319 3300053092 Bacteria 611
543 Ga0500641_0042822 3300053096 Bacteria 1836
544 Ga0500641_0220558 3300053096 Bacteria 804
545 Ga0500594_0199295 3300053118 Bacteria 657
546 Ga0500652_000985 3300053131 Bacteria 9378
547 Ga0500652_022549 3300053131 Bacteria 2384
548 Ga0500559_0164184 3300053136 Bacteria 1044
549 Ga0500559_0438984 3300053136 Bacteria 604
550 Ga0500568_0304617 3300053139 Bacteria 578
551 Ga0500622_0427570 3300053156 Bacteria 532
552 Ga0500627_0050332 3300053158 Bacteria 1814
553 Ga0500645_000030 3300053730 Bacteria 121213
554 Ga0500645_040989 3300053730 Bacteria 1368
555 Ga0466962_0011963 3300061719 Bacteria 4174
556 Ga0466962_0013769 3300061719 Bacteria 3894
557 Ga0466962_0236493 3300061719 Bacteria 896
558 2644633764 2643221715 Bacteria 6671032
559 2738665130 2738541264 Bacteria 5935393
560 2738707618 2738541274 Bacteria 6909446
561 2739144264 2738541356 Bacteria 5935017
562 2739332630 2738543028 Bacteria 6917070
563 2753038653 2751185725 Bacteria 5740550
564 2753327165 2751185792 Bacteria 5739090
565 2902801032 2902799365 Bacteria 5419524
566 2902814942 2902810491 Bacteria 6794147
567 2929215511 2929212328 Bacteria 7708288
568 Ga0075364_10015848
569 JGI24739J22299_10149906
570 JGI24743J22301_10013785
571 JGI24743J22301_10026481
572 JGI24750J21931_1064298
573 JGI24745J21846_1005539
574 JGI24745J21846_1023849
575 JGI24748J21848_1003107
576 JGI24738J21930_10031244
577 JGI24749J21850_1036210
578 JGI24744J21845_10000326
579 JGI24744J21845_10007820
580 JGI24034J26672_10002872
581 JGI24034J26672_10065718
582 JGI24034J26672_10109193
583 JGI24742J22300_10034482
584 JGI24742J22300_10035213
585 Ga0070676_10005389
586 Ga0070690_100093070
587 Ga0070677_10277549
588 Ga0068869_100022937
589 Ga0068869_100304569
590 Ga0068869_101962096
591 Ga0070666_10070086
592 Ga0070666_10571337
593 Ga0070680_100346574
594 Ga0070682_100073685
595 Ga0070682_100908613
596 Ga0068868_100005485
597 Ga0070660_100340161
598 Ga0070660_100440923
599 Ga0070660_100487332
600 Ga0070689_100093245
601 Ga0070689_102154154
602 Ga0070691_10001448
603 Ga0070691_10036792
604 Ga0070661_101358241
605 Ga0070692_10203194
606 Ga0070668_100000568
607 Ga0070668_100158634
608 Ga0070668_100964326
609 Ga0070668_101999122
610 Ga0070668_102214655
611 Ga0070669_100009018
612 Ga0070671_100447989
613 Ga0070674_100208716
614 Ga0070674_100228360
615 Ga0070673_100136666
616 Ga0070688_100015882
617 Ga0070688_101481042
618 Ga0070659_100099965
619 Ga0070659_100509377
620 Ga0070667_100018217
621 Ga0070667_100066477
622 Ga0070667_100218834
623 Ga0070709_11009046
624 Ga0070714_100043677
625 Ga0070714_100234486
626 Ga0070714_100399721
627 Ga0070714_100582117
628 Ga0070714_101695198
629 Ga0070713_100114593
630 Ga0070713_100691974
631 Ga0070710_10000932
632 Ga0070710_10034170
633 Ga0070710_10073090
634 Ga0070701_10003743
635 Ga0070711_100001643
636 Ga0070711_100876414
637 Ga0070705_100073895
638 Ga0070705_101444344
639 Ga0070700_100002582
640 Ga0070700_100736146
641 Ga0070694_100583328
642 Ga0070663_100094540
643 Ga0070663_100383312
644 Ga0070678_100070238
645 Ga0070678_100103789
646 Ga0070678_100255189
647 Ga0070678_100378025
648 Ga0070662_100539258
649 Ga0070662_101321408
650 Ga0068867_100010113
651 Ga0068867_101379143
652 Ga0070685_10218105
653 Ga0070697_100167052
654 Ga0068853_100010926
655 Ga0068853_100360912
656 Ga0070672_101695381
657 Ga0070686_100271670
658 Ga0070695_100027005
659 Ga0070695_100116189
660 Ga0070696_100017971
661 Ga0070693_100012592
662 Ga0070693_101085200
663 Ga0070665_100027133
664 Ga0070665_100034595
665 Ga0070665_102091460
666 Ga0070704_100012664
667 Ga0070704_100368931
668 Ga0068855_100039696
669 Ga0068855_101779329
670 Ga0068854_100000704
671 Ga0068854_100602011
672 Ga0068854_101396440
673 Ga0068856_100269132
674 Ga0068856_101855566
675 Ga0070702_100027914
676 Ga0070702_100091423
677 Ga0070702_100421505
678 Ga0070702_101773115
679 Ga0068852_100080920
680 Ga0068852_100094052
681 Ga0068859_100005722
682 Ga0068859_100198524
683 Ga0068859_102217843
684 Ga0068864_101001874
685 Ga0068866_10001957
686 Ga0068866_10132306
687 Ga0068861_100000622
688 Ga0068861_100118366
689 Ga0068851_10102500
690 Ga0068858_100102636
691 Ga0068858_100535183
692 Ga0068858_100902568
693 Ga0068860_100013606
694 Ga0068860_100344139
695 Ga0068860_100417454
696 Ga0068860_102788905
697 Ga0068862_100030020
698 Ga0070717_11821895
699 Ga0075365_10011492
700 Ga0075365_10114963
701 Ga0075365_10560495
702 Ga0075365_10673062
703 Ga0075363_100094957
704 Ga0075363_100165959
705 Ga0075363_100296835
706 Ga0075364_10049989
707 Ga0075364_10213810
708 Ga0075364_10288613
709 Ga0075364_10655135
710 Ga0070715_10066647
711 Ga0070716_100008355
712 Ga0070716_100352951
713 Ga0070716_100543756
714 Ga0070716_100686072
715 Ga0070712_100017986
716 Ga0070712_100098504
717 Ga0075362_10007434
718 Ga0075369_10058053
719 Ga0075369_10064045
720 Ga0075369_10570179
721 Ga0097621_100896590
722 Ga0075370_10045795
723 Ga0068871_100276916
724 Ga0068865_100004019
725 Ga0068865_100035559
726 Ga0097620_100005722
727 Ga0097620_100198530
728 Ga0097620_102217525
729 Ga0105250_10139696
730 Ga0105240_10104635
731 Ga0105240_11005306
732 Ga0111539_12317784
733 Ga0105245_10007406
734 Ga0105245_10187766
735 Ga0105245_10942767
736 Ga0105247_10003220
737 Ga0105247_10164368
738 Ga0105247_10940859
739 Ga0105243_10007329
740 Ga0105243_10082248
741 Ga0105243_11495025
742 Ga0105243_12843284
743 Ga0105241_10025326
744 Ga0105241_10755396
745 Ga0105242_10001104
746 Ga0105242_12618241
747 Ga0105248_10010806
748 Ga0105237_10030464
749 Ga0105237_11395220
750 Ga0105237_12568820
751 Ga0105238_10210781
752 Ga0105249_10000571
753 Ga0105249_10032430
754 Ga0105239_10394117
755 Ga0105239_10873966
756 Ga0105246_10023371
757 Ga0105246_11304378
758 Ga0157373_11292926
759 Ga0157371_10455848
760 Ga0157369_10122651
761 Ga0157369_10336002
762 Ga0157369_11006439
763 Ga0157378_10043733
764 Ga0157378_10232121
765 Ga0163162_10137615
766 Ga0163162_12682781
767 Ga0157372_11368680
768 Ga0157375_10042543
769 Ga0157375_10899181
770 Ga0157375_12752539
771 Ga0163163_10465955
772 Ga0163163_10777345
773 Ga0163163_11198006
774 Ga0157380_10000597
775 Ga0182008_10514743
776 Ga0157377_10047699
777 Ga0157377_10266754
778 Ga0157379_10018092
779 Ga0157379_10252695
780 Ga0157379_10556392
781 Ga0157376_10907174
782 Ga0163161_10006021
783 Ga0163161_10578724
784 Ga0209051_1096263
785 Ga0207697_10390295
786 Ga0207656_10154169
787 Ga0207653_10033595
788 Ga0207692_10007629
789 Ga0207692_10066799
790 Ga0207692_10189941
791 Ga0207642_10000205
792 Ga0207710_10004260
793 Ga0207710_10107289
794 Ga0207710_10333284
795 Ga0207688_10003825
796 Ga0207688_10004459
797 Ga0207680_10241784
798 Ga0207647_10013855
799 Ga0207647_10032885
800 Ga0207647_10236297
801 Ga0207685_10045627
802 Ga0207699_10079667
803 Ga0207645_10023364
804 Ga0207645_10075446
805 Ga0207643_10979186
806 Ga0207654_10016336
807 Ga0207654_10938003
808 Ga0207695_11494871
809 Ga0207671_10063989
810 Ga0207693_10000705
811 Ga0207693_10014488
812 Ga0207663_10012077
813 Ga0207663_10036477
814 Ga0207663_10223299
815 Ga0207660_10212161
816 Ga0207662_10042550
817 Ga0207657_10264694
818 Ga0207681_10019220
819 Ga0207694_10407905
820 Ga0207694_10752049
821 Ga0207659_10645944
822 Ga0207659_11221445
823 Ga0207687_10002750
824 Ga0207687_10245396
825 Ga0207700_10761709
826 Ga0207664_10116929
827 Ga0207664_10881835
828 Ga0207664_11108804
829 Ga0207644_10484073
830 Ga0207690_10157873
831 Ga0207706_10122796
832 Ga0207706_10142306
833 Ga0207686_10040315
834 Ga0207686_11613863
835 Ga0207709_10008492
836 Ga0207709_10383785
837 Ga0207670_11524807
838 Ga0207669_10000318
839 Ga0207669_10013923
840 Ga0207669_10596041
841 Ga0207704_10001564
842 Ga0207665_10136793
843 Ga0207665_10501737
844 Ga0207691_10497271
845 Ga0207711_10072577
846 Ga0207711_10336827
847 Ga0207711_10556838
848 Ga0207689_10008722
849 Ga0207689_10052197
850 Ga0207679_12120200
851 Ga0207667_10084343
852 Ga0207651_10192997
853 Ga0207712_10097042
854 Ga0207712_10147110
855 Ga0207668_10063791
856 Ga0207668_10751311
857 Ga0207640_10000920
858 Ga0207658_10007579
859 Ga0207658_10307397
860 Ga0207677_10001170
861 Ga0207677_10067731
862 Ga0207703_10018029
863 Ga0207703_10484620
864 Ga0207703_10889197
865 Ga0207639_10072000
866 Ga0207639_10117959
867 Ga0207678_10003485
868 Ga0207708_10003132
869 Ga0207708_10078454
870 Ga0207648_10010874
871 Ga0207648_12208047
872 Ga0207675_100000941
873 Ga0207675_100020330
874 Ga0207683_10027074
875 Ga0207698_10132787
876 Ga0207698_12700485
877 Ga0268266_10033590
878 Ga0268266_10049602
879 Ga0268266_11983100
880 Ga0268265_10005537
881 Ga0268264_10004799
882 Ga0268264_10168335
883 Ga0265327_10000081
884 Ga0265327_10009711
885 Ga0307408_102457974
886 Ga0316579_10506410
887 Ga0316578_10329255
888 Ga0307406_10099386
889 Ga0307406_10412082
890 Ga0307406_11427850
891 Ga0307416_103678548
892 Ga0307414_12051271
893 Ga0307415_100239738
894 Ga0373928_0064638
895 Ga0373929_0220861
896 Ga0373940_0145333
897 Ga0373952_0250296
898 Ga0373941_0139590
899 Ga0373960_0249558
900 Ga0373942_0073698
901 Ga0373961_0221235
902 Ga0316574_0383710
903 Ga0373931_0020790
904 Ga0373931_0662850
905 Ga0316584_0120309
906 Ga0436364_0273491
907 Ga0436364_0610518
908 Ga0436364_1115493
909 Ga0436365_0280180
910 Ga0436365_1696994
911 Ga0436365_1896310
912 Ga0436360_0497156
913 Ga0436360_0729409
914 Ga0436361_0638357
915 Ga0436361_0897672
916 Ga0436363_0130242
917 Ga0439461_0000435
918 Ga0439466_0017914
919 Ga0439465_0009389
920 Ga0439431_0002555
921 Ga0439445_0001715
922 Ga0439448_0297977
923 Ga0439434_0020654
924 Ga0466969_0141606
925 Ga0466969_0394524
926 Ga0466969_0516392
927 Ga0466972_0022960
928 Ga0466972_0260320
929 Ga0466972_0311424
930 Ga0466965_0000977
931 Ga0466965_0008391
932 Ga0466965_0384490
933 Ga0466966_0030434
934 Ga0466966_0033245
935 Ga0466961_0049072
936 Ga0466961_0202714
937 Ga0466963_0053388
938 Ga0466963_1307540
939 Ga0466964_0126579
940 Ga0466964_0262692
941 Ga0466964_0444635
942 Ga0466964_0767852
943 Ga0466971_0087548
944 Ga0466971_0229653
945 Ga0466968_0001250
946 Ga0466968_0005889
947 Ga0466968_0141465
948 Ga0466968_0299122
949 Ga0466970_0020643
950 Ga0466970_0136300
951 Ga0466970_0172418
952 Ga0466957_0004000
953 Ga0466957_0019061
954 Ga0466957_0145888
955 Ga0466957_0561008
956 Ga0466957_0669524
957 Ga0466960_0000150
958 Ga0466960_0015817
959 Ga0466959_0008385
960 Ga0466959_0008423
961 Ga0466959_0023497
962 Ga0466958_0036476
963 Ga0466958_0212903
964 Ga0466958_0429535
965 Ga0466958_0437539
966 Ga0466958_0643682
967 Ga0466958_1087591
968 Ga0466958_1098780
969 Ga0466967_0002298
970 Ga0466967_0008237
971 Ga0466967_0011056
972 Ga0466967_0107084
973 Ga0466967_0257249
974 Ga0466967_1140213
975 Ga0466967_1772513
976 Ga0495638_0030522
977 Ga0495618_0588312
978 Ga0495621_0519457
979 Ga0495649_0378951
980 Ga0495674_0758019
981 Ga0495672_0077710
982 Ga0495602_0360943
983 Ga0495626_0179203
984 Ga0496100_0027855
985 Ga0496100_0522999
986 Ga0496100_0646190
987 Ga0496101_0012357
988 Ga0496101_0030556
989 Ga0496101_0119027
990 Ga0496101_0143376
991 Ga0496101_0764148
992 Ga0496102_0005951
993 Ga0496102_0173271
994 Ga0496102_0430388
995 Ga0496103_0000932
996 Ga0496104_0100919
997 Ga0496104_0221836
998 Ga0496104_0544049
999 Ga0496104_0580203
1000 Ga0496105_0072825
1001 Ga0496106_0009592
1002 Ga0496106_0038341
1003 Ga0496106_0081969
1004 Ga0496106_0252927
1005 Ga0496106_0325178
1006 Ga0496106_1038721
1007 Ga0496107_0001310
1008 Ga0496107_0208427
1009 Ga0496108_0000404
1010 Ga0496108_0129414
1011 Ga0496108_0268994
1012 Ga0496109_0000670
1013 Ga0496109_0049676
1014 Ga0496109_0610993
1015 Ga0496110_0097586
1016 Ga0496110_1013782
1017 Ga0496111_0490113
1018 Ga0496111_1298238
1019 Ga0496112_0068714
1020 Ga0496112_0516874
1021 Ga0496112_0795893
1022 Ga0496113_0043659
1023 Ga0496114_0002700
1024 Ga0496114_0169767
1025 Ga0496114_0285102
1026 Ga0496114_0694585
1027 Ga0496115_0020339
1028 Ga0496115_0531507
1029 Ga0496115_0537960
1030 Ga0496117_0564341
1031 Ga0496119_0090437
1032 Ga0496122_0024627
1033 Ga0496123_0006092
1034 Ga0496125_0395886
1035 Ga0496126_0006189
1036 Ga0496126_0158087
1037 Ga0501031_0261930
1038 Ga0501032_0008663
1039 Ga0501032_0016051
1040 Ga0501032_0026234
1041 Ga0501033_0088689
1042 Ga0501033_0139368
1043 Ga0501033_0170475
1044 Ga0501034_0002996
1045 Ga0501034_0013493
1046 Ga0501034_0048428
1047 Ga0501036_0009512
1048 Ga0501036_0111723
1049 Ga0501036_0555674
1050 Ga0501037_0005727
1051 Ga0501037_0017959
1052 Ga0501037_0079814
1053 Ga0501038_0046860
1054 Ga0501038_0334922
1055 Ga0501038_0728780
1056 Ga0501039_0001425
1057 Ga0501039_0772481
1058 Ga0501043_0000337
1059 Ga0501043_0271960
1060 Ga0501043_0532674
1061 Ga0501046_0008004
1062 Ga0501047_0002406
1063 Ga0501047_0012600
1064 Ga0501047_0126125
1065 Ga0501047_0276401
1066 Ga0501048_0568694
1067 Ga0501048_1113764
1068 Ga0501067_0098142
1069 Ga0501068_0057078
1070 Ga0501069_0022738
1071 Ga0501069_0035338
1072 Ga0501070_0000642
1073 Ga0501070_0005878
1074 Ga0501070_0809585
1075 Ga0501071_0253507
1076 Ga0501073_0016559
1077 Ga0501077_0714166
1078 Ga0501080_0095347
1079 Ga0501035_0000279
1080 Ga0501035_0004831
1081 Ga0501044_0000637
1082 Ga0501044_0003653
1083 Ga0501044_0014514
1084 Ga0501044_0033874
1085 Ga0501044_0071845
1086 nmdc:mga03683_233901_c1
1087 nmdc:mga03683_258155_c1
1088 nmdc:mga03n38_778012_c1
1089 nmdc:mga03n38_83293_c1
1090 nmdc:mga03n38_950027_c1
1091 nmdc:mga00v17_178913_c1
1092 nmdc:mga00v17_33218_c1
1093 nmdc:mga00v17_3681_c1
1094 nmdc:mga0yw44_104045_c1
1095 nmdc:mga0yw44_155474_c1
1096 nmdc:mga0yw44_181596_c1
1097 nmdc:mga0yw44_28241_c1
1098 nmdc:mga0yw44_516685_c1
1099 nmdc:mga07m45_25292_c1
1100 nmdc:mga07m45_499923_c1
1101 nmdc:mga0sz30_26439_c2
1102 nmdc:mga0sz30_505175_c1
1103 nmdc:mga0sz30_507492_c1
1104 Ga0495601_0845506
1105 Ga0500635_0005811
1106 Ga0500635_0448813
1107 Ga0495655_0035940
1108 Ga0500643_043243
1109 Ga0500583_0450319
1110 Ga0500641_0042822
1111 Ga0500641_0220558
1112 Ga0500594_0199295
1113 Ga0500652_000985
1114 Ga0500652_022549
1115 Ga0500559_0164184
1116 Ga0500559_0438984
1117 Ga0500568_0304617
1118 Ga0500622_0427570
1119 Ga0500627_0050332
1120 Ga0500645_000030
1121 Ga0500645_040989
1122 Ga0466962_0011963
1123 Ga0466962_0013769
1124 Ga0466962_0236493
1125 2644633764
1126 2738665130
1127 2738707618
1128 2739144264
1129 2739332630
1130 2753038653
1131 2753327165
1132 2902801032
1133 2902814942
1134 2929215511

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1y13-assembly1.cif.gz_A structural analysis of plasmodium falciparum 6-pyruvoyl tetrahydropterin synthase (ptps) 0.6823 43 63
6bzi-assembly4.cif.gz_D crystal structure of halogenase pltm in complex with ethyl mercury and mercury 0.6806 42 63
3m0n-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37a catalytic residue mutant 0.6788 43 63
3lze-assembly1.cif.gz_A plasmodium vivax 6-pyruvoyltetrahydropterin synthase (ptps), e37c catalytic residue mutant 0.6761 43 63
2a0s-assembly1.cif.gz_A crystal structure of 6-pyruvoyl tetrahydropterin synthase (ptps) from plasmodium vivax at 2.2 a resolution 0.675 43 63
ID Description Score Start End Superfamily
af_P37339_4_262_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.733 45 63 3.50.50.60
af_P56329_165_306_3.30.30.170 Alpha Beta;2-Layer Sandwich;Defensin A-like; 0.6691 34 63 3.30.30.170
1y13C00 Alpha Beta;2-Layer Sandwich;Tetrahydropterin Synthase; Chain A;6-pyruvoyl tetrahydropterin synthase/QueD 0.6613 43 63 3.30.479.10
af_Q4DY34_22_339_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6521 42 63 2.130.10.10
af_Q0WVA1_111_488_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.6487 40 65 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A554UZK3-F1-model_v4 Aminotransferase 0.9628 7 70
AF-A0A838A0K4-F1-model_v4 Aminotransferase 0.9606 9 70
AF-A0A0U0W6Y6-F1-model_v4 Aminotransferase 0.9593 8 68
AF-G7CAV0-F1-model_v4 Aminotransferase 0.9499 10 67
AF-A0A2N0X568-F1-model_v4 Aminotransferase 0.9429 10 68

Map